AlfalfaGEDB | MsaG016159

M. sativa ssp. caerulea / MsaG016159

KEGG: -
GO: GO:0000902 GO:0001101 GO:0003674 GO:0003824 GO:0004672 GO:0004674 GO:0005975 GO:0006464 GO:0006468 GO:0006793 GO:0006796 GO:0006807 GO:0006884 GO:0007154 GO:0007165 GO:0007166 GO:0008150 GO:0008152 GO:0008361 GO:0009311 GO:0009653 GO:0009719 GO:0009725 GO:0009751 GO:0009826 GO:0009987 GO:0009992 GO:0010033 GO:0014070 GO:0016043 GO:0016049 GO:0016301 GO:0016310 GO:0016740 GO:0016772 GO:0016773 GO:0019538 GO:0019725 GO:0023052 GO:0030104 GO:0032502 GO:0032535 GO:0032989 GO:0036211 GO:0040007 GO:0042221 GO:0042493 GO:0042592 GO:0043170 GO:0043412 GO:0044237 GO:0044238 GO:0044260 GO:0044267 GO:0046677 GO:0048589 GO:0048856 GO:0048869 GO:0048878 GO:0050789 GO:0050794 GO:0050896 GO:0051716 GO:0055082 GO:0060560 GO:0065007 GO:0065008 GO:0071704 GO:0071840 GO:0090066 GO:0140096 GO:1901564 GO:1901700
PFAM: PF13947.9

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG016159	XP_039688021.1	70.228	702	196	7	23	720	723	1415	0.0	976
MsaG016159	XP_039688021.1	86.731	731	85	5	1	729	1	721	0.0	1267

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG016159	sp\|Q9LMN8\|WAK3_ARATH	44.669	741	353	18	3	716	1	711	0.0	593

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG016159	A0A072V217	82.490	771	84	5	1	729	1	762	0.0	1254

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000009	MsaG016159	0.826181	5.555538e-54	1.443953e-51
MsaG000023	MsaG016159	0.834552	5.106353e-56	1.687658e-53
MsaG000032	MsaG016159	0.816284	1.039020e-51	2.075019e-49
MsaG000048	MsaG016159	0.842490	4.662175e-58	1.969561e-55
MsaG000069	MsaG016159	0.859000	1.096092e-62	8.204365e-60
MsaG000137	MsaG016159	0.847888	1.643673e-59	8.293163e-57
MsaG000138	MsaG016159	0.852194	1.037720e-60	6.069175e-58
MsaG000219	MsaG016159	0.810769	1.673702e-50	2.912350e-48
MsaG000197	MsaG016159	0.800582	2.252836e-48	3.086338e-46
MsaG000202	MsaG016159	0.830904	4.068287e-55	1.208253e-52
MsaG000167	MsaG016159	0.817246	6.337161e-52	1.297296e-49
MsaG000253	MsaG016159	0.883581	8.509718e-71	1.820074e-67
MsaG000286	MsaG016159	0.834666	4.780477e-56	1.585460e-53
MsaG000260	MsaG016159	0.840084	1.987695e-57	7.779943e-55
MsaG000315	MsaG016159	0.852626	7.826755e-61	4.647295e-58
MsaG000367	MsaG016159	0.805751	1.942045e-49	2.996201e-47
MsaG000566	MsaG016159	0.817732	4.930956e-52	1.022095e-49
MsaG000537	MsaG016159	0.832698	1.474808e-55	4.614661e-53
MsaG000545	MsaG016159	0.832525	1.627611e-55	5.067084e-53
MsaG000621	MsaG016159	0.859209	9.489715e-63	7.160306e-60
MsaG000681	MsaG016159	0.894871	3.684069e-75	1.408878e-71
MsaG000705	MsaG016159	0.906606	2.945694e-80	2.238875e-76
MsaG000715	MsaG016159	0.803351	6.115122e-49	8.923409e-47
MsaG000778	MsaG016159	0.822827	3.392127e-53	8.043857e-51
MsaG000761	MsaG016159	0.872596	5.778659e-67	7.481069e-64
MsaG000867	MsaG016159	0.815924	1.249292e-51	2.472184e-49
MsaG000910	MsaG016159	0.895425	2.183608e-75	8.605629e-72
