AlfalfaGEDB | MsaG012019

M. sativa ssp. caerulea / MsaG012019

KEGG: -
GO: -
PFAM: PF13837.9

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012019	GAU28263.1	85.970	335	33	6	6	329	3	334	0.0	561

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012019	sp\|Q9LJG8\|ASIL2_ARATH	35.772	123	67	2	30	140	61	183	4.49e-15	79.0

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012019	tr\|A0A2Z6ME36\|A0A2Z6ME36_TRISU	85.970	335	33	6	6	329	3	334	0.0	561

TFs/TRs:

Gene ID	Type	Classification
MsaG012019	TF	Trihelix

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000213	MsaG012019	0.808151	6.069265e-50	9.912741e-48
MsaG000151	MsaG012019	0.834776	4.487356e-56	1.493102e-53
MsaG000163	MsaG012019	0.846430	4.109394e-59	1.974134e-56
MsaG000714	MsaG012019	0.832625	1.537282e-55	4.799861e-53
MsaG001004	MsaG012019	0.810166	2.255677e-50	3.867665e-48
MsaG001273	MsaG012019	0.806884	1.123498e-49	1.780304e-47
MsaG001765	MsaG012019	0.826120	5.745116e-54	1.490713e-51
MsaG002526	MsaG012019	0.816133	1.122349e-51	2.232847e-49
MsaG002555	MsaG012019	0.804468	3.593811e-49	5.381529e-47
MsaG003072	MsaG012019	0.816759	8.139489e-52	1.645483e-49
MsaG003322	MsaG012019	0.803092	6.915741e-49	1.003157e-46
MsaG003520	MsaG012019	0.802517	9.076406e-49	1.299302e-46
MsaG003658	MsaG012019	0.806109	1.634245e-49	2.542710e-47
MsaG003778	MsaG012019	0.850110	3.994937e-60	2.173012e-57
MsaG003828	MsaG012019	0.808107	6.200127e-50	1.011593e-47
MsaG003859	MsaG012019	0.804862	2.975637e-49	4.496912e-47
MsaG003891	MsaG012019	0.818020	4.247917e-52	8.871012e-50
MsaG003975	MsaG012019	0.823231	2.733071e-53	6.552162e-51
MsaG004303	MsaG012019	0.812437	7.293883e-51	1.322281e-48
MsaG004426	MsaG012019	0.806695	1.231293e-49	1.942543e-47
MsaG004923	MsaG012019	0.808009	6.502760e-50	1.058486e-47
MsaG005077	MsaG012019	0.822176	4.798952e-53	1.118166e-50
MsaG005078	MsaG012019	0.800378	2.478261e-48	3.379526e-46
MsaG005408	MsaG012019	0.818278	3.715395e-52	7.810610e-50
MsaG005875	MsaG012019	0.811700	1.053815e-50	1.875985e-48
MsaG005995	MsaG012019	0.821420	7.164774e-53	1.636103e-50
MsaG006150	MsaG012019	0.802284	1.013281e-48	1.442796e-46
MsaG006240	MsaG012019	0.817788	4.788407e-52	9.940028e-50
MsaG006638	MsaG012019	0.811322	1.272025e-50	2.243566e-48
MsaG006752	MsaG012019	0.805186	2.547673e-49	3.879241e-47
MsaG006891	MsaG012019	0.812984	5.541916e-51	1.018457e-48
MsaG007177	MsaG012019	0.808733	4.566213e-50	7.563340e-48
MsaG007847	MsaG012019	0.800546	2.291627e-48	3.136876e-46
MsaG007850	MsaG012019	0.801323	1.593034e-48	2.219199e-46
MsaG007742	MsaG012019	0.814869	2.138755e-51	4.120802e-49
MsaG008428	MsaG012019	0.812608	6.692929e-51	1.218500e-48
MsaG008704	MsaG012019	0.813575	4.117390e-51	7.679380e-49
MsaG009531	MsaG012019	0.812716	6.342040e-51	1.157700e-48
