AlfalfaGEDB | MsaG007795

M. sativa ssp. caerulea / MsaG007795

KEGG: K15032
GO: -
PFAM: PF02536.17

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG007795	XP_024631484.1	80.339	295	56	1	4	296	123	417	3.61e-166	478

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG007795	tr\|A0A072V7R4\|A0A072V7R4_MEDTR	76.897	290	64	2	9	296	163	451	3.46e-153	447

TFs/TRs:

Gene ID	Type	Classification
MsaG007795	TR	mTERF

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000045	MsaG007795	0.800847	1.990410e-48	2.743100e-46
MsaG000439	MsaG007795	0.837607	8.634396e-57	3.128716e-54
MsaG000450	MsaG007795	0.805170	2.567595e-49	3.908147e-47
MsaG000534	MsaG007795	0.818804	2.826623e-52	6.024042e-50
MsaG001558	MsaG007795	0.807336	9.023743e-50	1.445290e-47
MsaG003327	MsaG007795	0.823191	2.793193e-53	6.688860e-51
MsaG003461	MsaG007795	0.805571	2.117329e-49	3.252852e-47
MsaG004146	MsaG007795	0.806410	1.413153e-49	2.214528e-47
MsaG004185	MsaG007795	0.807497	8.345687e-50	1.341843e-47
MsaG005058	MsaG007795	0.812294	7.833229e-51	1.414964e-48
MsaG005201	MsaG007795	0.806731	1.210311e-49	1.911005e-47
MsaG006217	MsaG007795	0.803611	5.406855e-49	7.937139e-47
MsaG006225	MsaG007795	0.801315	1.598523e-48	2.226451e-46
MsaG006257	MsaG007795	0.815701	1.399985e-51	2.754761e-49
MsaG006943	MsaG007795	0.811984	9.148133e-51	1.639915e-48
MsaG007072	MsaG007795	0.803347	6.129357e-49	8.943125e-47
MsaG007600	MsaG007795	0.823895	1.914889e-53	4.673908e-51
MsaG007626	MsaG007795	0.803922	4.661447e-49	6.892635e-47
MsaG007684	MsaG007795	0.815871	1.283675e-51	2.536750e-49
MsaG007795	MsaG008112	0.821873	5.634817e-53	1.302337e-50
MsaG007795	MsaG008250	0.811661	1.074263e-50	1.910562e-48
MsaG007795	MsaG008434	0.806332	1.467779e-49	2.295831e-47
MsaG007795	MsaG008631	0.806790	1.176009e-49	1.859417e-47
MsaG007795	MsaG009140	0.802861	7.717250e-49	1.113414e-46
MsaG007795	MsaG009206	0.835830	2.438610e-56	8.373808e-54
MsaG007795	MsaG009785	0.800199	2.693980e-48	3.658712e-46
MsaG007795	MsaG011018	0.819823	1.660779e-52	3.635364e-50
MsaG007795	MsaG011044	0.808773	4.476817e-50	7.422350e-48
MsaG007795	MsaG011256	0.823166	2.830079e-53	6.772573e-51
MsaG007795	MsaG011248	0.808126	6.144032e-50	1.002883e-47
MsaG007795	MsaG011405	0.817389	5.884428e-52	1.209066e-49
MsaG007795	MsaG012169	0.806447	1.388095e-49	2.177196e-47
MsaG007795	MsaG012736	0.806846	1.144539e-49	1.811999e-47
MsaG007795	MsaG012772	0.805520	2.169875e-49	3.329608e-47
MsaG007795	MsaG017115	0.810407	2.002807e-50	3.454446e-48
MsaG007795	MsaG018135	0.802915	7.519384e-49	1.086241e-46
MsaG007795	MsaG018373	0.809271	3.505834e-50	5.882322e-48
MsaG007795	MsaG019007	0.815837	1.305888e-51	2.578474e-49
MsaG007795	MsaG019191	0.806801	1.169900e-49	1.850210e-47
MsaG007795	MsaG019571	0.833693	8.359867e-56	2.693416e-53
MsaG007795	MsaG020421	0.825951	6.299213e-54	1.626863e-51
MsaG007795	MsaG020718	0.802591	8.764986e-49	1.256854e-46
MsaG007795	MsaG020787	0.819090	2.435512e-52	5.229789e-50
MsaG007795	MsaG021106	0.803415	5.933360e-49	8.670823e-47
MsaG007795	MsaG021423	0.808475	5.180384e-50	8.527330e-48
MsaG007795	MsaG021467	0.801344	1.577418e-48	2.198474e-46
MsaG007795	MsaG021469	0.802501	9.146691e-49	1.308863e-46
MsaG007795	MsaG021477	0.820968	9.098245e-53	2.053003e-50
MsaG007795	MsaG021485	0.829830	7.421844e-55	2.137527e-52