MsaG000957	MsaG016159	0.835535	2.892352e-56	9.845160e-54
MsaG001036	MsaG016159	0.809103	3.808546e-50	6.364746e-48
MsaG001045	MsaG016159	0.917606	1.090584e-85	1.730599e-81
MsaG000994	MsaG016159	0.813698	3.868734e-51	7.237786e-49
MsaG001092	MsaG016159	0.808121	6.157304e-50	1.004950e-47
MsaG001098	MsaG016159	0.801851	1.243059e-48	1.752545e-46
MsaG001120	MsaG016159	0.818508	3.297160e-52	6.972924e-50
MsaG001121	MsaG016159	0.840764	1.322492e-57	5.287838e-55
MsaG001128	MsaG016159	0.830586	4.862049e-55	1.430817e-52
MsaG001147	MsaG016159	0.834110	6.581394e-56	2.146552e-53
MsaG001234	MsaG016159	0.841623	7.881262e-58	3.238281e-55
MsaG001294	MsaG016159	0.835437	3.062769e-56	1.039428e-53
MsaG001259	MsaG016159	0.800756	2.076818e-48	2.856420e-46
MsaG001270	MsaG016159	0.890553	1.956185e-73	5.935322e-70
MsaG001277	MsaG016159	0.865260	1.343747e-64	1.282880e-61
MsaG001374	MsaG016159	0.843003	3.409340e-58	1.464153e-55
MsaG001409	MsaG016159	0.832712	1.463066e-55	4.579916e-53
MsaG001490	MsaG016159	0.807109	1.007564e-49	1.605079e-47
MsaG001618	MsaG016159	0.802190	1.059157e-48	1.504841e-46
MsaG001619	MsaG016159	0.804228	4.029352e-49	6.000501e-47
MsaG001700	MsaG016159	0.810783	1.662183e-50	2.893303e-48
MsaG001767	MsaG016159	0.838635	4.706490e-57	1.760582e-54
MsaG001897	MsaG016159	0.854007	3.157423e-61	1.968965e-58
MsaG002213	MsaG016159	0.820073	1.456322e-52	3.209311e-50
MsaG002298	MsaG016159	0.909447	1.359726e-81	1.239976e-77
MsaG002532	MsaG016159	0.800599	2.235634e-48	3.063912e-46
MsaG002597	MsaG016159	0.833281	1.058271e-55	3.368408e-53
MsaG002605	MsaG016159	0.814844	2.166178e-51	4.170925e-49
MsaG002636	MsaG016159	0.874703	1.134851e-67	1.610863e-64
MsaG002738	MsaG016159	0.807978	6.603989e-50	1.074141e-47
MsaG002804	MsaG016159	0.837474	9.333985e-57	3.368743e-54
MsaG002785	MsaG016159	0.839366	3.050417e-57	1.167302e-54
MsaG002810	MsaG016159	0.853907	3.374289e-61	2.096483e-58
MsaG003184	MsaG016159	0.817133	6.716633e-52	1.370987e-49
MsaG003206	MsaG016159	0.849675	5.280481e-60	2.830545e-57
MsaG003263	MsaG016159	0.813543	4.183494e-51	7.796385e-49
MsaG003267	MsaG016159	0.817351	6.002306e-52	1.232050e-49
MsaG003273	MsaG016159	0.819544	1.922018e-52	4.176328e-50
MsaG003274	MsaG016159	0.839050	3.680923e-57	1.394932e-54
MsaG003293	MsaG016159	0.825239	9.269535e-54	2.347111e-51
MsaG003300	MsaG016159	0.848424	1.170883e-59	6.013975e-57
MsaG003309	MsaG016159	0.817950	4.403560e-52	9.179594e-50
MsaG003355	MsaG016159	0.807073	1.025518e-49	1.632293e-47
MsaG003711	MsaG016159	0.847225	2.495798e-59	1.231498e-56
MsaG003806	MsaG016159	0.863384	5.141660e-64	4.555754e-61
MsaG004007	MsaG016159	0.829996	6.768070e-55	1.958516e-52
MsaG003903	MsaG016159	0.817346	6.016675e-52	1.234849e-49
MsaG004010	MsaG016159	0.875918	4.383520e-68	6.566939e-65
MsaG004028	MsaG016159	0.836541	1.611980e-56	5.655093e-54
MsaG004086	MsaG016159	0.876607	2.543256e-68	3.929493e-65