MsaG009848	MsaG012019	0.812695	6.407798e-51	1.169117e-48
MsaG010245	MsaG012019	0.807690	7.595670e-50	1.226935e-47
MsaG010644	MsaG012019	0.812927	5.702503e-51	1.046480e-48
MsaG010890	MsaG012019	0.823335	2.586328e-53	6.217924e-51
MsaG011023	MsaG012019	0.802191	1.058705e-48	1.504239e-46
MsaG011144	MsaG012019	0.817934	4.441665e-52	9.254952e-50
MsaG011508	MsaG012019	0.801866	1.234198e-48	1.740667e-46
MsaG011819	MsaG012019	0.816191	1.089424e-51	2.170546e-49
MsaG012019	MsaG012101	0.807688	7.605044e-50	1.228370e-47
MsaG012019	MsaG012576	0.833787	7.923551e-56	2.559772e-53
MsaG012019	MsaG013974	0.805724	1.967937e-49	3.034172e-47
MsaG012019	MsaG014555	0.818546	3.232778e-52	6.843359e-50
MsaG012019	MsaG015145	0.828906	1.241807e-54	3.483217e-52
MsaG012019	MsaG016796	0.829654	8.190444e-55	2.347046e-52
MsaG012019	MsaG017114	0.811537	1.143104e-50	2.026789e-48
MsaG012019	MsaG017348	0.804101	4.280478e-49	6.355929e-47
MsaG012019	MsaG017500	0.839513	2.794799e-57	1.074435e-54
MsaG012019	MsaG017839	0.803605	5.421080e-49	7.957009e-47
MsaG012019	MsaG018082	0.809391	3.305159e-50	5.561849e-48
MsaG012019	MsaG018689	0.805756	1.937732e-49	2.989869e-47
MsaG012019	MsaG018722	0.810107	2.322527e-50	3.976555e-48
MsaG012019	MsaG018897	0.813681	3.902395e-51	7.297764e-49
MsaG012019	MsaG019118	0.825798	6.843573e-54	1.759906e-51
MsaG012019	MsaG019122	0.806753	1.197163e-49	1.891268e-47
MsaG012019	MsaG019480	0.825684	7.284060e-54	1.867232e-51
MsaG012019	MsaG020287	0.839760	2.412945e-57	9.348471e-55
MsaG012019	MsaG020418	0.804302	3.890191e-49	5.803206e-47
MsaG012019	MsaG020648	0.814491	2.590981e-51	4.944721e-49
MsaG012019	MsaG020754	0.814964	2.037809e-51	3.935739e-49
MsaG012019	MsaG021290	0.816778	8.063298e-52	1.630829e-49
MsaG012019	MsaG021301	0.813929	3.442977e-51	6.478964e-49
MsaG012019	MsaG022236	0.802424	9.487731e-49	1.355277e-46
MsaG012019	MsaG023664	0.810561	1.855853e-50	3.212909e-48
MsaG012019	MsaG023674	0.823360	2.551446e-53	6.138262e-51
MsaG012019	MsaG023812	0.801233	1.661396e-48	2.309652e-46
MsaG012019	MsaG023813	0.805869	1.835007e-49	2.838925e-47
MsaG012019	MsaG024225	0.833666	8.491296e-56	2.733607e-53
MsaG012019	MsaG024615	0.828129	1.908439e-54	5.238007e-52
MsaG012019	MsaG026584	0.814992	2.009380e-51	3.883552e-49
MsaG012019	MsaG027248	0.822060	5.103034e-53	1.185330e-50
MsaG012019	MsaG027590	0.828953	1.209459e-54	3.396946e-52
MsaG012019	MsaG027648	0.812329	7.698637e-51	1.391881e-48
MsaG012019	MsaG027898	0.832063	2.114794e-55	6.496650e-53
MsaG012019	MsaG028248	0.800787	2.047231e-48	2.817709e-46
MsaG012019	MsaG029370	0.827091	3.378731e-54	9.007015e-52
MsaG012019	MsaG032970	0.814066	3.213247e-51	6.067218e-49
MsaG012019	MsaG033640	0.815026	1.974739e-51	3.819825e-49
MsaG012019	MsaG034085	0.819749	1.726524e-52	3.771811e-50
MsaG012019	MsaG034794	0.807468	8.463577e-50	1.359839e-47
