AlfalfaGEDB | MsaG012186

M. sativa ssp. caerulea / MsaG012186

KEGG: K17604
GO: -
PFAM: PF03101.18

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012186	AES61431.2	92.887	239	17	0	1	239	1	239	2.64e-165	468

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012186	G7I8T1	92.887	239	17	0	1	239	1	239	1.26e-165	468

TFs/TRs:

Gene ID	Type	Classification
MsaG012186	TF	FAR1

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG001001	MsaG012186	0.827767	2.330174e-54	6.330683e-52
MsaG003913	MsaG012186	0.805211	2.517849e-49	3.835962e-47
MsaG004012	MsaG012186	0.806028	1.699250e-49	2.638718e-47
MsaG004353	MsaG012186	0.805030	2.746279e-49	4.166565e-47
MsaG004442	MsaG012186	0.806929	1.099486e-49	1.744075e-47
MsaG004479	MsaG012186	0.800488	2.354452e-48	3.218605e-46
MsaG004793	MsaG012186	0.806070	1.665824e-49	2.589421e-47
MsaG004798	MsaG012186	0.815692	1.405988e-51	2.765980e-49
MsaG004929	MsaG012186	0.808929	4.146260e-50	6.900198e-48
MsaG005698	MsaG012186	0.826474	4.735090e-54	1.240829e-51
MsaG006133	MsaG012186	0.864325	2.627625e-64	2.416613e-61
MsaG007145	MsaG012186	0.807054	1.034755e-49	1.646252e-47
MsaG009007	MsaG012186	0.814877	2.129519e-51	4.103843e-49
MsaG009265	MsaG012186	0.819760	1.716414e-52	3.750794e-50
MsaG009703	MsaG012186	0.809746	2.775838e-50	4.711340e-48
MsaG012186	MsaG012187	0.824933	1.094007e-53	2.747038e-51
MsaG012186	MsaG012304	0.804261	3.967118e-49	5.912281e-47
MsaG012186	MsaG013374	0.828811	1.308896e-54	3.661620e-52
MsaG012186	MsaG015082	0.816164	1.104824e-51	2.199714e-49
MsaG012186	MsaG015176	0.800982	1.868476e-48	2.582902e-46
MsaG012186	MsaG015239	0.812681	6.451699e-51	1.176717e-48
MsaG012186	MsaG016293	0.824541	1.352039e-53	3.358741e-51
MsaG012186	MsaG017173	0.815689	1.408742e-51	2.771122e-49
MsaG012186	MsaG017543	0.802122	1.093926e-48	1.551785e-46
MsaG012186	MsaG017795	0.806677	1.242014e-49	1.958583e-47
MsaG012186	MsaG018111	0.832689	1.483056e-55	4.639018e-53
MsaG012186	MsaG018593	0.832960	1.270793e-55	4.006783e-53
MsaG012186	MsaG018741	0.807841	7.057199e-50	1.144104e-47
MsaG012186	MsaG019265	0.804144	4.193918e-49	6.233364e-47
MsaG012186	MsaG020487	0.801613	1.389676e-48	1.948697e-46
MsaG012186	MsaG020731	0.825116	9.909496e-54	2.500700e-51
MsaG012186	MsaG020870	0.849730	5.094795e-60	2.736007e-57
MsaG012186	MsaG020963	0.830277	5.781783e-55	1.686623e-52
MsaG012186	MsaG021238	0.819994	1.518545e-52	3.339323e-50
MsaG012186	MsaG021448	0.802538	8.987461e-49	1.287192e-46
MsaG012186	MsaG023607	0.828624	1.451414e-54	4.039264e-52
MsaG012186	MsaG024972	0.809314	3.433011e-50	5.765947e-48
