AlfalfaGEDB | MsaG010545

M. sativa ssp. caerulea / MsaG010545

KEGG: -
GO: -
PFAM: PF00010.29

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG010545	XP_013465109.1	85.714	217	24	3	1	210	1	217	2.55e-125	363

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG010545	sp\|F4JIJ7\|BH162_ARATH	40.884	181	87	6	12	175	11	188	1.15e-32	119

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG010545	tr\|A0A072VAT4\|A0A072VAT4_MEDTR	85.714	217	24	3	1	210	1	217	1.22e-125	363

TFs/TRs:

Gene ID	Type	Classification
MsaG010545	TF	bHLH

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000459	MsaG010545	0.803346	6.131363e-49	8.945954e-47
MsaG001273	MsaG010545	0.846216	4.696256e-59	2.240236e-56
MsaG002043	MsaG010545	0.806416	1.409313e-49	2.208829e-47
MsaG002718	MsaG010545	0.800494	2.347440e-48	3.209462e-46
MsaG003503	MsaG010545	0.820162	1.389985e-52	3.070336e-50
MsaG003632	MsaG010545	0.809377	3.328985e-50	5.599906e-48
MsaG003715	MsaG010545	0.811398	1.225147e-50	2.164875e-48
MsaG003795	MsaG010545	0.836054	2.140523e-56	7.399898e-54
MsaG003894	MsaG010545	0.806683	1.238748e-49	1.953706e-47
MsaG003966	MsaG010545	0.810156	2.267439e-50	3.886820e-48
MsaG004280	MsaG010545	0.801115	1.755562e-48	2.434116e-46
MsaG004556	MsaG010545	0.811604	1.105192e-50	1.962824e-48
MsaG004681	MsaG010545	0.814430	2.671864e-51	5.091438e-49
MsaG005005	MsaG010545	0.840636	1.428130e-57	5.687419e-55
MsaG005641	MsaG010545	0.827509	2.685711e-54	7.243784e-52
MsaG006122	MsaG010545	0.802743	8.159667e-49	1.174066e-46
MsaG006335	MsaG010545	0.811418	1.212749e-50	2.144032e-48
MsaG006351	MsaG010545	0.834294	5.923709e-56	1.942768e-53
MsaG006422	MsaG010545	0.828680	1.406921e-54	3.921464e-52
MsaG006610	MsaG010545	0.853265	5.148552e-61	3.126735e-58
MsaG006623	MsaG010545	0.804922	2.891613e-49	4.375922e-47
MsaG006655	MsaG010545	0.804475	3.581240e-49	5.363558e-47
MsaG006638	MsaG010545	0.811037	1.465398e-50	2.566633e-48
MsaG006751	MsaG010545	0.824361	1.489939e-53	3.683263e-51
MsaG007182	MsaG010545	0.834820	4.374885e-56	1.457575e-53
MsaG007551	MsaG010545	0.803633	5.349187e-49	7.856553e-47
MsaG008238	MsaG010545	0.825556	7.808466e-54	1.994507e-51
MsaG009121	MsaG010545	0.800931	1.913719e-48	2.642381e-46
MsaG010052	MsaG010545	0.807970	6.628162e-50	1.077864e-47
MsaG010545	MsaG012489	0.848901	8.650307e-60	4.515839e-57
MsaG010545	MsaG013333	0.800685	2.147684e-48	2.949149e-46
MsaG010545	MsaG016663	0.803277	6.335000e-49	9.228417e-47
MsaG010545	MsaG017057	0.811602	1.106600e-50	1.965213e-48
MsaG010545	MsaG017310	0.816143	1.116528e-51	2.221896e-49
MsaG010545	MsaG017317	0.809638	2.926509e-50	4.954179e-48
MsaG010545	MsaG017719	0.800840	1.997299e-48	2.752142e-46
MsaG010545	MsaG017828	0.813440	4.407498e-51	8.192674e-49
MsaG010545	MsaG018078	0.828956	1.207311e-54	3.391206e-52
MsaG010545	MsaG018214	0.816960	7.342732e-52	1.492082e-49
MsaG010545	MsaG018577	0.845986	5.420313e-59	2.565960e-56
MsaG010545	MsaG018793	0.801404	1.533379e-48	2.140001e-46
MsaG010545	MsaG019395	0.809630	2.939424e-50	4.974979e-48
MsaG010545	MsaG019525	0.816590	8.877168e-52	1.786791e-49
MsaG010545	MsaG019910	0.835110	3.700375e-56	1.243576e-53
MsaG010545	MsaG020031	0.811557	1.131523e-50	2.007273e-48
MsaG010545	MsaG020346	0.831205	3.434481e-55	1.028849e-52
MsaG010545	MsaG021294	0.803309	6.240587e-49	9.097361e-47
MsaG010545	MsaG023376	0.803422	5.912691e-49	8.641965e-47
MsaG010545	MsaG024008	0.817549	5.420058e-52	1.118208e-49
MsaG010545	MsaG024303	0.831390	3.094298e-55	9.319829e-53
MsaG010545	MsaG024453	0.810331	2.079569e-50	3.580148e-48
MsaG010545	MsaG024480	0.817231	6.384504e-52	1.306516e-49