MsaG012019	MsaG035659	0.815953	1.230950e-51	2.437690e-49
MsaG012019	MsaG036046	0.806944	1.091755e-49	1.732420e-47
MsaG012019	MsaG036055	0.818452	3.395338e-52	7.169957e-50
MsaG012019	MsaG036122	0.831626	2.708697e-55	8.215444e-53
MsaG012019	MsaG036468	0.803642	5.325825e-49	7.823931e-47
MsaG012019	MsaG039347	0.831698	2.600008e-55	7.902786e-53
MsaG012019	MsaG040264	0.800137	2.773481e-48	3.761467e-46
MsaG012019	MsaG040907	0.824230	1.599043e-53	3.938700e-51
MsaG012019	MsaG041534	0.822166	4.825089e-53	1.123936e-50
MsaG012019	MsaG041731	0.819445	2.023235e-52	4.385145e-50
MsaG012019	MsaG041930	0.808647	4.761312e-50	7.870146e-48
MsaG012019	MsaG041985	0.800027	2.918820e-48	3.948926e-46
MsaG012019	MsaG041982	0.858217	1.872650e-62	1.361260e-59
MsaG012019	MsaG042381	0.800239	2.644372e-48	3.594646e-46
MsaG012019	MsaG043809	0.814262	2.909423e-51	5.520778e-49
MsaG012019	MsaG043880	0.813323	4.673234e-51	8.661093e-49
MsaG012019	MsaG044049	0.802989	7.260845e-49	1.050706e-46
MsaG012019	MsaG044546	0.804344	3.811992e-49	5.692075e-47
MsaG012019	MsaG045267	0.803036	7.103383e-49	1.029011e-46
MsaG012019	MsaG046066	0.819623	1.844027e-52	4.015117e-50
MsaG012019	MsaG046534	0.814886	2.120670e-51	4.087631e-49
MsaG012019	MsaG046643	0.808352	5.499526e-50	9.025786e-48
MsaG012019	MsaG046981	0.809264	3.518516e-50	5.902560e-48
MsaG012019	MsaG047018	0.822928	3.214603e-53	7.643453e-51
MsaG012019	MsaG047137	0.831221	3.404112e-55	1.020208e-52
MsaG012019	MsaG047188	0.806810	1.164818e-49	1.842550e-47
MsaG012019	MsaG000632	0.806097	1.643951e-49	2.557090e-47
MsaG012019	MsaG002578	0.809006	3.994426e-50	6.659783e-48
MsaG012019	MsaG002661	0.815455	1.587004e-51	3.103377e-49
MsaG012019	MsaG010138	0.813939	3.426645e-51	6.449765e-49
MsaG012019	MsaG012667	0.823994	1.816063e-53	4.444650e-51
MsaG012019	MsaG011821	0.805779	1.916268e-49	2.958336e-47
MsaG012019	MsaG019851	0.802533	9.009527e-49	1.290196e-46
MsaG012019	MsaG020114	0.801981	1.168767e-48	1.652712e-46
MsaG012019	MsaG027558	0.806951	1.088072e-49	1.726853e-47
MsaG012019	MsaG027436	0.800298	2.572240e-48	3.501254e-46
MsaG012019	MsaG033619	0.808791	4.437741e-50	7.360661e-48
MsaG012019	MsaG033077	0.817613	5.241339e-52	1.083111e-49
MsaG012019	MsaG032427	0.802953	7.385695e-49	1.067866e-46
MsaG012019	MsaG031602	0.811186	1.360902e-50	2.392333e-48
MsaG012019	MsaG036769	0.816528	9.164156e-52	1.841611e-49
MsaG012019	MsaG036522	0.813338	4.639286e-51	8.601298e-49
MsaG012019	MsaG036600	0.810204	2.214680e-50	3.800784e-48
MsaG012019	MsaG037555	0.801974	1.173021e-48	1.658436e-46
MsaG012019	MsaG035492	0.803817	4.900971e-49	7.229085e-47
MsaG012019	MsaG039594	0.803789	4.967869e-49	7.322898e-47
MsaG012019	MsaG045742	0.808023	6.458110e-50	1.051581e-47
MsaG012019	MsaG042294	0.800997	1.856064e-48	2.566568e-46

