AlfalfaGEDB | MsaG014248

M. sativa ssp. caerulea / MsaG014248

KEGG: -
GO: -
PFAM: PF02362.24

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG014248	XP_003600453.1	80.952	126	24	0	29	154	159	284	1.28e-69	222

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG014248	sp\|Q8L3W1\|VRN1_ARATH	29.457	129	83	4	31	155	212	336	2.12e-11	63.9

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG014248	tr\|G8A2Z4\|G8A2Z4_MEDTR	80.952	126	24	0	29	154	159	284	6.09e-70	222

TFs/TRs:

Gene ID	Type	Classification
MsaG014248	TF	B3

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000744	MsaG014248	0.834512	5.223301e-56	1.724329e-53
MsaG001397	MsaG014248	0.862745	8.081311e-64	6.982790e-61
MsaG001934	MsaG014248	0.819904	1.591315e-52	3.490976e-50
MsaG002269	MsaG014248	0.861443	2.017873e-63	1.657503e-60
MsaG003706	MsaG014248	0.851968	1.201995e-60	6.975304e-58
MsaG005665	MsaG014248	0.816662	8.556137e-52	1.725304e-49
MsaG007867	MsaG014248	0.800754	2.078763e-48	2.858945e-46
MsaG009271	MsaG014248	0.813755	3.758588e-51	7.041984e-49
MsaG009273	MsaG014248	0.847058	2.772877e-59	1.360475e-56
MsaG009400	MsaG014248	0.816849	7.773900e-52	1.575154e-49
MsaG010484	MsaG014248	0.810503	1.909998e-50	3.301988e-48
MsaG011006	MsaG014248	0.804431	3.657473e-49	5.472220e-47
MsaG011194	MsaG014248	0.861747	1.631389e-63	1.355778e-60
MsaG011499	MsaG014248	0.825605	7.600736e-54	1.944053e-51
MsaG013264	MsaG014248	0.822243	4.630036e-53	1.080752e-50
MsaG014152	MsaG014248	0.803542	5.585132e-49	8.186157e-47
MsaG014248	MsaG015591	0.869289	7.018854e-66	7.894995e-63
MsaG014248	MsaG016555	0.803062	7.013611e-49	1.016636e-46
MsaG014248	MsaG018344	0.834631	4.878397e-56	1.616185e-53
MsaG014248	MsaG018345	0.842058	6.057189e-58	2.523646e-55
MsaG014248	MsaG019502	0.835205	3.501710e-56	1.180142e-53
MsaG014248	MsaG021342	0.843744	2.167847e-58	9.533426e-56
MsaG014248	MsaG021976	0.807864	6.981021e-50	1.132379e-47
MsaG014248	MsaG022726	0.803634	5.347981e-49	7.854916e-47
MsaG014248	MsaG023256	0.839634	2.600071e-57	1.003387e-54
MsaG014248	MsaG023948	0.818695	2.991730e-52	6.357705e-50
MsaG014248	MsaG028201	0.852706	7.427005e-61	4.422511e-58
MsaG014248	MsaG028395	0.832640	1.524962e-55	4.763291e-53
MsaG014248	MsaG028674	0.807781	7.268043e-50	1.176575e-47
MsaG014248	MsaG029804	0.807375	8.855741e-50	1.419692e-47
MsaG014248	MsaG029809	0.814453	2.641106e-51	5.035596e-49
MsaG014248	MsaG030761	0.824989	1.061353e-53	2.669094e-51
MsaG014248	MsaG031038	0.805379	2.322893e-49	3.552760e-47
MsaG014248	MsaG031065	0.844839	1.104636e-58	5.035257e-56
MsaG014248	MsaG031679	0.824434	1.432825e-53	3.549003e-51
MsaG014248	MsaG033913	0.845166	9.023272e-59	4.156988e-56
MsaG014248	MsaG033925	0.814123	3.121744e-51	5.902910e-49
MsaG014248	MsaG035450	0.831854	2.381055e-55	7.270055e-53
MsaG014248	MsaG036975	0.809112	3.791340e-50	6.337376e-48
MsaG014248	MsaG037010	0.811889	9.591875e-51	1.715498e-48
MsaG014248	MsaG037664	0.809906	2.565127e-50	4.370593e-48
MsaG014248	MsaG037666	0.813430	4.429043e-51	8.230738e-49
MsaG014248	MsaG038768	0.833449	9.612363e-56	3.074776e-53
MsaG014248	MsaG039958	0.852846	6.776040e-61	4.054778e-58
MsaG014248	MsaG040352	0.841054	1.110734e-57	4.482452e-55
MsaG014248	MsaG040400	0.859804	6.302229e-63	4.863534e-60
MsaG014248	MsaG040477	0.832486	1.663816e-55	5.174036e-53
MsaG014248	MsaG041699	0.807273	9.306287e-50	1.488273e-47
MsaG014248	MsaG042207	0.807325	9.072223e-50	1.452677e-47
MsaG014248	MsaG042341	0.829180	1.066227e-54	3.013950e-52
MsaG014248	MsaG045759	0.804188	4.107422e-49	6.111023e-47
MsaG014248	MsaG045866	0.821377	7.330827e-53	1.672130e-50
MsaG014248	MsaG046017	0.802389	9.646253e-49	1.376821e-46
MsaG014248	MsaG046424	0.843605	2.360586e-58	1.033467e-55
MsaG014248	MsaG046580	0.855684	1.036037e-61	6.860791e-59
MsaG014248	MsaG046781	0.853739	3.768605e-61	2.327574e-58
MsaG014248	MsaG046962	0.827576	2.589053e-54	6.996500e-52
MsaG014248	MsaG002388	0.822640	3.749179e-53	8.845460e-51
MsaG014248	MsaG002751	0.861108	2.550077e-63	2.068068e-60
MsaG014248	MsaG001948	0.806078	1.659295e-49	2.579757e-47
MsaG014248	MsaG012223	0.811375	1.239031e-50	2.188181e-48
MsaG014248	MsaG021948	0.810308	2.102695e-50	3.617941e-48
MsaG014248	MsaG027700	0.853350	4.868169e-61	2.965332e-58
MsaG014248	MsaG024919	0.860258	4.603061e-63	3.614819e-60
MsaG014248	MsaG043833	0.818764	2.886180e-52	6.144548e-50