MsaG010545	MsaG026022	0.801963	1.178689e-48	1.666040e-46
MsaG010545	MsaG026607	0.808474	5.182093e-50	8.529966e-48
MsaG010545	MsaG026786	0.851387	1.752849e-60	9.965428e-58
MsaG010545	MsaG026963	0.807453	8.526845e-50	1.369498e-47
MsaG010545	MsaG027307	0.818533	3.254923e-52	6.888011e-50
MsaG010545	MsaG027822	0.806040	1.689857e-49	2.624880e-47
MsaG010545	MsaG027763	0.825503	8.035314e-54	2.049450e-51
MsaG010545	MsaG027877	0.804596	3.379429e-49	5.075510e-47
MsaG010545	MsaG028135	0.821302	7.626765e-53	1.736199e-50
MsaG010545	MsaG028248	0.816200	1.084768e-51	2.161727e-49
MsaG010545	MsaG029091	0.801167	1.713481e-48	2.378556e-46
MsaG010545	MsaG029422	0.816112	1.134372e-51	2.255524e-49
MsaG010545	MsaG029752	0.816137	1.120106e-51	2.228613e-49
MsaG010545	MsaG030902	0.804204	4.076570e-49	6.067346e-47
MsaG010545	MsaG032279	0.803580	5.484971e-49	8.046227e-47
MsaG010545	MsaG032702	0.842530	4.550190e-58	1.924716e-55
MsaG010545	MsaG033995	0.862036	1.331390e-63	1.118970e-60
MsaG010545	MsaG034590	0.833306	1.043256e-55	3.322993e-53
MsaG010545	MsaG035037	0.853978	3.219377e-61	2.005456e-58
MsaG010545	MsaG038749	0.822624	3.780300e-53	8.915193e-51
MsaG010545	MsaG039468	0.820285	1.303301e-52	2.888236e-50
MsaG010545	MsaG040095	0.855575	1.114327e-61	7.350580e-59
MsaG010545	MsaG040379	0.807112	1.006299e-49	1.603162e-47
MsaG010545	MsaG041202	0.831396	3.084274e-55	9.291421e-53
MsaG010545	MsaG043237	0.806857	1.138619e-49	1.803093e-47
MsaG010545	MsaG043817	0.802416	9.522702e-49	1.360039e-46
MsaG010545	MsaG044019	0.806054	1.678446e-49	2.608057e-47
MsaG010545	MsaG044303	0.815866	1.286566e-51	2.542168e-49
MsaG010545	MsaG044546	0.806739	1.205694e-49	1.904070e-47
MsaG010545	MsaG044617	0.803453	5.827222e-49	8.523117e-47
MsaG010545	MsaG045439	0.821929	5.470940e-53	1.266322e-50
MsaG010545	MsaG045535	0.809699	2.841236e-50	4.816795e-48
MsaG010545	MsaG045778	0.837138	1.136412e-56	4.059417e-54
MsaG010545	MsaG046104	0.808806	4.405916e-50	7.310463e-48
MsaG010545	MsaG046180	0.833861	7.595431e-56	2.458968e-53
MsaG010545	MsaG046540	0.806493	1.357585e-49	2.131590e-47
MsaG010545	MsaG046780	0.814858	2.150106e-51	4.141546e-49
MsaG010545	MsaG047011	0.822141	4.888270e-53	1.137924e-50
MsaG010545	MsaG001950	0.839700	2.500547e-57	9.670116e-55
MsaG010545	MsaG001966	0.809861	2.622904e-50	4.464128e-48
MsaG010545	MsaG002578	0.806283	1.503114e-49	2.348380e-47
MsaG010545	MsaG002617	0.801970	1.175268e-48	1.661439e-46
MsaG010545	MsaG014278	0.802063	1.124643e-48	1.593259e-46
MsaG010545	MsaG017584	0.837962	7.002800e-57	2.565384e-54
MsaG010545	MsaG012272	0.825567	7.759868e-54	1.982713e-51
MsaG010545	MsaG019880	0.821933	5.459824e-53	1.263869e-50
MsaG010545	MsaG018939	0.809585	3.004605e-50	5.080044e-48
MsaG010545	MsaG026803	0.803698	5.186000e-49	7.628557e-47
MsaG010545	MsaG033077	0.833720	8.232210e-56	2.654320e-53
MsaG010545	MsaG031964	0.807551	8.127239e-50	1.308416e-47
MsaG010545	MsaG034262	0.808289	5.671515e-50	9.294085e-48
MsaG010545	MsaG031242	0.824552	1.344605e-53	3.341204e-51
MsaG010545	MsaG030550	0.805074	2.688448e-49	4.082844e-47
MsaG010545	MsaG033449	0.825858	6.625004e-54	1.706569e-51
MsaG010545	MsaG033259	0.810203	2.215341e-50	3.801841e-48
MsaG010545	MsaG034891	0.839673	2.540864e-57	9.817469e-55
MsaG010545	MsaG036736	0.801786	1.281602e-48	1.804176e-46
MsaG010545	MsaG037155	0.823660	2.172404e-53	5.269090e-51
MsaG010545	MsaG035248	0.814337	2.801121e-51	5.325185e-49
MsaG010545	MsaG037051	0.800701	2.131074e-48	2.927413e-46
MsaG010545	MsaG039945	0.861854	1.513549e-63	1.262970e-60
MsaG010545	MsaG035299	0.812018	8.990232e-51	1.612985e-48
MsaG010545	MsaG046905	0.814661	2.376250e-51	4.554346e-49