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012019	MtrunA17_Chr3g0082261	90.774	336	11	7	1	329	1	323	0.0	552
MsaG012019	MtrunA17_Chr1g0164461	88.945	199	6	6	1	196	1	186	1.66e-109	317
MsaG012019	MtrunA17_Chr1g0164431	92.929	99	3	1	235	329	1	99	7.73e-57	179
MsaG012019	MtrunA17_Chr8g0344681	24.922	321	165	11	26	309	52	333	1.69e-17	82.4
MsaG012019	MtrunA17_Chr2g0283871	37.097	124	70	4	40	156	18	140	3.98e-17	80.9
MsaG012019	MtrunA17_Chr1g0179531	40.816	98	49	3	39	130	127	221	2.16e-15	76.6
MsaG012019	MtrunA17_Chr4g0041151	35.354	99	56	2	43	133	29	127	2.13e-13	69.7
MsaG012019	MtrunA17_Chr5g0402321	33.036	112	66	3	45	147	22	133	4.96e-12	64.7
MsaG012019	MtrunA17_Chr4g0066271	23.469	294	186	7	39	311	111	386	4.19e-11	63.5

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012019	AT3G54390.2	59.386	293	89	6	38	328	47	311	3.36e-102	303
MsaG012019	AT3G54390.1	59.386	293	89	6	38	328	31	295	3.69e-102	302
MsaG012019	AT3G10030.1	42.000	100	51	2	33	127	149	246	1.55e-17	83.6
MsaG012019	AT3G10030.2	40.777	103	54	2	33	130	149	249	2.05e-17	83.2
MsaG012019	AT3G14180.1	35.772	123	67	2	30	140	61	183	4.56e-16	79.0
MsaG012019	AT3G58630.2	25.773	291	175	10	41	309	22	293	9.74e-15	74.3
MsaG012019	AT3G58630.1	25.773	291	175	10	41	309	22	293	1.06e-14	74.3
MsaG012019	AT3G24860.1	40.698	86	47	2	45	129	65	147	6.57e-14	71.6
MsaG012019	AT3G11100.1	43.333	90	49	2	41	130	18	105	9.15e-13	67.8
MsaG012019	AT2G44730.1	33.673	98	58	1	39	129	58	155	1.19e-11	65.5

