AlfalfaGEDB | MsaG001093

M. sativa ssp. caerulea / MsaG001093

KEGG: K03321 K08065
GO: -
PFAM: PF00808.26

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG001093	XP_013466407.1	73.109	119	23	1	48	157	40	158	1.50e-53	178

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG001093	sp\|O23310\|NFYB3_ARATH	56.989	93	40	0	56	148	17	109	1.15e-31	114

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG001093	tr\|A0A072VGA7\|A0A072VGA7_MEDTR	73.109	119	23	1	48	157	40	158	7.16e-54	178

TFs/TRs:

Gene ID	Type	Classification
MsaG001093	TF	NF-YB

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000792	MsaG001093	0.829695	8.004295e-55	2.296342e-52
MsaG000881	MsaG001093	0.811076	1.437150e-50	2.519593e-48
MsaG000999	MsaG001093	0.826710	4.163278e-54	1.098134e-51
MsaG001373	MsaG001093	0.847542	2.044763e-59	1.019702e-56
MsaG001936	MsaG001093	0.809147	3.727293e-50	6.235438e-48
MsaG002114	MsaG001093	0.817705	5.000357e-52	1.035737e-49
MsaG002884	MsaG001093	0.817477	5.622869e-52	1.157956e-49
MsaG003605	MsaG001093	0.857755	2.563118e-62	1.831465e-59
MsaG003615	MsaG001093	0.819195	2.306255e-52	4.965878e-50
MsaG003646	MsaG001093	0.884920	2.732039e-71	6.232839e-68
MsaG004165	MsaG001093	0.839349	3.080772e-57	1.178248e-54
MsaG004466	MsaG001093	0.881086	6.812899e-70	1.293368e-66
MsaG004686	MsaG001093	0.825872	6.576410e-54	1.694712e-51
MsaG004967	MsaG001093	0.834173	6.348196e-56	2.074391e-53
MsaG005213	MsaG001093	0.814746	2.276537e-51	4.372640e-49
MsaG005631	MsaG001093	0.805544	2.145236e-49	3.293622e-47
MsaG006002	MsaG001093	0.831106	3.630245e-55	1.084457e-52
MsaG006186	MsaG001093	0.850813	2.540749e-60	1.416229e-57
MsaG006831	MsaG001093	0.820228	1.342721e-52	2.971198e-50
MsaG007317	MsaG001093	0.836181	1.988393e-56	6.900476e-54
MsaG007375	MsaG001093	0.817868	4.594240e-52	9.556750e-50
MsaG008367	MsaG001093	0.851946	1.219639e-60	7.071918e-58
MsaG009256	MsaG001093	0.820893	9.461421e-53	2.130685e-50
MsaG009270	MsaG001093	0.838813	4.235306e-57	1.593185e-54
MsaG009478	MsaG001093	0.846740	3.384807e-59	1.643179e-56
MsaG010891	MsaG001093	0.832589	1.569785e-55	4.896012e-53
MsaG011199	MsaG001093	0.800968	1.881525e-48	2.600062e-46
MsaG011238	MsaG001093	0.825029	1.038775e-53	2.615187e-51
MsaG011389	MsaG001093	0.823781	2.035258e-53	4.952679e-51
MsaG011650	MsaG001093	0.802889	7.615599e-49	1.099477e-46
MsaG012161	MsaG001093	0.815424	1.612510e-51	3.150752e-49
MsaG041955	MsaG001093	0.817347	6.012785e-52	1.234089e-49
MsaG044267	MsaG001093	0.839206	3.355049e-57	1.277485e-54
MsaG044277	MsaG001093	0.883773	7.236683e-71	1.562052e-67
MsaG044851	MsaG001093	0.864483	2.347165e-64	2.172189e-61
MsaG044867	MsaG001093	0.813572	4.122427e-51	7.688328e-49
MsaG045143	MsaG001093	0.843845	2.037780e-58	8.989852e-56
MsaG045187	MsaG001093	0.843972	1.884068e-58	8.345618e-56
MsaG045665	MsaG001093	0.838775	4.332050e-57	1.627588e-54
MsaG045776	MsaG001093	0.866522	5.385614e-65	5.408540e-62
MsaG046056	MsaG001093	0.820919	9.333660e-53	2.103397e-50
MsaG046480	MsaG001093	0.802911	7.536454e-49	1.088599e-46
MsaG046766	MsaG001093	0.808412	5.341452e-50	8.778971e-48
MsaG046805	MsaG001093	0.833567	8.986297e-56	2.884429e-53
MsaG002246	MsaG001093	0.862098	1.275058e-63	1.074169e-60
MsaG001093	MsaG001536	0.848111	1.427470e-59	7.255980e-57
MsaG001093	MsaG009684	0.803878	4.761626e-49	7.033370e-47
MsaG001093	MsaG013680	0.827704	2.412717e-54	6.543324e-52