MsaG007795	MsaG022116	0.805576	2.112734e-49	3.246115e-47
MsaG007795	MsaG023119	0.806107	1.636357e-49	2.545851e-47
MsaG007795	MsaG023704	0.828143	1.893418e-54	5.198801e-52
MsaG007795	MsaG025282	0.806697	1.230134e-49	1.940797e-47
MsaG007795	MsaG025492	0.806691	1.233983e-49	1.946568e-47
MsaG007795	MsaG027026	0.808450	5.242868e-50	8.624821e-48
MsaG007795	MsaG027087	0.807640	7.786198e-50	1.256142e-47
MsaG007795	MsaG027359	0.802316	9.981251e-49	1.422287e-46
MsaG007795	MsaG027383	0.801058	1.803119e-48	2.496784e-46
MsaG007795	MsaG028091	0.802324	9.943922e-49	1.417223e-46
MsaG007795	MsaG028250	0.808098	6.225852e-50	1.015582e-47
MsaG007795	MsaG028487	0.809724	2.805235e-50	4.758743e-48
MsaG007795	MsaG028568	0.803953	4.593165e-49	6.796582e-47
MsaG007795	MsaG028634	0.804461	3.604725e-49	5.397036e-47
MsaG007795	MsaG028825	0.814931	2.071866e-51	3.998189e-49
MsaG007795	MsaG029459	0.801701	1.333870e-48	1.874155e-46
MsaG007795	MsaG029482	0.830477	5.170320e-55	1.516768e-52
MsaG007795	MsaG030267	0.806543	1.325450e-49	2.083572e-47
MsaG007795	MsaG030804	0.800894	1.947588e-48	2.686870e-46
MsaG007795	MsaG032404	0.801380	1.550826e-48	2.163193e-46
MsaG007795	MsaG033312	0.815178	1.827646e-51	3.548893e-49
MsaG007795	MsaG033688	0.818436	3.422549e-52	7.224469e-50
MsaG007795	MsaG034308	0.826637	4.332291e-54	1.140355e-51
MsaG007795	MsaG034418	0.803013	7.180162e-49	1.039601e-46
MsaG007795	MsaG034851	0.808033	6.429078e-50	1.047084e-47
MsaG007795	MsaG035317	0.801253	1.646189e-48	2.289547e-46
MsaG007795	MsaG035675	0.818809	2.820069e-52	6.010811e-50
MsaG007795	MsaG035700	0.801224	1.668235e-48	2.318704e-46
MsaG007795	MsaG036022	0.803234	6.464582e-49	9.407925e-47
MsaG007795	MsaG036577	0.800194	2.700198e-48	3.666783e-46
MsaG007795	MsaG038043	0.816447	9.555730e-52	1.916285e-49
MsaG007795	MsaG039418	0.804952	2.850682e-49	4.317013e-47
MsaG007795	MsaG040474	0.801622	1.384174e-48	1.941362e-46
MsaG007795	MsaG042510	0.803377	6.042530e-49	8.822652e-47
MsaG007795	MsaG043881	0.809098	3.817896e-50	6.379610e-48
MsaG007795	MsaG044319	0.806184	1.576594e-49	2.457385e-47
MsaG007795	MsaG044880	0.815040	1.960081e-51	3.792829e-49
MsaG007795	MsaG045392	0.809637	2.928256e-50	4.957039e-48
MsaG007795	MsaG046930	0.808075	6.296844e-50	1.026592e-47
MsaG007795	MsaG002433	0.801845	1.246166e-48	1.756712e-46
MsaG007795	MsaG002307	0.807079	1.022543e-49	1.627790e-47
MsaG007795	MsaG009163	0.800294	2.577379e-48	3.507918e-46
MsaG007795	MsaG010555	0.825214	9.397069e-54	2.377770e-51
MsaG007795	MsaG011837	0.804916	2.899576e-49	4.387425e-47
MsaG007795	MsaG013008	0.810189	2.230459e-50	3.826545e-48
MsaG007795	MsaG011633	0.822341	4.395815e-53	1.028816e-50
MsaG007795	MsaG013071	0.806378	1.435646e-49	2.248011e-47
MsaG007795	MsaG021945	0.808384	5.414395e-50	8.892877e-48
MsaG007795	MsaG019592	0.812589	6.757647e-51	1.229721e-48
MsaG007795	MsaG027643	0.808162	6.034677e-50	9.859102e-48
MsaG007795	MsaG027453	0.801755	1.299894e-48	1.828709e-46
MsaG007795	MsaG030982	0.806423	1.404207e-49	2.201207e-47
MsaG007795	MsaG031225	0.810134	2.291733e-50	3.926401e-48
MsaG007795	MsaG031808	0.801255	1.644171e-48	2.286878e-46
MsaG007795	MsaG033182	0.803480	5.754227e-49	8.421584e-47
MsaG007795	MsaG033058	0.819876	1.615410e-52	3.541063e-50
MsaG007795	MsaG031222	0.811737	1.034761e-50	1.843706e-48