MsaG004091	MsaG016159	0.896377	8.840623e-76	3.675063e-72
MsaG004099	MsaG016159	0.871521	1.311007e-66	1.620602e-63
MsaG004155	MsaG016159	0.840768	1.319550e-57	5.276731e-55
MsaG004191	MsaG016159	0.811515	1.155396e-50	2.047498e-48
MsaG004326	MsaG016159	0.817289	6.195518e-52	1.269739e-49
MsaG004329	MsaG016159	0.815783	1.342677e-51	2.647397e-49
MsaG004348	MsaG016159	0.820219	1.349019e-52	2.984429e-50
MsaG004433	MsaG016159	0.802721	8.244681e-49	1.185701e-46
MsaG004394	MsaG016159	0.847602	1.968847e-59	9.837718e-57
MsaG004445	MsaG016159	0.863180	5.941444e-64	5.222091e-61
MsaG004478	MsaG016159	0.803389	6.007664e-49	8.774218e-47
MsaG004455	MsaG016159	0.859251	9.222298e-63	6.969651e-60
MsaG004495	MsaG016159	0.856701	5.231625e-62	3.595737e-59
MsaG004712	MsaG016159	0.882755	1.702917e-70	3.499953e-67
MsaG004962	MsaG016159	0.809889	2.586008e-50	4.404412e-48
MsaG005038	MsaG016159	0.893647	1.155954e-74	4.137019e-71
MsaG005083	MsaG016159	0.817417	5.799689e-52	1.192529e-49
MsaG005054	MsaG016159	0.845850	5.900633e-59	2.780618e-56
MsaG005102	MsaG016159	0.817809	4.737421e-52	9.839642e-50
MsaG005118	MsaG016159	0.818011	4.266680e-52	8.908420e-50
MsaG005139	MsaG016159	0.843023	3.368133e-58	1.447350e-55
MsaG005157	MsaG016159	0.855239	1.394158e-61	9.084888e-59
MsaG005203	MsaG016159	0.818935	2.640755e-52	5.647464e-50
MsaG005213	MsaG016159	0.810695	1.736419e-50	3.015937e-48
MsaG005226	MsaG016159	0.893479	1.350786e-74	4.791203e-71
MsaG005232	MsaG016159	0.808581	4.917733e-50	8.115639e-48
MsaG005278	MsaG016159	0.807756	7.357888e-50	1.190388e-47
MsaG005338	MsaG016159	0.836209	1.956336e-56	6.794986e-54
MsaG005345	MsaG016159	0.863263	5.602516e-64	4.940469e-61
MsaG005349	MsaG016159	0.820895	9.452084e-53	2.128680e-50
MsaG005352	MsaG016159	0.843712	2.211087e-58	9.713730e-56
MsaG005414	MsaG016159	0.833595	8.844828e-56	2.841367e-53
MsaG005424	MsaG016159	0.855526	1.151432e-61	7.582078e-59
MsaG005545	MsaG016159	0.882734	1.732709e-70	3.557427e-67
MsaG005475	MsaG016159	0.818078	4.120737e-52	8.618292e-50
MsaG005487	MsaG016159	0.855020	1.613001e-61	1.042785e-58
MsaG005530	MsaG016159	0.825963	6.255972e-54	1.616286e-51
MsaG005613	MsaG016159	0.830390	5.426566e-55	1.588176e-52
MsaG005633	MsaG016159	0.815978	1.215054e-51	2.407744e-49
MsaG005831	MsaG016159	0.811866	9.700392e-51	1.733922e-48
MsaG005768	MsaG016159	0.803874	4.770120e-49	7.045308e-47
MsaG005769	MsaG016159	0.800375	2.481819e-48	3.384102e-46
MsaG005773	MsaG016159	0.812919	5.725747e-51	1.050535e-48
MsaG005814	MsaG016159	0.867578	2.488121e-65	2.608739e-62
MsaG005906	MsaG016159	0.833259	1.071228e-55	3.407615e-53
MsaG005940	MsaG016159	0.863913	3.528761e-64	3.192193e-61
MsaG006129	MsaG016159	0.887543	2.830650e-72	7.356628e-69
MsaG006191	MsaG016159	0.828932	1.223846e-54	3.435254e-52
MsaG006195	MsaG016159	0.813851	3.581670e-51	6.726737e-49
MsaG006277	MsaG016159	0.826840	3.875811e-54	1.026006e-51
