AlfalfaGEDB | MsaG004028

M. sativa ssp. caerulea / MsaG004028

KEGG: K16670
GO: -
PFAM: PF03790.16

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG004028	AES61472.2	97.388	268	6	1	1	267	1	268	0.0	544

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG004028	sp\|Q9FP29\|KNOS1_ORYSJ	58.268	254	99	3	12	262	38	287	1.63e-90	273

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG004028	G7I9I1	97.388	268	6	1	1	267	1	268	0.0	544

TFs/TRs:

Gene ID	Type	Classification
MsaG004028	TF	HB-KNOX

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000276	MsaG004028	0.804279	3.932511e-49	5.863242e-47
MsaG000315	MsaG004028	0.800331	2.533873e-48	3.451585e-46
MsaG000681	MsaG004028	0.807896	6.871228e-50	1.115442e-47
MsaG000761	MsaG004028	0.815433	1.604931e-51	3.136657e-49
MsaG001232	MsaG004028	0.816451	9.534489e-52	1.912256e-49
MsaG002142	MsaG004028	0.819314	2.167347e-52	4.681390e-50
MsaG004010	MsaG004028	0.817915	4.483405e-52	9.337540e-50
MsaG004028	MsaG004155	0.806211	1.555727e-49	2.426521e-47
MsaG004028	MsaG004329	0.812093	8.663212e-51	1.557099e-48
MsaG004028	MsaG005352	0.805996	1.725578e-49	2.677556e-47
MsaG004028	MsaG005545	0.833670	8.470487e-56	2.727216e-53
MsaG004028	MsaG006332	0.842472	4.711202e-58	1.989117e-55
MsaG004028	MsaG006548	0.817866	4.598640e-52	9.565426e-50
MsaG004028	MsaG007146	0.826346	5.078235e-54	1.325974e-51
MsaG004028	MsaG007677	0.808286	5.680756e-50	9.308534e-48
MsaG004028	MsaG007826	0.806536	1.329873e-49	2.090190e-47
MsaG004028	MsaG007988	0.804808	3.053577e-49	4.608875e-47
MsaG004028	MsaG008125	0.821427	7.136346e-53	1.629918e-50
MsaG004028	MsaG008861	0.802192	1.058338e-48	1.503732e-46
MsaG004028	MsaG008888	0.810150	2.273953e-50	3.897428e-48
MsaG004028	MsaG008877	0.806509	1.347664e-49	2.116788e-47
MsaG004028	MsaG009875	0.800608	2.226000e-48	3.051392e-46
MsaG004028	MsaG010307	0.804466	3.597362e-49	5.386557e-47
MsaG004028	MsaG010363	0.823538	2.319150e-53	5.606223e-51
MsaG004028	MsaG010604	0.808968	4.068549e-50	6.777178e-48
MsaG004028	MsaG011147	0.802828	7.836880e-49	1.129820e-46
MsaG004028	MsaG011565	0.802807	7.914263e-49	1.140447e-46
MsaG004028	MsaG011559	0.804701	3.215116e-49	4.840469e-47
MsaG004028	MsaG011573	0.807012	1.056018e-49	1.678453e-47
MsaG004028	MsaG011796	0.832703	1.471188e-55	4.603920e-53
MsaG004028	MsaG012026	0.818428	3.436546e-52	7.252473e-50
MsaG004028	MsaG012334	0.815629	1.452007e-51	2.851969e-49
MsaG004028	MsaG012592	0.835431	3.073057e-56	1.042746e-53
MsaG004028	MsaG014242	0.807558	8.102686e-50	1.304653e-47
MsaG004028	MsaG015144	0.805003	2.781351e-49	4.217071e-47
MsaG004028	MsaG015237	0.848432	1.164950e-59	5.985097e-57
MsaG004028	MsaG015330	0.809662	2.892327e-50	4.899155e-48
MsaG004028	MsaG015854	0.813153	5.091521e-51	9.396305e-49
MsaG004028	MsaG015874	0.805727	1.964304e-49	3.028875e-47
MsaG004028	MsaG015960	0.809273	3.502917e-50	5.877642e-48
MsaG004028	MsaG016118	0.848268	1.292762e-59	6.605436e-57
MsaG004028	MsaG016159	0.836541	1.611980e-56	5.655093e-54
MsaG004028	MsaG016384	0.848122	1.418270e-59	7.211592e-57