MsaG012186	MsaG025428	0.859370	8.496804e-63	6.450227e-60
MsaG012186	MsaG025722	0.801896	1.216868e-48	1.717405e-46
MsaG012186	MsaG026841	0.804117	4.247909e-49	6.309694e-47
MsaG012186	MsaG026863	0.800227	2.659264e-48	3.613892e-46
MsaG012186	MsaG027005	0.834699	4.692007e-56	1.557578e-53
MsaG012186	MsaG027361	0.800873	1.967087e-48	2.712498e-46
MsaG012186	MsaG027933	0.848398	1.190496e-59	6.109386e-57
MsaG012186	MsaG028001	0.804239	4.009010e-49	5.971620e-47
MsaG012186	MsaG028498	0.814968	2.033579e-51	3.927961e-49
MsaG012186	MsaG028951	0.850478	3.153677e-60	1.737508e-57
MsaG012186	MsaG029481	0.800450	2.396962e-48	3.273930e-46
MsaG012186	MsaG029519	0.863007	6.713941e-64	5.861579e-61
MsaG012186	MsaG029763	0.800236	2.647834e-48	3.599092e-46
MsaG012186	MsaG030955	0.815351	1.673189e-51	3.263328e-49
MsaG012186	MsaG032068	0.813100	5.227706e-51	9.634998e-49
MsaG012186	MsaG033030	0.801152	1.725508e-48	2.394424e-46
MsaG012186	MsaG034079	0.833643	8.603846e-56	2.767863e-53
MsaG012186	MsaG039196	0.836695	1.472888e-56	5.191238e-54
MsaG012186	MsaG039924	0.808666	4.716896e-50	7.800471e-48
MsaG012186	MsaG041905	0.804699	3.218229e-49	4.844908e-47
MsaG012186	MsaG044218	0.824156	1.664454e-53	4.091460e-51
MsaG012186	MsaG044885	0.829107	1.110369e-54	3.132324e-52
MsaG012186	MsaG045072	0.802181	1.063815e-48	1.511152e-46
MsaG012186	MsaG045225	0.819070	2.461758e-52	5.283243e-50
MsaG012186	MsaG046313	0.804456	3.614175e-49	5.410471e-47
MsaG012186	MsaG046546	0.821046	8.728661e-53	1.973681e-50
MsaG012186	MsaG000630	0.811607	1.103786e-50	1.960450e-48
MsaG012186	MsaG003742	0.817716	4.971058e-52	1.029965e-49
MsaG012186	MsaG014180	0.812671	6.484845e-51	1.182452e-48
MsaG012186	MsaG019831	0.804434	3.651864e-49	5.464197e-47
MsaG012186	MsaG028462	0.810075	2.359368e-50	4.036516e-48
MsaG012186	MsaG030315	0.805029	2.746692e-49	4.167130e-47
MsaG012186	MsaG030924	0.812671	6.484845e-51	1.182452e-48
MsaG012186	MsaG034181	0.800827	2.009877e-48	2.768623e-46
MsaG012186	MsaG032695	0.806275	1.508686e-49	2.356676e-47
MsaG012186	MsaG031291	0.824120	1.696802e-53	4.167035e-51
MsaG012186	MsaG036873	0.840184	1.872616e-57	7.352393e-55
MsaG012186	MsaG035287	0.800848	1.989557e-48	2.741967e-46
MsaG012186	MsaG037156	0.843214	2.998761e-58	1.296449e-55
MsaG012186	MsaG036524	0.813556	4.155359e-51	7.746639e-49
MsaG012186	MsaG038711	0.823473	2.400886e-53	5.793523e-51
MsaG012186	MsaG036751	0.857086	4.034711e-62	2.812197e-59
MsaG012186	MsaG042234	0.812399	7.431957e-51	1.346049e-48
MsaG012186	MsaG043146	0.800232	2.652570e-48	3.605220e-46