MsaG006280	MsaG016159	0.809732	2.794792e-50	4.741926e-48
MsaG006281	MsaG016159	0.855759	9.851710e-62	6.541103e-59
MsaG006284	MsaG016159	0.871724	1.124424e-66	1.402027e-63
MsaG006332	MsaG016159	0.847552	2.031931e-59	1.013640e-56
MsaG006355	MsaG016159	0.851604	1.522876e-60	8.723210e-58
MsaG006366	MsaG016159	0.804252	3.983607e-49	5.935649e-47
MsaG006426	MsaG016159	0.844163	1.675734e-58	7.470309e-56
MsaG006476	MsaG016159	0.883069	1.308705e-70	2.730652e-67
MsaG006504	MsaG016159	0.843327	2.797626e-58	1.213988e-55
MsaG006545	MsaG016159	0.815920	1.251509e-51	2.476347e-49
MsaG006713	MsaG016159	0.826297	5.217366e-54	1.360389e-51
MsaG006762	MsaG016159	0.825438	8.324289e-54	2.119336e-51
MsaG006803	MsaG016159	0.829136	1.092952e-54	3.085651e-52
MsaG007021	MsaG016159	0.817813	4.727042e-52	9.819243e-50
MsaG007042	MsaG016159	0.820827	9.799043e-53	2.202755e-50
MsaG007063	MsaG016159	0.825882	6.539746e-54	1.685744e-51
MsaG007064	MsaG016159	0.813282	4.771197e-51	8.833484e-49
MsaG007074	MsaG016159	0.814779	2.238670e-51	4.303536e-49
MsaG007077	MsaG016159	0.805698	1.992110e-49	3.069657e-47
MsaG007078	MsaG016159	0.809810	2.688916e-50	4.570993e-48
MsaG007079	MsaG016159	0.813827	3.624723e-51	6.803603e-49
MsaG007105	MsaG016159	0.801965	1.177845e-48	1.664923e-46
MsaG007146	MsaG016159	0.835725	2.591850e-56	8.871933e-54
MsaG007169	MsaG016159	0.819176	2.328355e-52	5.011106e-50
MsaG007212	MsaG016159	0.845944	5.564591e-59	2.630461e-56
MsaG007269	MsaG016159	0.821925	5.483584e-53	1.269115e-50
MsaG007363	MsaG016159	0.846578	3.744707e-59	1.807943e-56
MsaG007448	MsaG016159	0.839528	2.770434e-57	1.065553e-54
MsaG007496	MsaG016159	0.821794	5.877272e-53	1.355449e-50
MsaG007516	MsaG016159	0.849854	4.706309e-60	2.537925e-57
MsaG007576	MsaG016159	0.801344	1.577039e-48	2.197983e-46
MsaG007577	MsaG016159	0.803817	4.901469e-49	7.229788e-47
MsaG007607	MsaG016159	0.804659	3.279196e-49	4.932207e-47
MsaG007677	MsaG016159	0.801381	1.549996e-48	2.162094e-46
MsaG007653	MsaG016159	0.813560	4.147099e-51	7.732071e-49
MsaG007970	MsaG016159	0.800314	2.553296e-48	3.476766e-46
MsaG008062	MsaG016159	0.819541	1.924591e-52	4.181642e-50
MsaG008118	MsaG016159	0.849277	6.807543e-60	3.599673e-57
MsaG008125	MsaG016159	0.910073	6.811694e-82	6.459004e-78
MsaG008152	MsaG016159	0.825707	7.191855e-54	1.844832e-51
MsaG008167	MsaG016159	0.833730	8.183298e-56	2.639414e-53
MsaG008330	MsaG016159	0.804598	3.376517e-49	5.071386e-47
MsaG008444	MsaG016159	0.816517	9.217609e-52	1.851813e-49
MsaG008403	MsaG016159	0.807530	8.212476e-50	1.321464e-47
MsaG008409	MsaG016159	0.849738	5.069937e-60	2.723419e-57
MsaG008424	MsaG016159	0.831564	2.805533e-55	8.493402e-53
MsaG008435	MsaG016159	0.820022	1.496453e-52	3.293193e-50
MsaG008589	MsaG016159	0.854762	1.914865e-61	1.226591e-58
MsaG008591	MsaG016159	0.830575	4.893755e-55	1.439678e-52
MsaG008616	MsaG016159	0.827178	3.221016e-54	8.607300e-52
MsaG008744	MsaG016159	0.809149	3.723120e-50	6.228815e-48