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG010545	MtrunA17_Chr2g0324511	81.595	163	20	2	1	153	1	163	1.64e-88	258
MsaG010545	MtrunA17_Chr4g0040201	66.495	194	57	4	9	194	8	201	1.60e-83	246
MsaG010545	MtrunA17_Chr2g0324521	86.957	115	9	2	45	153	2	116	3.03e-63	192
MsaG010545	MtrunA17_Chr2g0324571	80.342	117	15	1	45	153	2	118	4.19e-62	189
MsaG010545	MtrunA17_Chr2g0324531	86.441	59	8	0	152	210	2	60	2.11e-31	109
MsaG010545	MtrunA17_Chr2g0282341	39.552	134	69	3	48	173	4	133	4.18e-28	103

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG010545	AT4G20970.1	40.884	181	87	6	12	175	11	188	1.17e-33	119
MsaG010545	AT1G10585.1	28.902	173	117	3	7	177	9	177	1.82e-14	68.9
MsaG010545	AT5G51780.1	29.586	169	105	3	14	169	3	170	3.99e-12	62.8
MsaG010545	AT5G51780.2	29.586	169	105	3	14	169	26	193	6.11e-12	62.4
MsaG010545	AT1G10586.1	25.882	170	120	3	7	174	9	174	4.88e-11	59.7

Find 41 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
CCACAAACTTTGTTACAATT+TGG	0.173105	2:+74569726	MsaT010545.1:CDS
TATCTCTTCAAATTCTTCTT+TGG	0.234992	2:+74568785	MsaT010545.1:CDS
CAATTGTGGGATCTTGAAAT+TGG	0.247122	2:+74569819	MsaT010545.1:CDS
ATGCTTCTTAATTAAGGATT+TGG	0.262973	2:-74569888	None:intergenic
AACAAGAAAGAAAGTTTAAA+AGG	0.273993	2:+74568630	MsaT010545.1:CDS
AGAGAAGAAAGAAAGTTTAA+TGG	0.275748	2:+74568605	MsaT010545.1:CDS
GAGAGTTAAGTTTGGAATAG+AGG	0.305206	2:-74567870	None:intergenic
GAGAAGAAAGAAAGTTTAAT+GGG	0.355968	2:+74568606	MsaT010545.1:CDS
CCAACTTTAGATTTGTCTCT+AGG	0.356186	2:-74568578	None:intergenic
AGGAAGAAGAGAGTTAAGTT+TGG	0.360183	2:-74567878	None:intergenic
CCAAATTGTAACAAAGTTTG+TGG	0.389197	2:-74569726	None:intergenic
AACATCCTTTCTTTCGACTT+TGG	0.397896	2:-74567818	None:intergenic
TCTTCAAATTCTTCTTTGGC+TGG	0.403407	2:+74568789	MsaT010545.1:CDS
TTGAAATTGGAAGTGAGAGT+TGG	0.404544	2:+74569832	MsaT010545.1:CDS
TAATTTCACAGAAAATAAAA+TGG	0.425918	2:-74568731	None:intergenic
ATAGCCTCATCTACTTGATC+AGG	0.429867	2:-74568540	None:intergenic
CTTTCGACTTTGGTTGAACA+AGG	0.449950	2:-74567808	None:intergenic
AAAATAGAGATTCATGAAAT+GGG	0.456591	2:+74568669	MsaT010545.1:CDS