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG014248	MtrunA17_Chr3g0103201	77.778	126	28	0	29	154	95	220	3.28e-68	206
MsaG014248	MtrunA17_Chr3g0103161	68.000	125	40	0	33	157	2	126	1.16e-59	181
MsaG014248	MtrunA17_Chr3g0103181	73.451	113	30	0	42	154	167	279	5.96e-55	174
MsaG014248	MtrunA17_Chr3g0103171	61.538	130	48	1	27	154	136	265	3.90e-51	164
MsaG014248	MtrunA17_Chr3g0103191	76.596	94	21	1	29	121	158	251	9.77e-44	144
MsaG014248	MtrunA17_Chr8g0390841	52.308	65	30	1	91	155	455	518	1.11e-15	73.2
MsaG014248	MtrunA17_Chr8g0390841	33.036	112	65	3	47	155	227	331	1.32e-12	64.3
MsaG014248	MtrunA17_Chr1g0208771	36.154	130	75	4	33	155	330	458	2.44e-15	72.0
MsaG014248	MtrunA17_Chr1g0208771	35.780	109	58	6	53	157	192	292	1.35e-12	64.3
MsaG014248	MtrunA17_Chr4g0033961	31.818	132	77	6	31	155	263	388	3.90e-11	60.1
MsaG014248	MtrunA17_Chr1g0162441	29.545	132	80	6	31	155	267	392	9.28e-11	58.9

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG014248	AT3G18990.1	29.457	129	83	4	31	155	212	336	2.16e-12	63.9
MsaG014248	AT3G18990.2	29.457	129	83	4	31	155	212	336	2.38e-12	63.9
MsaG014248	AT1G49480.3	27.132	129	86	4	31	155	97	221	1.55e-11	60.5
MsaG014248	AT1G49480.1	27.132	129	86	4	31	155	97	221	1.55e-11	60.5
MsaG014248	AT1G49480.2	27.132	129	86	4	31	155	97	221	1.55e-11	60.5