MsaG008814	MsaG016159	0.857213	3.703352e-62	2.593279e-59
MsaG008831	MsaG016159	0.877729	1.040685e-68	1.691689e-65
MsaG008848	MsaG016159	0.894825	3.846596e-75	1.467566e-71
MsaG008874	MsaG016159	0.850828	2.516502e-60	1.403424e-57
MsaG008861	MsaG016159	0.877473	1.277401e-68	2.052313e-65
MsaG008919	MsaG016159	0.860098	5.143954e-63	4.014452e-60
MsaG008994	MsaG016159	0.853912	3.363236e-61	2.089974e-58
MsaG009165	MsaG016159	0.808958	4.089462e-50	6.810322e-48
MsaG009327	MsaG016159	0.846931	3.002492e-59	1.466832e-56
MsaG009423	MsaG016159	0.883887	6.568726e-71	1.425744e-67
MsaG009424	MsaG016159	0.819202	2.297021e-52	4.947032e-50
MsaG009518	MsaG016159	0.808908	4.189960e-50	6.969379e-48
MsaG009674	MsaG016159	0.881677	4.178236e-70	8.158079e-67
MsaG009680	MsaG016159	0.845207	8.797429e-59	4.058409e-56
MsaG009871	MsaG016159	0.880613	1.005521e-69	1.867728e-66
MsaG009874	MsaG016159	0.858221	1.867058e-62	1.357434e-59
MsaG009900	MsaG016159	0.879512	2.471350e-69	4.361403e-66
MsaG010009	MsaG016159	0.813291	4.749736e-51	8.795637e-49
MsaG010028	MsaG016159	0.821835	5.749476e-53	1.327471e-50
MsaG010074	MsaG016159	0.833530	9.175955e-56	2.942160e-53
MsaG010113	MsaG016159	0.878191	7.182528e-69	1.192669e-65
MsaG010303	MsaG016159	0.878652	4.958870e-69	8.409584e-66
MsaG010305	MsaG016159	0.862722	8.214441e-64	7.091135e-61
MsaG010307	MsaG016159	0.907171	1.610855e-80	1.269465e-76
MsaG010363	MsaG016159	0.877850	9.445469e-69	1.543919e-65
MsaG010491	MsaG016159	0.843093	3.228009e-58	1.390222e-55
MsaG010567	MsaG016159	0.823256	2.697580e-53	6.471473e-51
MsaG010635	MsaG016159	0.863026	6.625859e-64	5.788809e-61
MsaG010603	MsaG016159	0.837182	1.108070e-56	3.963372e-54
MsaG010604	MsaG016159	0.875688	5.252736e-68	7.787840e-65
MsaG010710	MsaG016159	0.840800	1.294329e-57	5.181201e-55
MsaG010767	MsaG016159	0.850763	2.624657e-60	1.460379e-57
MsaG010761	MsaG016159	0.830032	6.630355e-55	1.920711e-52
MsaG010715	MsaG016159	0.802593	8.758726e-49	1.255996e-46
MsaG010788	MsaG016159	0.801904	1.212079e-48	1.710973e-46
MsaG010792	MsaG016159	0.878981	3.799616e-69	6.543505e-66
MsaG010799	MsaG016159	0.837725	8.054836e-57	2.929220e-54
MsaG010807	MsaG016159	0.805574	2.115244e-49	3.249777e-47
MsaG010864	MsaG016159	0.805751	1.941756e-49	2.995794e-47
MsaG011002	MsaG016159	0.800764	2.069371e-48	2.846678e-46
MsaG011025	MsaG016159	0.810419	1.991024e-50	3.435114e-48
MsaG011095	MsaG016159	0.838800	4.270120e-57	1.605566e-54
MsaG011147	MsaG016159	0.852648	7.716294e-61	4.585356e-58
MsaG011213	MsaG016159	0.853286	5.078958e-61	3.086774e-58
MsaG011218	MsaG016159	0.805166	2.572079e-49	3.914641e-47
MsaG011315	MsaG016159	0.842381	4.981517e-58	2.097057e-55
MsaG011525	MsaG016159	0.821097	8.497848e-53	1.924051e-50
MsaG011539	MsaG016159	0.806176	1.582340e-49	2.465879e-47
MsaG011454	MsaG016159	0.809946	2.514455e-50	4.288415e-48
MsaG011469	MsaG016159	0.852149	1.068606e-60	6.240137e-58