MsaG007795	MsaG033283	0.820706	1.044171e-52	2.339687e-50
MsaG007795	MsaG038618	0.803500	5.699788e-49	8.345733e-47
MsaG007795	MsaG037217	0.817757	4.867589e-52	1.009602e-49
MsaG007795	MsaG042525	0.807927	6.769656e-50	1.099777e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG007795	MtrunA17_Chr2g0296291	74.658	292	72	1	4	293	119	410	8.42e-153	434
MsaG007795	MtrunA17_Chr2g0296251	77.737	274	59	1	10	281	125	398	7.45e-149	423
MsaG007795	MtrunA17_Chr2g0296711	75.352	284	65	2	16	294	116	399	7.18e-148	421
MsaG007795	MtrunA17_Chr2g0296221	76.364	275	61	2	24	294	153	427	3.03e-145	415
MsaG007795	MtrunA17_Chr2g0296231	71.831	284	77	1	16	296	112	395	2.86e-143	409
MsaG007795	MtrunA17_Chr2g0296171	76.336	262	58	2	24	281	134	395	6.43e-135	388
MsaG007795	MtrunA17_Chr2g0315731	71.273	275	77	1	24	296	144	418	4.22e-134	386
MsaG007795	MtrunA17_Chr2g0296741	67.133	286	89	2	16	296	133	418	6.31e-132	381
MsaG007795	MtrunA17_Chr2g0296721	70.545	275	78	2	24	296	124	397	6.91e-131	377
MsaG007795	MtrunA17_Chr2g0296191	74.131	259	63	2	24	278	736	994	1.04e-124	380
MsaG007795	MtrunA17_Chr2g0296191	64.130	276	93	3	8	280	237	509	2.85e-110	342
MsaG007795	MtrunA17_Chr2g0296181	67.018	285	62	4	16	295	114	371	1.65e-119	348
MsaG007795	MtrunA17_Chr2g0296551	81.910	199	34	1	100	296	1	199	8.66e-114	326
MsaG007795	MtrunA17_Chr2g0296151	53.676	272	121	2	24	293	114	382	1.32e-97	292
MsaG007795	MtrunA17_Chr2g0295741	54.044	272	120	2	24	293	120	388	5.60e-96	288
MsaG007795	MtrunA17_Chr2g0296111	54.945	273	109	4	24	289	113	378	4.04e-94	283
MsaG007795	MtrunA17_Chr2g0296211	66.990	206	63	2	95	295	167	372	5.56e-91	275
MsaG007795	MtrunA17_Chr2g0295731	52.273	264	121	3	24	285	121	381	1.42e-89	271
MsaG007795	MtrunA17_Chr2g0296701	78.235	170	35	1	129	296	2	171	1.60e-89	264
MsaG007795	MtrunA17_Chr2g0296121	50.000	272	131	2	24	293	200	468	2.56e-87	268
MsaG007795	MtrunA17_Chr4g0067121	48.881	268	132	3	24	289	124	388	7.34e-84	257
MsaG007795	MtrunA17_Chr2g0296301	45.725	269	139	4	24	288	108	373	2.71e-77	240
MsaG007795	MtrunA17_Chr2g0296751	79.167	144	27	2	155	296	1	143	5.35e-76	229
MsaG007795	MtrunA17_Chr2g0295761	48.473	262	129	3	24	282	132	390	1.38e-70	223
MsaG007795	MtrunA17_Chr4g0067671	45.306	245	131	1	24	268	116	357	1.03e-66	212
MsaG007795	MtrunA17_Chr2g0296131	59.524	168	62	2	130	293	9	174	2.01e-64	200
MsaG007795	MtrunA17_Chr4g0067141	44.186	258	139	3	24	279	116	370	5.29e-64	206
MsaG007795	MtrunA17_Chr2g0296161	54.971	171	75	1	126	294	1	171	2.03e-62	195
MsaG007795	MtrunA17_Chr2g0286191	45.318	267	127	7	24	281	103	359	7.66e-61	197
MsaG007795	MtrunA17_Chr2g0295721	61.947	113	43	0	126	238	1	113	2.66e-45	149
MsaG007795	MtrunA17_Chr2g0286221	51.282	156	72	3	128	281	16	169	4.30e-41	140
MsaG007795	MtrunA17_Chr8g0377801	30.000	260	176	3	24	279	128	385	4.98e-28	111
MsaG007795	MtrunA17_Chr4g0001831	31.600	250	159	6	24	266	109	353	1.76e-27	109
MsaG007795	MtrunA17_Chr8g0377781	30.078	256	173	4	24	275	115	368	1.09e-24	102
MsaG007795	MtrunA17_Chr4g0067131	50.617	81	38	1	199	277	1	81	6.25e-20	82.4
MsaG007795	MtrunA17_Chr4g0067681	50.000	62	31	0	188	249	1	62	4.72e-14	65.9
MsaG007795	MtrunA17_Chr2g0295711	50.746	67	32	1	24	90	120	185	8.06e-14	68.9
MsaG007795	MtrunA17_Chr2g0295751	58.182	55	23	0	24	78	121	175	5.07e-12	66.2