MsaG004028	MsaG016448	0.810294	2.118158e-50	3.643165e-48
MsaG004028	MsaG016503	0.812916	5.735625e-51	1.052252e-48
MsaG004028	MsaG017407	0.805949	1.765309e-49	2.736251e-47
MsaG004028	MsaG017634	0.809231	3.576134e-50	5.994357e-48
MsaG004028	MsaG017887	0.805692	1.998415e-49	3.078905e-47
MsaG004028	MsaG018150	0.829894	7.162300e-55	2.066575e-52
MsaG004028	MsaG019089	0.812836	5.970366e-51	1.093122e-48
MsaG004028	MsaG019134	0.814334	2.805948e-51	5.333933e-49
MsaG004028	MsaG019298	0.845954	5.529812e-59	2.614938e-56
MsaG004028	MsaG019435	0.873269	3.447843e-67	4.595890e-64
MsaG004028	MsaG019473	0.803366	6.074140e-49	8.866465e-47
MsaG004028	MsaG020385	0.838585	4.849271e-57	1.811116e-54
MsaG004028	MsaG020730	0.867695	2.282704e-65	2.404852e-62
MsaG004028	MsaG020697	0.835398	3.132962e-56	1.061971e-53
MsaG004028	MsaG021090	0.852948	6.337925e-61	3.806533e-58
MsaG004028	MsaG021496	0.800205	2.686304e-48	3.648797e-46
MsaG004028	MsaG021927	0.841755	7.280257e-58	3.003765e-55
MsaG004028	MsaG021996	0.801355	1.569049e-48	2.187351e-46
MsaG004028	MsaG022880	0.880104	1.524745e-69	2.764836e-66
MsaG004028	MsaG023078	0.879376	2.759192e-69	4.838546e-66
MsaG004028	MsaG023997	0.804092	4.298660e-49	6.381586e-47
MsaG004028	MsaG024105	0.802251	1.029079e-48	1.464152e-46
MsaG004028	MsaG024451	0.820207	1.357507e-52	3.002247e-50
MsaG004028	MsaG024752	0.801376	1.553759e-48	2.167060e-46
MsaG004028	MsaG025530	0.826339	5.099194e-54	1.331155e-51
MsaG004028	MsaG025838	0.803504	5.686385e-49	8.327105e-47
MsaG004028	MsaG025985	0.826334	5.110454e-54	1.333924e-51
MsaG004028	MsaG026854	0.801853	1.241412e-48	1.750344e-46
MsaG004028	MsaG026901	0.815662	1.427615e-51	2.806422e-49
MsaG004028	MsaG027275	0.808280	5.698522e-50	9.336264e-48
MsaG004028	MsaG027543	0.814875	2.132081e-51	4.108571e-49
MsaG004028	MsaG027547	0.821811	5.824147e-53	1.343841e-50
MsaG004028	MsaG027759	0.840358	1.687247e-57	6.661220e-55
MsaG004028	MsaG027891	0.803026	7.137151e-49	1.033669e-46
MsaG004028	MsaG028423	0.803569	5.515098e-49	8.088307e-47
MsaG004028	MsaG028585	0.801090	1.776569e-48	2.461816e-46
MsaG004028	MsaG028626	0.848670	1.002018e-59	5.190022e-57
MsaG004028	MsaG028760	0.811772	1.016820e-50	1.813291e-48
MsaG004028	MsaG028762	0.843063	3.288632e-58	1.414972e-55
MsaG004028	MsaG029029	0.802069	1.121594e-48	1.589170e-46
MsaG004028	MsaG029076	0.831026	3.797572e-55	1.131821e-52
MsaG004028	MsaG029311	0.812006	9.047705e-51	1.622793e-48
MsaG004028	MsaG029377	0.804221	4.043329e-49	6.020315e-47
MsaG004028	MsaG029635	0.802370	9.733323e-49	1.388635e-46
MsaG004028	MsaG030197	0.837346	1.006203e-56	3.617011e-54
MsaG004028	MsaG030451	0.832279	1.870947e-55	5.783272e-53
MsaG004028	MsaG030455	0.860878	2.992551e-63	2.405818e-60
MsaG004028	MsaG030524	0.817707	4.994875e-52	1.034645e-49
MsaG004028	MsaG031104	0.805407	2.291985e-49	3.507719e-47
MsaG004028	MsaG031527	0.839983	2.111137e-57	8.237266e-55
MsaG004028	MsaG032713	0.800749	2.083751e-48	2.865487e-46
MsaG004028	MsaG034446	0.834611	4.935188e-56	1.634012e-53