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG012186	MtrunA17_Chr1g0172971	75.000	132	18	1	1	132	1	117	6.51e-62	202
MsaG012186	MtrunA17_Chr6g0475591	86.111	36	5	0	204	239	1	36	9.67e-17	72.8
MsaG012186	MtrunA17_Chr1g0202341	29.730	185	106	6	50	232	50	212	6.68e-14	70.9
MsaG012186	MtrunA17_Chr7g0258861	27.041	196	121	5	46	238	2	178	4.26e-12	64.7

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Find 37 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TCTGCTGTTGGCCTGTTGTT+TGG	0.302805	3:+20424534	None:intergenic
TTACTTCTCGAAATGATCTA+AGG	0.311482	3:+20424343	None:intergenic
GAGAACGTCTTATGAAGTTA+TGG	0.394356	3:-20424268	MsaT012186.1:CDS
CTAAGGTAACGCGAATGCTT+TGG	0.399481	3:+20424360	None:intergenic
CGTTATGTTTGTAACAAAGA+AGG	0.427485	3:-20424582	MsaT012186.1:CDS
GAAGTTATGGGTCAAGGAGT+TGG	0.428685	3:-20424255	MsaT012186.1:CDS
CGAGAAGTAAATGAAGTTCA+AGG	0.430014	3:-20424330	MsaT012186.1:CDS
TCCATGATTCTTTATTGCTA+GGG	0.444266	3:+20424745	None:intergenic
TTCCATGATTCTTTATTGCT+AGG	0.445442	3:+20424744	None:intergenic
GAAAGGGTTGGTTGTAAAGC+TGG	0.447509	3:-20424465	MsaT012186.1:CDS
ATTTACTTAATCCAAACAAC+AGG	0.452259	3:-20424545	MsaT012186.1:CDS
ATGTGTATAAGATATATAGA+TGG	0.452819	3:-20424413	MsaT012186.1:CDS
GCTCTTATAAATTCTAAAGC+TGG	0.462891	3:-20424300	MsaT012186.1:CDS
AGAACGTCTTATGAAGTTAT+GGG	0.466325	3:-20424267	MsaT012186.1:CDS
ACAAAACAAGAAATTTGATA+AGG	0.468895	3:-20424616	MsaT012186.1:CDS
TTTAAGTCTGAAAACCGAAA+AGG	0.483010	3:+20424216	None:intergenic
GAATGCTTTGGTTTATGTAA+TGG	0.496214	3:+20424372	None:intergenic
CCCCTAGCAATAAAGAATCA+TGG	0.497001	3:-20424746	MsaT012186.1:CDS
TTACAACCAACCCTTTCCTC+AGG	0.505082	3:+20424471	None:intergenic
AGCTGGAATATATTTGAAGC+TGG	0.507410	3:-20424448	MsaT012186.1:CDS
GGTAATTATGCATATAACAC+TGG	0.523547	3:-20424678	MsaT012186.1:CDS
TAACAAAGAAGGTTTCAAGA+AGG	0.525236	3:-20424571	MsaT012186.1:CDS
TAAGATATATAGATGGGATG+TGG	0.528498	3:-20424406	MsaT012186.1:CDS
CCATGATTCTTTATTGCTAG+GGG	0.537011	3:+20424746	None:intergenic
AACAAAGAAGGTTTCAAGAA+GGG	0.545537	3:-20424570	MsaT012186.1:CDS
GTTATGGGTCAAGGAGTTGG+AGG	0.578191	3:-20424252	MsaT012186.1:CDS
TCTTATGAAGTTATGGGTCA+AGG	0.580120	3:-20424261	MsaT012186.1:CDS
ATGACAATTCACAAAAGAGA+TGG	0.583940	3:-20424183	MsaT012186.1:CDS
TTCACAAAAGAGATGGTGGT+TGG	0.595505	3:-20424176	MsaT012186.1:CDS
TGTGTATAAGATATATAGAT+GGG	0.601002	3:-20424412	MsaT012186.1:CDS
ACCAGTGGACTGTCTGCTGT+TGG	0.602965	3:+20424522	None:intergenic
TCACTGATTCATGCTGAGAG+TGG	0.606950	3:-20424825	MsaT012186.1:CDS
GCCAACAGCAGACAGTCCAC+TGG	0.611268	3:-20424523	MsaT012186.1:CDS
ATATCAACTTCATCTGAGAG+TGG	0.614980	3:-20424870	MsaT012186.1:CDS
ACAATTCACAAAAGAGATGG+TGG	0.617339	3:-20424180	MsaT012186.1:CDS
TTCACAAACTCAATAACCAG+TGG	0.633415	3:+20424507	None:intergenic
GGGTCAAGGAGTTGGAGGCA+CGG	0.637387	3:-20424247	MsaT012186.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr3	gene	20424173	20424901	20424173	ID=MsaG012186
Chr3	mRNA	20424173	20424901	20424173	ID=MsaT012186.1;Parent=MsaG012186
Chr3	exon	20424173	20424901	20424173	ID=MsaT012186.1.exon1;Parent=MsaT012186.1
Chr3	CDS	20424173	20424901	20424173	ID=cds.MsaT012186.1;Parent=MsaT012186.1

Gene Sequence

>MsaT012186.1

ATGGATTTGATATCAACTTCATCTGAGAGTGGACAACTGAGTGTTGAAACTTCATCACTGATTCATGCTGAGAGTGGACAATTGAGTGTTGAAAGTTCTTCAATGATTCATGCTGACAGTTCTCAATGTTACTCCCCTAGCAATAAAGAATCATGGAAGTCTTTAGTCTTTCAATCTATTAAAGAGATTGAAGATTTTTATGGTAATTATGCATATAACACTGGATTTTCTATTAGGACTATGTTGAAGTCGAAGAATAATTCACAAAACAAGAAATTTGATAAGGTACATTATTTGCGTTATGTTTGTAACAAAGAAGGTTTCAAGAAGGGAAATTTACTTAATCCAAACAACAGGCCAACAGCAGACAGTCCACTGGTTATTGAGTTTGTGAAAGTGAAAGAAAAACCTGAGGAAAGGGTTGGTTGTAAAGCTGGAATATATTTGAAGCTGGATGAAGTTTTGAATGTGTATAAGATATATAGATGGGATGTGGATCACTGTCATCCATTACATAAACCAAAGCATTCGCGTTACCTTAGATCATTTCGAGAAGTAAATGAAGTTCAAGGACAACTAGCTCTTATAAATTCTAAAGCTGGAATGTCGATGAGAACGTCTTATGAAGTTATGGGTCAAGGAGTTGGAGGCACGGAGAATCTTCCTTTTCGGTTTTCAGACTTAAAGAACTATCTAATGACAATTCACAAAAGAGATGGTGGTTGGTGA

Protein sequence

>MsaT012186.1

MDLISTSSESGQLSVETSSLIHAESGQLSVESSSMIHADSSQCYSPSNKESWKSLVFQSIKEIEDFYGNYAYNTGFSIRTMLKSKNNSQNKKFDKVHYLRYVCNKEGFKKGNLLNPNNRPTADSPLVIEFVKVKEKPEERVGCKAGIYLKLDEVLNVYKIYRWDVDHCHPLHKPKHSRYLRSFREVNEVQGQLALINSKAGMSMRTSYEVMGQGVGGTENLPFRFSDLKNYLMTIHKRDGGW*