MsaG011478	MsaG016159	0.818025	4.235448e-52	8.846285e-50
MsaG011565	MsaG016159	0.828804	1.313841e-54	3.674731e-52
MsaG011559	MsaG016159	0.811763	1.021000e-50	1.820377e-48
MsaG011573	MsaG016159	0.803148	6.736025e-49	9.783134e-47
MsaG011575	MsaG016159	0.824439	1.428558e-53	3.538981e-51
MsaG011589	MsaG016159	0.825123	9.872507e-54	2.491862e-51
MsaG011678	MsaG016159	0.864918	1.717564e-64	1.617385e-61
MsaG011690	MsaG016159	0.823548	2.306538e-53	5.577248e-51
MsaG011796	MsaG016159	0.832039	2.144647e-55	6.583570e-53
MsaG012001	MsaG016159	0.862288	1.115149e-63	9.464472e-61
MsaG011993	MsaG016159	0.811164	1.376332e-50	2.418124e-48
MsaG012013	MsaG016159	0.818920	2.661609e-52	5.689669e-50
MsaG012026	MsaG016159	0.854735	1.949626e-61	1.247652e-58
MsaG012048	MsaG016159	0.831431	3.024001e-55	9.119166e-53
MsaG012078	MsaG016159	0.832886	1.325407e-55	4.170018e-53
MsaG012127	MsaG016159	0.816516	9.223665e-52	1.852964e-49
MsaG012162	MsaG016159	0.846324	4.391337e-59	2.102369e-56
MsaG012229	MsaG016159	0.834623	4.899463e-56	1.622806e-53
MsaG012334	MsaG016159	0.906832	2.314687e-80	1.783930e-76
MsaG012360	MsaG016159	0.819035	2.506589e-52	5.374642e-50
MsaG012363	MsaG016159	0.808558	4.974899e-50	8.205298e-48
MsaG012396	MsaG016159	0.886671	6.052409e-72	1.505721e-68
MsaG012487	MsaG016159	0.841015	1.137472e-57	4.584376e-55
MsaG012488	MsaG016159	0.827197	3.187846e-54	8.523272e-52
MsaG012565	MsaG016159	0.844161	1.678242e-58	7.480905e-56
MsaG012592	MsaG016159	0.879706	2.110714e-69	3.757969e-66
MsaG012620	MsaG016159	0.826809	3.942906e-54	1.042846e-51
MsaG012675	MsaG016159	0.851108	2.100537e-60	1.182792e-57
MsaG012649	MsaG016159	0.805446	2.248918e-49	3.445002e-47
MsaG013221	MsaG016159	0.801252	1.646897e-48	2.290472e-46
MsaG013222	MsaG016159	0.809985	2.467037e-50	4.211467e-48
MsaG013627	MsaG016159	0.809624	2.947572e-50	4.988145e-48
MsaG013829	MsaG016159	0.830777	4.367752e-55	1.292481e-52
MsaG013968	MsaG016159	0.844520	1.344734e-58	6.065014e-56
MsaG013971	MsaG016159	0.825260	9.169354e-54	2.323042e-51
MsaG014159	MsaG016159	0.802409	9.552465e-49	1.364069e-46
MsaG014135	MsaG016159	0.857991	2.182993e-62	1.573632e-59
MsaG014207	MsaG016159	0.867209	3.261752e-65	3.368827e-62
MsaG014239	MsaG016159	0.803815	4.905971e-49	7.236124e-47
MsaG014242	MsaG016159	0.814553	2.510896e-51	4.799264e-49
MsaG014305	MsaG016159	0.838108	6.426773e-57	2.364943e-54
MsaG014471	MsaG016159	0.858539	1.503070e-62	1.105939e-59
MsaG014554	MsaG016159	0.872661	5.499652e-67	7.139704e-64
MsaG014556	MsaG016159	0.844328	1.513732e-58	6.784536e-56
MsaG014651	MsaG016159	0.839460	2.884435e-57	1.107140e-54
MsaG014655	MsaG016159	0.814122	3.123687e-51	5.906395e-49
MsaG014844	MsaG016159	0.811935	9.374531e-51	1.678552e-48
MsaG014907	MsaG016159	0.801892	1.219045e-48	1.720355e-46
MsaG014937	MsaG016159	0.812668	6.496583e-51	1.184485e-48
MsaG014940	MsaG016159	0.841226	1.001440e-57	4.063369e-55
MsaG014961	MsaG016159	0.855594	1.100368e-61	7.263621e-59