MsaG004028	MsaG034554	0.810170	2.251397e-50	3.860678e-48
MsaG004028	MsaG035216	0.814085	3.181713e-51	6.010614e-49
MsaG004028	MsaG035263	0.829231	1.036595e-54	2.934276e-52
MsaG004028	MsaG035673	0.812635	6.604657e-51	1.203206e-48
MsaG004028	MsaG037421	0.812028	8.945304e-51	1.605318e-48
MsaG004028	MsaG038522	0.825746	7.042373e-54	1.808379e-51
MsaG004028	MsaG038999	0.802959	7.366848e-49	1.065283e-46
MsaG004028	MsaG039175	0.834143	6.458983e-56	2.108695e-53
MsaG004028	MsaG039466	0.810103	2.327644e-50	3.984930e-48
MsaG004028	MsaG040511	0.861857	1.509569e-63	1.259877e-60
MsaG004028	MsaG040640	0.824877	1.127795e-53	2.827453e-51
MsaG004028	MsaG041204	0.813332	4.652728e-51	8.624933e-49
MsaG004028	MsaG042057	0.801359	1.565874e-48	2.183154e-46
MsaG004028	MsaG042534	0.833166	1.129602e-55	3.583555e-53
MsaG004028	MsaG043029	0.824040	1.771528e-53	4.341263e-51
MsaG004028	MsaG044050	0.814664	2.373129e-51	4.548729e-49
MsaG004028	MsaG044115	0.819179	2.324735e-52	5.003702e-50
MsaG004028	MsaG044630	0.811792	1.006356e-50	1.795556e-48
MsaG004028	MsaG044865	0.833263	1.069154e-55	3.401378e-53
MsaG004028	MsaG045052	0.803848	4.830390e-49	7.129938e-47
MsaG004028	MsaG045606	0.837387	9.824572e-57	3.536195e-54
MsaG004028	MsaG046005	0.813416	4.459335e-51	8.284141e-49
MsaG004028	MsaG046150	0.818080	4.117177e-52	8.611297e-50
MsaG004028	MsaG046278	0.805426	2.271091e-49	3.477244e-47
MsaG004028	MsaG046438	0.819643	1.824771e-52	3.975352e-50
MsaG004028	MsaG046724	0.831615	2.724457e-55	8.260521e-53
MsaG004028	MsaG046828	0.834133	6.497037e-56	2.120486e-53
MsaG004028	MsaG046830	0.872806	4.922652e-67	6.430431e-64
MsaG004028	MsaG046974	0.814980	2.021453e-51	3.905724e-49
MsaG004028	MsaG004310	0.806814	1.162286e-49	1.838727e-47
MsaG004028	MsaG002665	0.809355	3.364995e-50	5.657345e-48
MsaG004028	MsaG002355	0.806910	1.109883e-49	1.759750e-47
MsaG004028	MsaG001992	0.806273	1.509942e-49	2.358548e-47
MsaG004028	MsaG000822	0.845880	5.790649e-59	2.731574e-56
MsaG004028	MsaG009146	0.856644	5.437380e-62	3.729313e-59
MsaG004028	MsaG009203	0.810891	1.575960e-50	2.750392e-48
MsaG004028	MsaG012002	0.810967	1.517608e-50	2.653462e-48
MsaG004028	MsaG027150	0.820153	1.396845e-52	3.084737e-50
MsaG004028	MsaG028382	0.814607	2.442542e-51	4.674951e-49
MsaG004028	MsaG028769	0.809679	2.868749e-50	4.861188e-48
MsaG004028	MsaG031376	0.851736	1.397753e-60	8.044272e-58
MsaG004028	MsaG031514	0.855495	1.175581e-61	7.732142e-59
MsaG004028	MsaG029995	0.811389	1.230094e-50	2.173191e-48
MsaG004028	MsaG030749	0.817629	5.200012e-52	1.074981e-49
MsaG004028	MsaG033404	0.807987	6.574748e-50	1.069625e-47
MsaG004028	MsaG033107	0.863767	3.914426e-64	3.521117e-61
MsaG004028	MsaG032454	0.833821	7.770068e-56	2.512627e-53
MsaG004028	MsaG032963	0.804076	4.331530e-49	6.427985e-47
MsaG004028	MsaG032707	0.815159	1.845025e-51	3.580894e-49
MsaG004028	MsaG037042	0.810360	2.050182e-50	3.532076e-48
MsaG004028	MsaG038133	0.807614	7.885177e-50	1.271314e-47
MsaG004028	MsaG043553	0.809207	3.619057e-50	6.062831e-48