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG007795	AT5G07900.1	33.077	260	169	3	24	278	140	399	2.14e-39	142
MsaG007795	AT1G21150.3	30.153	262	179	3	11	268	77	338	1.05e-29	115
MsaG007795	AT1G21150.1	30.153	262	179	3	11	268	113	374	1.79e-29	115
MsaG007795	AT1G21150.2	30.153	262	179	3	11	268	177	438	4.19e-29	115
MsaG007795	AT5G64950.1	27.907	258	168	4	24	268	110	362	2.13e-24	102
MsaG007795	AT1G61990.2	26.667	285	160	6	24	269	123	397	4.38e-20	90.1
MsaG007795	AT1G61990.1	26.667	285	160	6	24	269	123	397	4.38e-20	90.1
MsaG007795	AT1G61980.3	26.897	290	168	7	24	274	123	407	2.33e-18	85.1
MsaG007795	AT1G61980.2	26.897	290	168	7	24	274	123	407	2.33e-18	85.1
MsaG007795	AT1G61980.1	26.897	290	168	7	24	274	123	407	2.33e-18	85.1
MsaG007795	AT1G61970.2	25.442	283	165	8	24	266	123	399	3.72e-17	81.6
MsaG007795	AT1G61970.7	25.442	283	165	8	24	266	123	399	3.72e-17	81.6
MsaG007795	AT1G61970.6	25.442	283	165	8	24	266	123	399	3.72e-17	81.6
MsaG007795	AT1G61970.3	25.442	283	165	8	24	266	123	399	3.72e-17	81.6
MsaG007795	AT1G61970.5	25.442	283	165	8	24	266	123	399	3.72e-17	81.6
MsaG007795	AT1G61970.4	25.442	283	165	8	24	266	123	399	3.72e-17	81.6
MsaG007795	AT1G61970.1	25.442	283	165	8	24	266	123	399	3.72e-17	81.6
MsaG007795	AT1G62120.1	26.370	292	171	6	24	275	127	414	1.15e-15	77.4
MsaG007795	AT1G62110.1	29.282	181	120	3	19	195	118	294	2.08e-12	67.8
MsaG007795	AT3G46950.1	28.729	181	121	4	19	198	118	291	9.92e-12	65.5
MsaG007795	AT1G62150.1	30.000	170	111	3	30	195	135	300	3.56e-11	63.9