Find 26 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
AAAGAACTTCATCAATAAAT+TGG	0.285020	3:-69729129	MsaT014248.1:CDS
TGACCATCTTCTATATGATT+AGG	0.306797	3:+69729031	None:intergenic
TCAATAACCCCTTTAAAATC+TGG	0.344940	3:+69728906	None:intergenic
ACTGATAAACAAGAAAGATT+TGG	0.358474	3:-69728724	MsaT014248.1:CDS
CGTTGTTACGAAGGCAGATA+TGG	0.391650	3:-69728822	MsaT014248.1:CDS
AGTGAGAGTGGACTGGAATC+AGG	0.399530	3:-69728765	MsaT014248.1:CDS
AGAATGTGATGATGCAGATT+AGG	0.440524	3:-69728872	MsaT014248.1:CDS
TACATTGCACACATATATGC+AGG	0.482109	3:-69729172	MsaT014248.1:CDS
GCCAAGGGATTCTAGAGCTC+AGG	0.489379	3:-69729107	MsaT014248.1:CDS
AAACCTAATCATATAGAAGA+TGG	0.505339	3:-69729034	MsaT014248.1:CDS
GTCGTCGCCTTTCCGTGGGT+TGG	0.516583	3:-69728800	MsaT014248.1:CDS
TGATGATGCAGATTAGGAAA+AGG	0.518118	3:-69728866	MsaT014248.1:CDS
CTTCATCAATAAATTGGCCA+AGG	0.530612	3:-69729123	MsaT014248.1:CDS
TCATATAGAAGATGGTCAGC+TGG	0.539319	3:-69729026	MsaT014248.1:intron
TCCTGAGCTCTAGAATCCCT+TGG	0.542805	3:+69729106	None:intergenic
TAAAGGGGTTATTGAGAACA+AGG	0.546960	3:-69728898	MsaT014248.1:CDS
TATGGTCGTCGCCTTTCCGT+GGG	0.562523	3:-69728804	MsaT014248.1:CDS
ATATGGTCGTCGCCTTTCCG+TGG	0.567959	3:-69728805	MsaT014248.1:CDS
TCATTGTTTGCAAGTGAGAG+TGG	0.589705	3:-69728777	MsaT014248.1:CDS
TTCATCAATAAATTGGCCAA+GGG	0.591832	3:-69729122	MsaT014248.1:CDS
ACAATGACCAACCCACGGAA+AGG	0.604310	3:+69728793	None:intergenic
AAATTACTCCGTTGTTACGA+AGG	0.605850	3:-69728831	MsaT014248.1:CDS
GTTTGCAAGTGAGAGTGGAC+TGG	0.609003	3:-69728772	MsaT014248.1:CDS
TGCAGATTAGGAAAAGGTCA+TGG	0.613419	3:-69728860	MsaT014248.1:CDS
TGCAAACAATGACCAACCCA+CGG	0.632224	3:+69728788	None:intergenic
CATATCTGCCTTCGTAACAA+CGG	0.666214	3:+69728823	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr3	gene	69728689	69729257	69728689	ID=MsaG014248
Chr3	mRNA	69728689	69729257	69728689	ID=MsaT014248.1;Parent=MsaG014248
Chr3	exon	69728689	69728934	69728689	ID=MsaT014248.1.exon2;Parent=MsaT014248.1
Chr3	CDS	69728689	69728934	69728689	ID=cds.MsaT014248.1;Parent=MsaT014248.1
Chr3	exon	69729027	69729257	69729027	ID=MsaT014248.1.exon1;Parent=MsaT014248.1
Chr3	CDS	69729027	69729257	69729027	ID=cds.MsaT014248.1;Parent=MsaT014248.1

Gene Sequence

>MsaT014248.1

ATGGTTGCTCAATATTCTCAATATTCTCAATATAAGTACTTTACAAGAGTTTCTTCTTTGTTTTACATTGCACACATATATGCAGGTGATCATGAGAAGACTACTAAAAGAACTTCATCAATAAATTGGCCAAGGGATTCTAGAGCTCAGGAAGTAGCTCAAAATTTCATCTCAAGCAATCCTTTTTTCACAATTCTCATAAAACCTAATCATATAGAAGATGGTCAGCTGTCTGTACCAGATTTTAAAGGGGTTATTGAGAACAAGGACAAGAATGTGATGATGCAGATTAGGAAAAGGTCATGGAATGTGAAATTACTCCGTTGTTACGAAGGCAGATATGGTCGTCGCCTTTCCGTGGGTTGGTCATTGTTTGCAAGTGAGAGTGGACTGGAATCAGGAGATGTTTGTGTCTTTGAACTGATAAACAAGAAAGATTTGGTTTTTAAAGTTCATATTTTCAAAAGTGACGGTTAA

Protein sequence

>MsaT014248.1

MVAQYSQYSQYKYFTRVSSLFYIAHIYAGDHEKTTKRTSSINWPRDSRAQEVAQNFISSNPFFTILIKPNHIEDGQLSVPDFKGVIENKDKNVMMQIRKRSWNVKLLRCYEGRYGRRLSVGWSLFASESGLESGDVCVFELINKKDLVFKVHIFKSDG*