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG004028	MtrunA17_Chr1g0192791	97.388	268	6	1	1	267	1	268	0.0	543
MsaG004028	MtrunA17_Chr5g0413201	53.696	257	103	4	9	259	63	309	9.71e-85	256
MsaG004028	MtrunA17_Chr1g0151961	48.413	252	117	4	18	264	119	362	8.26e-70	219
MsaG004028	MtrunA17_Chr5g0439391	48.594	249	103	4	19	259	47	278	2.23e-67	211
MsaG004028	MtrunA17_Chr2g0289201	50.206	243	107	4	18	256	117	349	2.53e-65	208
MsaG004028	MtrunA17_Chr1g0149651	34.538	249	138	6	19	244	174	420	1.76e-37	137
MsaG004028	MtrunA17_Chr3g0137241	35.249	261	122	8	19	244	107	355	1.80e-37	135
MsaG004028	MtrunA17_Chr5g0398181	33.597	253	145	4	15	244	24	276	1.28e-36	132
MsaG004028	MtrunA17_Chr4g0065241	33.065	248	147	4	16	244	68	315	2.39e-36	132
MsaG004028	MtrunA17_Chr2g0305101	34.274	248	138	6	19	244	95	339	3.00e-35	129
MsaG004028	MtrunA17_Chr6g0479181	34.906	106	67	1	15	120	64	167	8.43e-13	65.5
MsaG004028	MtrunA17_Chr7g0240371	38.356	73	43	1	174	246	296	366	4.84e-11	62.8
MsaG004028	MtrunA17_Chr4g0008591	42.466	73	39	2	174	246	352	421	5.78e-11	62.4