TGAAATTGGAAGTGAGAGTT+GGG	0.469657	2:+74569833	MsaT010545.1:CDS
TCTTCATACCGTGCATGCTC+AGG	0.472764	2:+74568821	MsaT010545.1:CDS
TCTTGTTGATTATGTTCCAT+TGG	0.483862	2:-74567778	None:intergenic
TTCAACCAAAGTCGAAAGAA+AGG	0.492351	2:+74567813	MsaT010545.1:CDS
CCTAGAGACAAATCTAAAGT+TGG	0.498284	2:+74568578	MsaT010545.1:CDS
ATTTCAAGATCCCACAATTG+AGG	0.509351	2:-74569816	None:intergenic
TTAAGGATTTGGTAAACTCA+TGG	0.514490	2:-74569877	None:intergenic
TCATCTACTTGATCAGGTAA+TGG	0.522136	2:-74568534	None:intergenic
TACAAGTGATTGTAACATGT+GGG	0.544345	2:+74568700	MsaT010545.1:CDS
GGAAACACAGCCTCAATTGT+GGG	0.559018	2:+74569806	MsaT010545.1:CDS
TGGAAACACAGCCTCAATTG+TGG	0.568137	2:+74569805	MsaT010545.1:CDS
ATGACCTTCGAATTATAGCT+AGG	0.581881	2:-74567898	None:intergenic
TCTTCCTAGCTATAATTCGA+AGG	0.587922	2:+74567894	MsaT010545.1:CDS
TATATATACCTGAGCATGCA+CGG	0.590008	2:-74568829	None:intergenic
GAGCAATCAAAATAAGTGAG+AGG	0.593941	2:+74569748	MsaT010545.1:CDS
TGTTACAATCACTTGTAGAG+TGG	0.604182	2:-74568694	None:intergenic
GTTACAATCACTTGTAGAGT+GGG	0.605139	2:-74568693	None:intergenic
CTACAAGTGATTGTAACATG+TGG	0.615945	2:+74568699	MsaT010545.1:CDS
AGGTTGAAAGAGTTTGTGAA+CGG	0.618184	2:+74569768	MsaT010545.1:CDS
ATTACCTGATCAAGTAGATG+AGG	0.636526	2:+74568536	MsaT010545.1:CDS
GAACGGATCTGTGAGCGATG+TGG	0.701045	2:+74569785	MsaT010545.1:CDS
ACAAGTGATTGTAACATGTG+GGG	0.739715	2:+74568701	MsaT010545.1:CDS
ACTGCATGAAGAGAACGTCG+AGG	0.768331	2:+74568761	MsaT010545.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr2	gene	74567781	74569899	74567781	ID=MsaG010545
Chr2	mRNA	74567781	74569899	74567781	ID=MsaT010545.1;Parent=MsaG010545
Chr2	exon	74567781	74567915	74567781	ID=MsaT010545.1.exon1;Parent=MsaT010545.1
Chr2	CDS	74567781	74567915	74567781	ID=cds.MsaT010545.1;Parent=MsaT010545.1
Chr2	exon	74568522	74568842	74568522	ID=MsaT010545.1.exon2;Parent=MsaT010545.1
Chr2	CDS	74568522	74568842	74568522	ID=cds.MsaT010545.1;Parent=MsaT010545.1
Chr2	exon	74569723	74569899	74569723	ID=MsaT010545.1.exon3;Parent=MsaT010545.1
Chr2	CDS	74569723	74569899	74569723	ID=cds.MsaT010545.1;Parent=MsaT010545.1