Find 55 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ATCAATTTGGTGGCTGATTT+TGG	0.113704	2:-23058037	MsaT007795.1:CDS
GCCATCTATATTTGGTTTAA+AGG	0.141804	2:-23057975	MsaT007795.1:CDS
CAGTCAAGGCCATCTATATT+TGG	0.179813	2:-23057983	MsaT007795.1:CDS
GATCCTTCGTTGACTACTTT+TGG	0.192467	2:-23057911	MsaT007795.1:CDS
TTGGAGGAAGTTAAGGGTTT+AGG	0.192505	2:-23057938	MsaT007795.1:CDS
TGGAGGAAGTTAAGGGTTTA+GGG	0.236533	2:-23057937	MsaT007795.1:CDS
AAACTATAACAAAACATATT+TGG	0.239296	2:+23057677	None:intergenic
TATTGTGGCTAATATCAATT+TGG	0.259534	2:-23058050	MsaT007795.1:CDS
AGACCAACCCCATTTCTTAA+AGG	0.307244	2:+23057829	None:intergenic
TTTGTTATAGTTTACATAAA+AGG	0.315414	2:-23057667	MsaT007795.1:CDS
GCAGAGAATGGTGTCCTTGC+TGG	0.321424	2:+23058117	None:intergenic
CTTGAGCAAGTTTGTCTTGA+AGG	0.325723	2:-23057543	MsaT007795.1:CDS
TCTCTGCTTAATTCGATATT+CGG	0.329319	2:-23058101	MsaT007795.1:CDS
AAAGGATTTGATTAAGTCAT+TGG	0.335353	2:-23057957	MsaT007795.1:CDS
AAACTAATCTGTAAAATTGC+AGG	0.337554	2:+23058190	None:intergenic
TGTAGGTAACCCTAAGTTCT+TGG	0.343348	2:-23058305	MsaT007795.1:intron
AAGCTTAATTCCAAGAACTT+AGG	0.347303	2:+23058295	None:intergenic
AAGTTGATACCTTTAAGAAA+TGG	0.365182	2:-23057838	MsaT007795.1:CDS
AGTTGATACCTTTAAGAAAT+GGG	0.365271	2:-23057837	MsaT007795.1:CDS
ATTGAAGCCAACATCAAATT+AGG	0.374513	2:+23057773	None:intergenic
ATATCTTCAGAATAAGTAAA+TGG	0.375368	2:+23057569	None:intergenic
TAAGTCATTGGAGGAAGTTA+AGG	0.377755	2:-23057945	MsaT007795.1:CDS
AATTGATATTAGCCACAATA+AGG	0.390705	2:+23058053	None:intergenic
AGCTTAATTCCAAGAACTTA+GGG	0.393617	2:+23058296	None:intergenic
ATCAGATGAAGAAGCGCCTT+TGG	0.403170	2:+23058237	None:intergenic
TCCTTTAAACCAAATATAGA+TGG	0.404648	2:+23057974	None:intergenic
TTACATAAAAGGATCATTCC+AGG	0.411963	2:-23057656	MsaT007795.1:CDS
TCAATTAGGTTGGGATTCCT+TGG	0.416390	2:-23057714	MsaT007795.1:CDS
TTGGGTCAATCAATTAGGTT+GGG	0.436055	2:-23057723	MsaT007795.1:CDS
AAGTCATTGGAGGAAGTTAA+GGG	0.441441	2:-23057944	MsaT007795.1:CDS
AATTGCAAAACTGAGGCTCC+TGG	0.473795	2:+23057638	None:intergenic
GAAATCACATATTAAGTGAA+TGG	0.476870	2:+23057446	None:intergenic
TTTGGGTCAATCAATTAGGT+TGG	0.477232	2:-23057724	MsaT007795.1:CDS
GTTGCTTTGGTAGCCAAGAA+AGG	0.483813	2:-23057887	MsaT007795.1:CDS
AACTAATCTGTAAAATTGCA+GGG	0.522503	2:+23058191	None:intergenic
ATATCAGCCTAATTTGATGT+TGG	0.524802	2:-23057780	MsaT007795.1:CDS
ATTAGCCACAATAAGGCGAT+AGG	0.536156	2:+23058060	None:intergenic
TTGCTAGTTTGCTTCAGTCA+AGG	0.547608	2:-23057997	MsaT007795.1:CDS
TGTGGCTAATATCAATTTGG+TGG	0.549748	2:-23058047	MsaT007795.1:CDS
TGGAAATTTAGCAAGTGCCA+AGG	0.550727	2:+23057697	None:intergenic
GTTGATACCTTTAAGAAATG+GGG	0.553181	2:-23057836	MsaT007795.1:CDS
GGATTTGATTAAGTCATTGG+AGG	0.561173	2:-23057954	MsaT007795.1:CDS
TGCGCCGCTGAACTCTCCAT+TGG	0.570549	2:-23059694	MsaT007795.1:intron
ATATCGAATTAAGCAGAGAA+TGG	0.572002	2:+23058105	None:intergenic
AAATCCCTATCGCCTTATTG+TGG	0.576235	2:-23058065	MsaT007795.1:CDS
ATACCTTTAAGAAATGGGGT+TGG	0.587688	2:-23057832	MsaT007795.1:CDS
GAGCAAGTTTGTCTTGAAGG+AGG	0.590871	2:-23057540	MsaT007795.1:CDS
TAGGTTCTTTAATTCCAGCA+AGG	0.604223	2:-23058131	MsaT007795.1:CDS
TTAGCCACAATAAGGCGATA+GGG	0.609256	2:+23058061	None:intergenic
CAAAAGAAATTGCAAAACTG+AGG	0.625549	2:+23057631	None:intergenic
GTTACCAATGGAGAGTTCAG+CGG	0.658433	2:+23059690	None:intergenic
AATGAAACTTGCATACACAA+AGG	0.663379	2:-23057483	MsaT007795.1:CDS
CTATCTATTAAAGTTATACG+AGG	0.674399	2:-23057510	MsaT007795.1:CDS
ACCCCAAAAGTAGTCAACGA+AGG	0.684823	2:+23057908	None:intergenic
GCATACACAAAGGAGAACAA+TGG	0.692068	2:-23057473	MsaT007795.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr2	gene	23057457	23059719	23057457	ID=MsaG007795
Chr2	mRNA	23057457	23059719	23057457	ID=MsaT007795.1;Parent=MsaG007795
Chr2	exon	23057457	23058322	23057457	ID=MsaT007795.1.exon2;Parent=MsaT007795.1
Chr2	CDS	23057457	23058322	23057457	ID=cds.MsaT007795.1;Parent=MsaT007795.1
Chr2	exon	23059695	23059719	23059695	ID=MsaT007795.1.exon1;Parent=MsaT007795.1
Chr2	CDS	23059695	23059719	23059695	ID=cds.MsaT007795.1;Parent=MsaT007795.1