MsaG001093	MsaG018733	0.806405	1.416950e-49	2.220161e-47
MsaG001093	MsaG020996	0.852284	9.785985e-61	5.741744e-58
MsaG001093	MsaG023045	0.804954	2.848190e-49	4.313402e-47
MsaG001093	MsaG028128	0.845740	6.318971e-59	2.967192e-56
MsaG001093	MsaG026524	0.803730	5.108535e-49	7.520244e-47
MsaG001093	MsaG033667	0.860424	4.102532e-63	3.242159e-60
MsaG001093	MsaG031339	0.817372	5.936714e-52	1.219260e-49
MsaG001093	MsaG030876	0.801987	1.165847e-48	1.648768e-46
MsaG001093	MsaG039370	0.829542	8.715551e-55	2.489517e-52
MsaG001093	MsaG037437	0.823590	2.254857e-53	5.458713e-51
MsaG001093	MsaG037837	0.826384	4.974550e-54	1.300273e-51
MsaG001093	MsaG043567	0.840433	1.612984e-57	6.382940e-55
MsaG001093	MsaG041132	0.819802	1.678620e-52	3.672470e-50
MsaG012887	MsaG001093	0.819421	2.049090e-52	4.438412e-50
MsaG013633	MsaG001093	0.805649	2.040114e-49	3.139971e-47
MsaG014630	MsaG001093	0.829073	1.131763e-54	3.189601e-52
MsaG014642	MsaG001093	0.840609	1.451762e-57	5.776556e-55
MsaG014841	MsaG001093	0.813382	4.537978e-51	8.422924e-49
MsaG014945	MsaG001093	0.819984	1.526586e-52	3.356096e-50
MsaG016687	MsaG001093	0.848833	9.033142e-60	4.704435e-57
MsaG016801	MsaG001093	0.827304	3.005401e-54	8.059757e-52
MsaG016982	MsaG001093	0.855807	9.537490e-62	6.343969e-59
MsaG017243	MsaG001093	0.817817	4.717666e-52	9.800708e-50
MsaG017405	MsaG001093	0.823573	2.276271e-53	5.507771e-51
MsaG018504	MsaG001093	0.825701	7.216419e-54	1.850783e-51
MsaG018539	MsaG001093	0.815136	1.867479e-51	3.622270e-49
MsaG019034	MsaG001093	0.852250	1.000242e-60	5.861617e-58
MsaG019071	MsaG001093	0.854782	1.889898e-61	1.211426e-58
MsaG019268	MsaG001093	0.811892	9.576183e-51	1.712811e-48
MsaG019276	MsaG001093	0.821037	8.772307e-53	1.983085e-50
MsaG019453	MsaG001093	0.800743	2.089944e-48	2.873592e-46
MsaG019641	MsaG001093	0.844905	1.060295e-58	4.844336e-56
MsaG020042	MsaG001093	0.846333	4.364583e-59	2.090209e-56
MsaG020257	MsaG001093	0.800798	2.036607e-48	2.803752e-46
MsaG020423	MsaG001093	0.802173	1.068081e-48	1.516904e-46
MsaG020552	MsaG001093	0.816259	1.052021e-51	2.099672e-49
MsaG021109	MsaG001093	0.804509	3.522990e-49	5.280519e-47
MsaG022404	MsaG001093	0.825086	1.007384e-53	2.540067e-51
MsaG022540	MsaG001093	0.826232	5.405426e-54	1.406890e-51
MsaG022793	MsaG001093	0.812922	5.717411e-51	1.049081e-48
MsaG023554	MsaG001093	0.808396	5.384918e-50	8.846842e-48
MsaG024058	MsaG001093	0.828126	1.911931e-54	5.247057e-52
MsaG024380	MsaG001093	0.817289	6.197702e-52	1.270161e-49
MsaG027021	MsaG001093	0.856155	7.556486e-62	5.090704e-59
MsaG027217	MsaG001093	0.842413	4.884071e-58	2.058139e-55
MsaG027424	MsaG001093	0.801008	1.846400e-48	2.553847e-46
MsaG027408	MsaG001093	0.852235	1.010626e-60	5.919184e-58
MsaG027679	MsaG001093	0.818921	2.659684e-52	5.685798e-50
MsaG028625	MsaG001093	0.813147	5.105835e-51	9.421365e-49
MsaG029352	MsaG001093	0.809400	3.290114e-50	5.537789e-48
MsaG030201	MsaG001093	0.865208	1.395055e-64	1.329136e-61
MsaG032127	MsaG001093	0.843358	2.745112e-58	1.192390e-55
MsaG032378	MsaG001093	0.811913	9.478138e-51	1.696173e-48
MsaG033932	MsaG001093	0.806636	1.267161e-49	1.996325e-47
MsaG034552	MsaG001093	0.807232	9.493903e-50	1.516763e-47
MsaG035157	MsaG001093	0.825438	8.323911e-54	2.119243e-51
MsaG035269	MsaG001093	0.810567	1.850382e-50	3.203898e-48
MsaG036431	MsaG001093	0.812205	8.191627e-51	1.476424e-48
MsaG040599	MsaG001093	0.809955	2.503424e-50	4.270487e-48