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG004028	AT1G23380.1	51.190	252	103	4	17	261	84	322	3.26e-83	253
MsaG004028	AT1G70510.1	50.602	249	109	3	17	261	68	306	1.21e-81	248
MsaG004028	AT1G23380.2	50.787	254	103	5	17	261	84	324	3.95e-81	247
MsaG004028	AT1G70510.2	49.802	253	109	4	17	261	68	310	2.75e-79	242
MsaG004028	AT1G62360.1	49.798	247	108	4	18	258	121	357	2.99e-67	213
MsaG004028	AT4G08150.1	47.177	248	117	5	18	258	134	374	5.31e-66	211
MsaG004028	AT1G62990.1	34.661	251	142	6	15	244	26	275	1.65e-39	139
MsaG004028	AT5G25220.2	35.200	250	132	6	19	244	160	403	2.11e-38	139
MsaG004028	AT5G25220.1	35.200	250	132	6	19	244	160	403	2.14e-38	139
MsaG004028	AT5G11060.1	35.156	256	124	8	19	244	124	367	1.80e-37	136
MsaG004028	AT4G32040.2	34.146	246	140	5	19	244	119	362	9.55e-37	134
MsaG004028	AT4G32040.1	34.146	246	140	5	19	244	119	362	1.02e-36	134
MsaG004028	AT1G75430.1	49.091	55	28	0	192	246	209	263	5.73e-11	62.0
MsaG004028	AT5G02030.1	46.667	60	32	0	187	246	350	409	8.92e-11	62.4