Find 51 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TTACACTGTGTTTGTGTCTT+TGG	0.214518	3:+17261376	None:intergenic
AAACAAAACAATATTATTAT+TGG	0.217354	3:-17261574	MsaT012019.1:CDS
TTGAAGCATATGAATCAAAA+TGG	0.232049	3:-17261486	MsaT012019.1:CDS
CAAAACTCACATGGATCAAA+TGG	0.353080	3:-17261106	MsaT012019.1:CDS
ATGGATTCTTGTTAGCGATA+TGG	0.365210	3:+17259629	None:intergenic
GTTGATTCATCATTGAGAAT+TGG	0.394877	3:-17259283	MsaT012019.1:CDS
ATTATTATTGGTAGTGGAAG+TGG	0.394946	3:-17261562	MsaT012019.1:CDS
AACAATATTATTATTGGTAG+TGG	0.397415	3:-17261568	MsaT012019.1:CDS
ACTAAACAATAATCAAGGTT+TGG	0.408425	3:-17261227	MsaT012019.1:CDS
AAGCGCCGGCGTGCTGCTAT+CGG	0.427506	3:+17259600	None:intergenic
CAGAGAACAATAACAATAAG+AGG	0.430888	3:-17259531	MsaT012019.1:CDS
CAAAACTCAAAGGACAAGAT+TGG	0.436569	3:-17261447	MsaT012019.1:CDS
GGTGATTCTTGTTGTGATGT+TGG	0.438336	3:+17261601	None:intergenic
CTAGTTCAGATGTTTCATCT+TGG	0.449491	3:-17261309	MsaT012019.1:CDS
AAAACTCACATGGATCAAAT+GGG	0.461537	3:-17261105	MsaT012019.1:CDS
TGAGGCAAAGAGAGGAGAAA+TGG	0.461965	3:-17259389	MsaT012019.1:CDS
GGTGGAGGAACAACCGTACT+AGG	0.467128	3:+17261142	None:intergenic
GACTTGATCTTCTTCTTCGT+GGG	0.486660	3:-17261273	MsaT012019.1:CDS
GATCTTCTTCTTCGTGGGAC+AGG	0.486736	3:-17261268	MsaT012019.1:CDS
AAAACTCAAAGGACAAGATT+GGG	0.491011	3:-17261446	MsaT012019.1:CDS
GGCTAGCTGAGGTGGTAGTA+AGG	0.495732	3:-17259468	MsaT012019.1:CDS
TGGGAATAGCAGAAAGCATA+AGG	0.497144	3:-17259492	MsaT012019.1:CDS
TGAAGCATATGAATCAAAAT+GGG	0.499206	3:-17261485	MsaT012019.1:CDS
AGACTTGATCTTCTTCTTCG+TGG	0.502001	3:-17261274	MsaT012019.1:CDS
ATTCTTGTTGTGATGTTGGA+GGG	0.502379	3:+17261605	None:intergenic
ATACACAACTTGAGATTGCT+AGG	0.505134	3:-17259339	MsaT012019.1:CDS
TGAGCAGTTGTAATTGGTGG+AGG	0.515009	3:+17261127	None:intergenic
AGATTGAGTCCATGAAGAAA+AGG	0.517431	3:-17261348	MsaT012019.1:CDS
AAGGTCAGAACAAACAAGAA+TGG	0.526165	3:-17259449	MsaT012019.1:CDS
GAGGCAAAAGAAAGAAACAA+TGG	0.541095	3:-17259512	MsaT012019.1:CDS
GATTCTTGTTGTGATGTTGG+AGG	0.544639	3:+17261604	None:intergenic
TATCGCTAACAAGAATCCAT+TGG	0.548742	3:-17259626	MsaT012019.1:CDS
AGGCAAAAGAAAGAAACAAT+GGG	0.549197	3:-17259511	MsaT012019.1:CDS
ACAACACTAAACAATAATCA+AGG	0.555763	3:-17261232	MsaT012019.1:CDS
CATAAGGTGGCTAGCTGAGG+TGG	0.564897	3:-17259476	MsaT012019.1:CDS
GAAGATGAGAGTTGAAGCTG+AGG	0.581651	3:-17259407	MsaT012019.1:CDS
GTGCTGCTATCGGTTTCCAA+TGG	0.590073	3:+17259610	None:intergenic
AAAAGAGATGAATGGAGTGA+AGG	0.593095	3:-17261526	MsaT012019.1:CDS
AGAAATAGAGCAAAACTCAA+AGG	0.604235	3:-17261457	MsaT012019.1:CDS
GTTGAAGCTGAGGCAAAGAG+AGG	0.612939	3:-17259397	MsaT012019.1:CDS
ACAACTGCTCAAAACTCACA+TGG	0.614879	3:-17261115	MsaT012019.1:CDS
AAGCATAAGGTGGCTAGCTG+AGG	0.618034	3:-17259479	MsaT012019.1:CDS
TGGGGTTGATAAATTAGTCA+AGG	0.623652	3:-17261086	MsaT012019.1:intron
TCAGCCACTAGCTCCTAGTA+CGG	0.644324	3:-17261155	MsaT012019.1:CDS
GGAAACCGATAGCAGCACGC+CGG	0.658154	3:-17259605	MsaT012019.1:CDS
ACAACCGTACTAGGAGCTAG+TGG	0.669765	3:+17261151	None:intergenic
AAACTCACATGGATCAAATG+GGG	0.677274	3:-17261104	MsaT012019.1:CDS
AGATCAAGTCTAGAATACAA+AGG	0.687202	3:+17261286	None:intergenic
GAATAGCAGAAAGCATAAGG+TGG	0.715377	3:-17259489	MsaT012019.1:CDS
GCATGTGACATAGCAAGTGG+TGG	0.720133	3:+17261193	None:intergenic
TGTGCATGTGACATAGCAAG+TGG	0.748690	3:+17261190	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr3	gene	17259273	17261668	17259273	ID=MsaG012019
Chr3	mRNA	17259273	17261668	17259273	ID=MsaT012019.1;Parent=MsaG012019
Chr3	exon	17259273	17259680	17259273	ID=MsaT012019.1.exon2;Parent=MsaT012019.1
Chr3	CDS	17259273	17259680	17259273	ID=cds.MsaT012019.1;Parent=MsaT012019.1
Chr3	exon	17261087	17261668	17261087	ID=MsaT012019.1.exon1;Parent=MsaT012019.1
Chr3	CDS	17261087	17261668	17261087	ID=cds.MsaT012019.1;Parent=MsaT012019.1