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG001093	MtrunA17_Chr1g0159271	77.419	93	12	1	74	157	1	93	5.67e-46	146
MsaG001093	MtrunA17_Chr1g0185911	51.852	108	49	1	56	160	25	132	2.53e-32	114
MsaG001093	MtrunA17_Chr8g0382931	53.333	105	39	1	54	148	12	116	4.03e-32	114
MsaG001093	MtrunA17_Chr7g0263601	47.706	109	55	1	59	167	25	131	7.91e-31	109
MsaG001093	MtrunA17_Chr5g0446491	54.839	93	41	1	56	148	20	111	1.84e-30	109
MsaG001093	MtrunA17_Chr1g0165041	52.222	90	43	0	59	148	5	94	2.75e-30	108
MsaG001093	MtrunA17_Chr3g0102351	54.839	93	41	1	56	148	24	115	9.09e-30	107
MsaG001093	MtrunA17_Chr2g0290491	54.444	90	41	0	59	148	16	105	9.34e-30	107
MsaG001093	MtrunA17_Chr4g0076321	55.952	84	37	0	65	148	24	107	7.55e-28	101
MsaG001093	MtrunA17_Chr8g0384451	51.765	85	41	0	65	149	45	129	5.25e-27	101
MsaG001093	MtrunA17_Chr4g0076381	48.889	90	46	0	59	148	57	146	9.33e-27	101
MsaG001093	MtrunA17_Chr1g0195851	51.190	84	41	0	65	148	41	124	5.71e-26	98.2
MsaG001093	MtrunA17_Chr4g0067091	44.660	103	56	1	46	148	9	110	3.38e-25	96.7
MsaG001093	MtrunA17_Chr2g0296321	47.619	84	44	0	65	148	71	154	7.51e-24	94.0
MsaG001093	MtrunA17_Chr1g0158951	52.326	86	32	1	91	167	20	105	1.43e-23	89.4
MsaG001093	MtrunA17_Chr1g0159291	45.000	80	44	0	61	140	3	82	1.21e-22	86.7
MsaG001093	MtrunA17_Chr1g0191981	41.667	84	49	0	65	148	9	92	3.44e-21	84.0
MsaG001093	MtrunA17_Chr5g0446601	35.632	87	56	0	65	151	29	115	2.05e-13	65.1