Find 61 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
GCTTCTCTTCTTGAAGAAAT+AGG	0.173162	1:-64900794	MsaT004028.1:CDS
GAAATGCTCCTTCGTAAGTA+TGG	0.209222	1:-64896020	MsaT004028.1:CDS
TCTCACGGAAAGCATTATTT+TGG	0.227729	1:+64900759	None:intergenic
ATTTCTCAAGAAAAGGAAAA+AGG	0.267954	1:-64895970	MsaT004028.1:CDS
CTTCTCTTCTTGAAGAAATA+GGG	0.308161	1:-64900793	MsaT004028.1:CDS
ACAACCAATCGGATCTAATA+AGG	0.325364	1:-64901148	MsaT004028.1:CDS
ATATAAAGCAGATAAATAAT+TGG	0.326164	1:-64895301	MsaT004028.1:CDS
TTTACCTGAACGGTTGTAAT+CGG	0.376328	1:+64900411	None:intergenic
TGTTGCTTCATTGAAGGGCT+TGG	0.378477	1:+64900498	None:intergenic
AATAATGCTTTCCGTGAGAT+AGG	0.392343	1:-64900755	MsaT004028.1:CDS
GATAGTAGATTTGGATAAAG+AGG	0.394577	1:+64901080	None:intergenic
TCCTGACCTTGACCACTTCA+TGG	0.397547	1:-64900726	MsaT004028.1:intron
AAATAATGTTGCTTCATTGA+AGG	0.405931	1:+64900492	None:intergenic
GACAGGAATTTCTCAAGAAA+AGG	0.410633	1:-64895977	MsaT004028.1:CDS
ATTTGAATTACCGTGGGATA+AGG	0.413318	1:+64895885	None:intergenic
AATAATGTTGCTTCATTGAA+GGG	0.423656	1:+64900493	None:intergenic
GGATGCAAGAAAAGCATTGA+TGG	0.424199	1:-64895934	MsaT004028.1:CDS
GGAAAGGTTGAAGCAGTAGA+AGG	0.448898	1:-64896095	MsaT004028.1:CDS
ATTGGTGGAACGTCCACTAT+AGG	0.452627	1:-64895911	MsaT004028.1:CDS
TCATCCGATTACAACCGTTC+AGG	0.455239	1:-64900415	MsaT004028.1:intron
GGGTCAGATCACGAGGCAGC+AGG	0.458108	1:-64896143	MsaT004028.1:intron
TTACAGAGGTCCTGCTATGC+TGG	0.477108	1:+64895202	None:intergenic
ACCATGAAGTGGTCAAGGTC+AGG	0.484448	1:+64900725	None:intergenic
TGGGATAAGGCCACCTATAG+TGG	0.485346	1:+64895898	None:intergenic
AAATGCTCCTTCGTAAGTAT+GGG	0.496084	1:-64896019	MsaT004028.1:CDS
ATTCCTGTCTTAAGTTGCTA+AGG	0.503658	1:+64895991	None:intergenic
CAAGAAAAGCATTGATGGAT+TGG	0.506407	1:-64895929	MsaT004028.1:CDS
AAAGAGGGTGAGTTGCGATC+TGG	0.510035	1:+64901096	None:intergenic
GTAAGTAGCACCAGCATAGC+AGG	0.513299	1:-64895212	MsaT004028.1:CDS
TCTAATAAGGTTGGATATGA+CGG	0.529171	1:-64901135	MsaT004028.1:CDS
AGAAGAGAAGCAAGTTCTGT+TGG	0.544757	1:+64900806	None:intergenic
ATAGTAGATTTGGATAAAGA+GGG	0.546531	1:+64901081	None:intergenic
CCAATCGGATCTAATAAGGT+TGG	0.547810	1:-64901144	MsaT004028.1:CDS
TCTTTAAGCTCTTTATCACC+TGG	0.551142	1:+64896041	None:intergenic
CCAACCTTATTAGATCCGAT+TGG	0.554336	1:+64901144	None:intergenic
GAAAAGCATTGATGGATTGG+TGG	0.555034	1:-64895926	MsaT004028.1:CDS
TTACCTTAGCAACTTAAGAC+AGG	0.555596	1:-64895994	MsaT004028.1:CDS
ACAACTAAACGAACTTTGCA+AGG	0.560050	1:-64900452	MsaT004028.1:CDS
TCACATGGAACACAACCAAT+CGG	0.562048	1:-64901159	None:intergenic
CTGCAGCTGTCAGATATGAC+TGG	0.564508	1:-64895329	MsaT004028.1:CDS
TTAAGTTCTCTTTACCTGAA+CGG	0.565840	1:+64900401	None:intergenic
TCAGAGGATGAAATGAGTTG+TGG	0.568316	1:-64896116	MsaT004028.1:CDS
AATATACCATGAAGTGGTCA+AGG	0.574865	1:+64900720	None:intergenic
TAAAAGAATATACCATGAAG+TGG	0.580028	1:+64900714	None:intergenic
TCAATCAGAGGAAAAGACAC+TGG	0.584588	1:-64895274	MsaT004028.1:CDS
CAGGATCATCTCCTATCTCA+CGG	0.597806	1:+64900744	None:intergenic
CTTTGTGGCACATCATGTCC+AGG	0.602003	1:-64896059	MsaT004028.1:CDS
GGTGGTCATGATGAACTTTG+TGG	0.607949	1:-64896074	MsaT004028.1:CDS
AATGCTCCTTCGTAAGTATG+GGG	0.615416	1:-64896018	MsaT004028.1:CDS
CTATAGGTGGCCTTATCCCA+CGG	0.616947	1:-64895895	MsaT004028.1:intron
CAACTAAACGAACTTTGCAA+GGG	0.626350	1:-64900451	MsaT004028.1:CDS
AACTAAACGAACTTTGCAAG+GGG	0.629556	1:-64900450	MsaT004028.1:CDS
GGTCAGATCACGAGGCAGCA+GGG	0.632522	1:-64896142	MsaT004028.1:intron
ATAATTGGTTCATCAATCAG+AGG	0.632866	1:-64895286	MsaT004028.1:CDS
CGAGGCAGCAGGGACATCAG+AGG	0.640139	1:-64896132	MsaT004028.1:CDS
AGTTCTTCATAGATACAAAG+AGG	0.649236	1:-64900527	MsaT004028.1:CDS
GGTGGAACGTCCACTATAGG+TGG	0.655633	1:-64895908	MsaT004028.1:CDS
GGATGAAATGAGTTGTGGAA+AGG	0.661174	1:-64896111	MsaT004028.1:CDS
AAGGTTGAAGCAGTAGAAGG+TGG	0.681013	1:-64896092	MsaT004028.1:CDS
ATGCTCCTTCGTAAGTATGG+GGG	0.702025	1:-64896017	MsaT004028.1:CDS
CCTGCAGAATAAATTTACAG+AGG	0.707916	1:+64895188	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr1	gene	64895202	64901177	64895202	ID=MsaG004028
Chr1	mRNA	64895202	64901177	64895202	ID=MsaT004028.1;Parent=MsaG004028
Chr1	exon	64895202	64895363	64895202	ID=MsaT004028.1.exon5;Parent=MsaT004028.1
Chr1	CDS	64895202	64895363	64895202	ID=cds.MsaT004028.1;Parent=MsaT004028.1
Chr1	exon	64895896	64896158	64895896	ID=MsaT004028.1.exon4;Parent=MsaT004028.1
Chr1	CDS	64895896	64896158	64895896	ID=cds.MsaT004028.1;Parent=MsaT004028.1
Chr1	exon	64900416	64900563	64900416	ID=MsaT004028.1.exon3;Parent=MsaT004028.1
Chr1	CDS	64900416	64900563	64900416	ID=cds.MsaT004028.1;Parent=MsaT004028.1
Chr1	exon	64900727	64900837	64900727	ID=MsaT004028.1.exon2;Parent=MsaT004028.1
Chr1	CDS	64900727	64900837	64900727	ID=cds.MsaT004028.1;Parent=MsaT004028.1
Chr1	exon	64901058	64901177	64901058	ID=MsaT004028.1.exon1;Parent=MsaT004028.1
Chr1	CDS	64901058	64901177	64901058	ID=cds.MsaT004028.1;Parent=MsaT004028.1