Gene Sequence

>MsaT012019.1

ATGAATGAAAAAATAGAAAACAAAGATCAAATTCAACAAAACCCTCCAACATCACAACAAGAATCACCAAGAAAACAAAACAATATTATTATTGGTAGTGGAAGTGGAAATGAGAGACTAAAAAGAGATGAATGGAGTGAAGGAGCAGTTACAACACTTCTTGAAGCATATGAATCAAAATGGGTACTTAGAAATAGAGCAAAACTCAAAGGACAAGATTGGGAAGATGTTGCAAAACATGTTTCATCAAGATCAAATTCAACTAAGTCACCAAAGACACAAACACAGTGTAAGAATAAGATTGAGTCCATGAAGAAAAGGTATAGATCAGAATCAGCTAGTTCAGATGTTTCATCTTGGCCTTTGTATTCTAGACTTGATCTTCTTCTTCGTGGGACAGGACAATTATCTACAACAACACTAAACAATAATCAAGGTTTGGTTTTGTTGGAACCACCACTTGCTATGTCACATGCACAAGAAGAAGTTCATCAGCCACTAGCTCCTAGTACGGTTGTTCCTCCACCAATTACAACTGCTCAAAACTCACATGGATCAAATGGGGTTGATAAATTAGTCAAGGAAGATGAAATAGAAACTAAGTCATCTGACCATATCGCTAACAAGAATCCATTGGAAACCGATAGCAGCACGCCGGCGCTTTACAGCGAAAAAGACGAGCAAAGAAGCAAAAAGAGGAGAATGAGAGCAGAGAACAATAACAATAAGAGGCAAAAGAAAGAAACAATGGGAATAGCAGAAAGCATAAGGTGGCTAGCTGAGGTGGTAGTAAGGTCAGAACAAACAAGAATGGACACATTGAAAGAGATAGAGAAGATGAGAGTTGAAGCTGAGGCAAAGAGAGGAGAAATGGAAATCAAGAGAACTGAAATTATTGCTAATACACAACTTGAGATTGCTAGGATCTTTGCAAATGTTAATAATAAAGATAAAGATGTTGATTCATCATTGAGAATTGGAAGAAGCTAA

Protein sequence

>MsaT012019.1

MNEKIENKDQIQQNPPTSQQESPRKQNNIIIGSGSGNERLKRDEWSEGAVTTLLEAYESKWVLRNRAKLKGQDWEDVAKHVSSRSNSTKSPKTQTQCKNKIESMKKRYRSESASSDVSSWPLYSRLDLLLRGTGQLSTTTLNNNQGLVLLEPPLAMSHAQEEVHQPLAPSTVVPPPITTAQNSHGSNGVDKLVKEDEIETKSSDHIANKNPLETDSSTPALYSEKDEQRSKKRRMRAENNNNKRQKKETMGIAESIRWLAEVVVRSEQTRMDTLKEIEKMRVEAEAKRGEMEIKRTEIIANTQLEIARIFANVNNKDKDVDSSLRIGRS*