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG001093	AT4G14540.1	56.989	93	40	0	56	148	17	109	1.17e-32	114
MsaG001093	AT2G38880.7	50.000	112	52	2	55	166	16	123	8.48e-32	111
MsaG001093	AT2G38880.3	50.000	112	54	2	55	166	16	125	9.01e-32	111
MsaG001093	AT2G38880.2	50.000	112	54	2	55	166	16	125	1.10e-31	111
MsaG001093	AT2G38880.1	50.000	112	54	2	55	166	16	125	1.10e-31	111
MsaG001093	AT2G38880.5	50.000	112	54	2	55	166	16	125	1.10e-31	111
MsaG001093	AT5G47640.1	55.319	94	41	1	56	149	24	116	7.70e-31	110
MsaG001093	AT3G53340.5	46.429	112	60	0	59	170	28	139	9.03e-31	110
MsaG001093	AT3G53340.1	46.429	112	60	0	59	170	28	139	9.03e-31	110
MsaG001093	AT2G38880.4	50.000	94	47	0	55	148	16	109	4.07e-30	106
MsaG001093	AT2G38880.11	50.000	94	47	0	55	148	16	109	1.42e-29	106
MsaG001093	AT2G38880.8	50.000	94	47	0	55	148	16	109	1.42e-29	106
MsaG001093	AT2G38880.9	50.000	94	47	0	55	148	16	109	2.04e-29	106
MsaG001093	AT2G38880.10	50.000	94	47	0	55	148	16	109	2.04e-29	106
MsaG001093	AT2G38880.6	50.000	94	47	0	55	148	16	109	2.04e-29	106
MsaG001093	AT2G37060.2	47.458	118	56	2	59	170	29	146	2.10e-29	106
MsaG001093	AT2G37060.3	47.458	118	56	2	59	170	29	146	2.10e-29	106
MsaG001093	AT2G37060.1	47.458	118	56	2	59	170	29	146	2.10e-29	106
MsaG001093	AT3G53340.4	52.222	90	43	0	59	148	28	117	2.27e-29	105
MsaG001093	AT3G53340.3	51.648	91	44	0	58	148	27	117	1.43e-28	103
MsaG001093	AT3G53340.2	51.648	91	44	0	58	148	27	117	1.43e-28	103
MsaG001093	AT2G13570.1	54.118	85	39	0	65	149	41	125	8.82e-28	103
MsaG001093	AT1G21970.1	48.352	91	47	0	58	148	57	147	1.86e-27	103
MsaG001093	AT5G47670.2	48.889	90	46	0	59	148	28	117	4.94e-27	101
MsaG001093	AT5G47670.1	48.889	90	46	0	59	148	57	146	8.59e-27	101
MsaG001093	AT5G47670.3	48.889	90	46	0	59	148	57	146	8.59e-27	101
MsaG001093	AT2G47810.1	44.762	105	57	1	65	168	56	160	1.60e-26	99.0
MsaG001093	AT1G09030.1	41.121	107	55	2	61	159	3	109	7.17e-23	89.0
MsaG001093	AT5G08190.1	30.097	103	69	1	65	167	16	115	3.09e-11	58.9