Gene Sequence

>MsaT010545.1

ATGGAACATAATCAACAAGAATGTCAACCTTGTTCAACCAAAGTCGAAAGAAAGGATGTTGAGAAAAATAGGAGAAATCAGATGAAGATCCTCTATTCCAAACTTAACTCTCTTCTTCCTAGCTATAATTCGAAGGAATTAACGTTACCATTACCTGATCAAGTAGATGAGGCTATAAACTACATAAAGAGCCTAGAGACAAATCTAAAGTTGGCAAAAGAGAAGAAAGAAAGTTTAATGGGAAACAAGAAAGAAAGTTTAAAAGGAAGCATAAAGTTGCCAAAAATAGAGATTCATGAAATGGGACCCACTCTACAAGTGATTGTAACATGTGGGGTTGATGACCATTTTATTTTCTGTGAAATTATGAGAATACTGCATGAAGAGAACGTCGAGGTTATCTCTTCAAATTCTTCTTTGGCTGGTGATTCACTTCTTCATACCGTGCATGCTCAGATTCCACAAACTTTGTTACAATTTGGAGCAATCAAAATAAGTGAGAGGTTGAAAGAGTTTGTGAACGGATCTGTGAGCGATGTGGAAACACAGCCTCAATTGTGGGATCTTGAAATTGGAAGTGAGAGTTGGGAGCTTCTACATTCTGTAGTAACCATGAGTTTACCAAATCCTTAA

Protein sequence

>MsaT010545.1

MEHNQQECQPCSTKVERKDVEKNRRNQMKILYSKLNSLLPSYNSKELTLPLPDQVDEAINYIKSLETNLKLAKEKKESLMGNKKESLKGSIKLPKIEIHEMGPTLQVIVTCGVDDHFIFCEIMRILHEENVEVISSNSSLAGDSLLHTVHAQIPQTLLQFGAIKISERLKEFVNGSVSDVETQPQLWDLEIGSESWELLHSVVTMSLPNP*