Gene Sequence

>MsaT007795.1

ATGTGCGCCGCTGAACTCTCCATTGGTAACCCTAAGTTCTTGGAATTAAGCTTGAAGAATCATCAAATTAAGTTTGAATATTTTCTATCCAAAGGCGCTTCTTCATCTGATATTGTTTCATTGTTAACTGCAAACCCTGCAATTTTACAGATTAGTTTGGAGAAACGAATAATCCCTCTTTTTGAATTGTTAAATAGGTTCTTTAATTCCAGCAAGGACACCATTCTCTGCTTAATTCGATATTCGGCTGCATTTATTATAAATCCCTATCGCCTTATTGTGGCTAATATCAATTTGGTGGCTGATTTTGGAGTTTCTGATAATGTCATTGCTAGTTTGCTTCAGTCAAGGCCATCTATATTTGGTTTAAAGGATTTGATTAAGTCATTGGAGGAAGTTAAGGGTTTAGGGTTTGATCCTTCGTTGACTACTTTTGGGGTTGCTTTGGTAGCCAAGAAAGGTTTAAGTAAAAAACTTTGGGATGAGAAAGTTGATACCTTTAAGAAATGGGGTTGGTCTGATGAAGATGTAATTCGAGCATTTAGATATCAGCCTAATTTGATGTTGGCTTCAATTGATAAGATTAGTTTGCTGATGAGTTTTTGGGTCAATCAATTAGGTTGGGATTCCTTGGCACTTGCTAAATTTCCAAATATGTTTTGTTATAGTTTACATAAAAGGATCATTCCAGGAGCCTCAGTTTTGCAATTTCTTTTGATGAAAGGATTGCGAAAAAAGAATGCAAGCTTAGTCACACCATTTACTTATTCTGAAGATATGTTCTTGAGCAAGTTTGTCTTGAAGGAGGAGTCTAACTATCTATTAAAGTTATACGAGGAAAAAATGAAACTTGCATACACAAAGGAGAACAATGGCATGCCATTCACTTAA

Protein sequence

>MsaT007795.1

MCAAELSIGNPKFLELSLKNHQIKFEYFLSKGASSSDIVSLLTANPAILQISLEKRIIPLFELLNRFFNSSKDTILCLIRYSAAFIINPYRLIVANINLVADFGVSDNVIASLLQSRPSIFGLKDLIKSLEEVKGLGFDPSLTTFGVALVAKKGLSKKLWDEKVDTFKKWGWSDEDVIRAFRYQPNLMLASIDKISLLMSFWVNQLGWDSLALAKFPNMFCYSLHKRIIPGASVLQFLLMKGLRKKNASLVTPFTYSEDMFLSKFVLKEESNYLLKLYEEKMKLAYTKENNGMPFT*