Find 35 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
AACTATCGCAACCATGCTTA+TGG	0.229358	1:+15040392	MsaT001093.1:CDS
GATTCTTGTCAAATTTCTAA+TGG	0.267704	1:-15040153	None:intergenic
TTAGTGGTGAAGATTTAATA+TGG	0.318108	1:+15040312	MsaT001093.1:CDS
AAGCATGGTTGCGATAGTTT+TGG	0.320197	1:-15040388	None:intergenic
ATATGGGCCATGGGTAGGTT+AGG	0.325129	1:+15040329	MsaT001093.1:CDS
CATGGGTAGGTTAGGGTTTG+AGG	0.343933	1:+15040337	MsaT001093.1:CDS
CGCAGTTCGTCATTCCTTGT+TGG	0.350817	1:-15040125	None:intergenic
CGTTCATCACAATCAAGTTC+TGG	0.391796	1:+15038712	MsaT001093.1:CDS
CAGAAAAGAAAGATCTAACT+TGG	0.396160	1:+15039117	MsaT001093.1:CDS
ATTCTTGTCAAATTTCTAAT+GGG	0.396632	1:-15040152	None:intergenic
ACTATCGCAACCATGCTTAT+GGG	0.422034	1:+15040393	MsaT001093.1:CDS
TATGGGCCATGGGTAGGTTA+GGG	0.451016	1:+15040330	MsaT001093.1:CDS
GATGTGTGTGTCTGAATTCA+TGG	0.465046	1:+15040235	MsaT001093.1:CDS
GAGAGTCGAAAGATCATTAG+TGG	0.486411	1:+15040296	MsaT001093.1:CDS
TAGTGGTGAAGATTTAATAT+GGG	0.494669	1:+15040313	MsaT001093.1:CDS
GGGTTCAACAAGGATGGATC+AGG	0.507582	1:+15040413	MsaT001093.1:CDS
AATTGCATGCATATCAATGT+TGG	0.519524	1:-15040463	None:intergenic
TCGCTTCTCTTAGATTCTCA+AGG	0.531405	1:+15039082	MsaT001093.1:intron
TGAAGATTTAATATGGGCCA+TGG	0.535798	1:+15040319	MsaT001093.1:CDS
TTAGGGTTTGAGGACTATGT+TGG	0.540397	1:+15040347	MsaT001093.1:CDS
AGTGGCTCGAGCAGTGGCAA+TGG	0.552171	1:+15040440	MsaT001093.1:CDS
GCTTATGGGTTCAACAAGGA+TGG	0.560755	1:+15040407	MsaT001093.1:CDS
ATTTAATATGGGCCATGGGT+AGG	0.572332	1:+15040324	MsaT001093.1:CDS
TGAACGGTTGTTGTTAAATG+AGG	0.576425	1:-15038695	None:intergenic
AGAAAAGAAAGATCTAACTT+GGG	0.587000	1:+15039118	MsaT001093.1:CDS
AAGGATGGATCAGGTGCTAG+TGG	0.598209	1:+15040422	MsaT001093.1:CDS
GGTGCTAGTGGCTCGAGCAG+TGG	0.601799	1:+15040434	MsaT001093.1:CDS
GAAGATTTAATATGGGCCAT+GGG	0.602532	1:+15040320	MsaT001093.1:CDS
CCTTGTTGAACCCATAAGCA+TGG	0.602629	1:-15040403	None:intergenic
CTCAAACCCTAACCTACCCA+TGG	0.607706	1:-15040336	None:intergenic
TGCAGGTAGGGAGTCCAACA+AGG	0.616172	1:+15040111	MsaT001093.1:intron
CCATGCTTATGGGTTCAACA+AGG	0.642059	1:+15040403	MsaT001093.1:CDS
CAGAACTTGATTGTGATGAA+CGG	0.644512	1:-15038711	None:intergenic
ATGTGTGTGTCTGAATTCAT+GGG	0.648992	1:+15040236	MsaT001093.1:CDS
CATGGGCATCATCATCACTG+AGG	0.744966	1:+15040253	MsaT001093.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr1	gene	15038686	15040472	15038686	ID=MsaG001093
Chr1	mRNA	15038686	15040472	15038686	ID=MsaT001093.1;Parent=MsaG001093
Chr1	exon	15038686	15038733	15038686	ID=MsaT001093.1.exon1;Parent=MsaT001093.1
Chr1	CDS	15038686	15038733	15038686	ID=cds.MsaT001093.1;Parent=MsaT001093.1
Chr1	exon	15039095	15039178	15039095	ID=MsaT001093.1.exon2;Parent=MsaT001093.1
Chr1	CDS	15039095	15039178	15039095	ID=cds.MsaT001093.1;Parent=MsaT001093.1
Chr1	exon	15039655	15039681	15039655	ID=MsaT001093.1.exon3;Parent=MsaT001093.1
Chr1	CDS	15039655	15039681	15039655	ID=cds.MsaT001093.1;Parent=MsaT001093.1
Chr1	exon	15040116	15040472	15040116	ID=MsaT001093.1.exon4;Parent=MsaT001093.1
Chr1	CDS	15040116	15040472	15040116	ID=cds.MsaT001093.1;Parent=MsaT001093.1

Gene Sequence

>MsaT001093.1

ATGGAAGCTCCTCATTTAACAACAACCGTTCATCACAATCAAGTTCTGATTCTCAAGGCATTATTTGCCTCAGAAAAGAAAGATCTAACTTGGGATATGATTGTGCATCACTTGTTAACCATTTTTGACATGCTAACAAGTATATACACAGACAAAAAAGTAGGGAGTCCAACAAGGAATGACGAACTGCGTCTTCCCATTAGAAATTTGACAAGAATCATGCAGCGTGCTCTTCCATCGTACGCAAAAATATCTCAAGATGCTAAGGCATCAACACAGATGTGTGTGTCTGAATTCATGGGCATCATCATCACTGAGGCTGTTGAGAAATGTAATGAAGAGAGTCGAAAGATCATTAGTGGTGAAGATTTAATATGGGCCATGGGTAGGTTAGGGTTTGAGGACTATGTTGGTCGTCTATCTGTTCTCCTCCAAAACTATCGCAACCATGCTTATGGGTTCAACAAGGATGGATCAGGTGCTAGTGGCTCGAGCAGTGGCAATGGCCAACATTGA

Protein sequence

>MsaT001093.1

MEAPHLTTTVHHNQVLILKALFASEKKDLTWDMIVHHLLTIFDMLTSIYTDKKVGSPTRNDELRLPIRNLTRIMQRALPSYAKISQDAKASTQMCVSEFMGIIITEAVEKCNEESRKIISGEDLIWAMGRLGFEDYVGRLSVLLQNYRNHAYGFNKDGSGASGSSSGNGQH*