Gene Sequence

>MsaT004028.1

ATGGAACACAACCAATCGGATCTAATAAGGTTGGATATGACGGATCGAATTATCAAGAACCAGATCGCAACTCACCCTCTTTATCCAAATCTACTATCTGCTTTTTTAGAATGCCAAAAGGTTGGGGCACCAACAGAACTTGCTTCTCTTCTTGAAGAAATAGGGCGTGAAAACCACCAAAATAATGCTTTCCGTGAGATAGGAGATGATCCTGACCTTGACCACTTCATGGAATCATACTGTGAAGTTCTTCATAGATACAAAGAGGAGTTATCCAAGCCCTTCAATGAAGCAACATTATTTTTGTGCAATATTGAATCACAACTAAACGAACTTTGCAAGGGGACACAAACAATGTCATCCGATTACAACCGTTCAGATCACGAGGCAGCAGGGACATCAGAGGATGAAATGAGTTGTGGAAAGGTTGAAGCAGTAGAAGGTGGTCATGATGAACTTTGTGGCACATCATGTCCAGGTGATAAAGAGCTTAAAGAAATGCTCCTTCGTAAGTATGGGGGTTACCTTAGCAACTTAAGACAGGAATTTCTCAAGAAAAGGAAAAAGGGTAAACTACCAAAGGATGCAAGAAAAGCATTGATGGATTGGTGGAACGTCCACTATAGGTGGCCTTATCCCACGGAGGAGGAGAAACTGCAGCTGTCAGATATGACTGGACTTGATATAAAGCAGATAAATAATTGGTTCATCAATCAGAGGAAAAGACACTGGAAACCATCTGAAAATATGAGATTTTCTATTATGGAGGGTGTAAGTAGCACCAGCATAGCAGGACCTCTGTAA

Protein sequence

>MsaT004028.1

MEHNQSDLIRLDMTDRIIKNQIATHPLYPNLLSAFLECQKVGAPTELASLLEEIGRENHQNNAFREIGDDPDLDHFMESYCEVLHRYKEELSKPFNEATLFLCNIESQLNELCKGTQTMSSDYNRSDHEAAGTSEDEMSCGKVEAVEGGHDELCGTSCPGDKELKEMLLRKYGGYLSNLRQEFLKKRKKGKLPKDARKALMDWWNVHYRWPYPTEEEKLQLSDMTGLDIKQINNWFINQRKRHWKPSENMRFSIMEGVSSTSIAGPL*