MsaG015012	MsaG016159	0.816340	1.009487e-51	2.018929e-49
MsaG015144	MsaG016159	0.887098	4.175981e-72	1.060763e-68
MsaG015237	MsaG016159	0.867058	3.640578e-65	3.737420e-62
MsaG015238	MsaG016159	0.817110	6.795505e-52	1.386269e-49
MsaG015255	MsaG016159	0.816864	7.712125e-52	1.563256e-49
MsaG015319	MsaG016159	0.871702	1.143166e-66	1.424031e-63
MsaG015322	MsaG016159	0.840318	1.728166e-57	6.814164e-55
MsaG015512	MsaG016159	0.836891	1.313617e-56	4.657312e-54
MsaG015468	MsaG016159	0.824004	1.806354e-53	4.422132e-51
MsaG015469	MsaG016159	0.801281	1.624182e-48	2.260424e-46
MsaG015854	MsaG016159	0.881368	5.399781e-70	1.038710e-66
MsaG015874	MsaG016159	0.835696	2.635521e-56	9.013486e-54
MsaG015918	MsaG016159	0.852714	7.390731e-61	4.402199e-58
MsaG015960	MsaG016159	0.826425	4.864541e-54	1.272989e-51
MsaG015966	MsaG016159	0.846186	4.784548e-59	2.280154e-56
MsaG016056	MsaG016159	0.914621	3.834509e-84	4.933335e-80
MsaG016116	MsaG016159	0.830265	5.822162e-55	1.697771e-52
MsaG016118	MsaG016159	0.921461	8.967066e-88	1.881298e-83
MsaG016154	MsaG016159	0.857920	2.291522e-62	1.647520e-59
MsaG016159	MsaG016179	0.859421	8.207047e-63	6.242074e-60
MsaG016159	MsaG016228	0.814161	3.062367e-51	5.796102e-49
MsaG016159	MsaG016297	0.828892	1.250918e-54	3.507540e-52
MsaG016159	MsaG016306	0.822390	4.283089e-53	1.003732e-50
MsaG016159	MsaG016384	0.838969	3.861318e-57	1.459597e-54
MsaG016159	MsaG016385	0.827370	2.898550e-54	7.787672e-52
MsaG016159	MsaG016448	0.829270	1.014462e-54	2.874948e-52
MsaG016159	MsaG016459	0.812657	6.530241e-51	1.190318e-48
MsaG016159	MsaG016483	0.846768	3.325525e-59	1.615931e-56
MsaG016159	MsaG016503	0.826380	4.984089e-54	1.302630e-51
MsaG016159	MsaG016531	0.866296	6.348730e-65	6.317498e-62
MsaG016159	MsaG016565	0.815338	1.684599e-51	3.284483e-49
MsaG016159	MsaG016911	0.861470	1.980467e-63	1.628477e-60
MsaG016159	MsaG017022	0.843700	2.226971e-58	9.779947e-56
MsaG016159	MsaG017061	0.866948	3.947364e-65	4.034659e-62
MsaG016159	MsaG017084	0.846123	4.977368e-59	2.367026e-56
MsaG016159	MsaG017106	0.868451	1.307059e-65	1.420439e-62
MsaG016159	MsaG017131	0.837419	9.639515e-57	3.473157e-54
MsaG016159	MsaG017148	0.883970	6.128162e-71	1.335472e-67
MsaG016159	MsaG017179	0.820215	1.351921e-52	2.990511e-50
MsaG016159	MsaG017182	0.871789	1.069481e-66	1.337295e-63
MsaG016159	MsaG017243	0.803354	6.107976e-49	8.913563e-47
MsaG016159	MsaG017272	0.855269	1.367064e-61	8.918015e-59
MsaG016159	MsaG017288	0.869355	6.681283e-66	7.535955e-63
MsaG016159	MsaG017358	0.840543	1.509800e-57	5.995381e-55
MsaG016159	MsaG017407	0.808387	5.408546e-50	8.883744e-48
MsaG016159	MsaG017461	0.818726	2.943510e-52	6.260321e-50
MsaG016159	MsaG017559	0.865220	1.382184e-64	1.317513e-61
MsaG016159	MsaG017561	0.875977	4.184288e-68	6.285285e-65
MsaG016159	MsaG017567	0.838204	6.074512e-57	2.241990e-54
MsaG016159	MsaG017568	0.857871	2.369141e-62	1.700240e-59
MsaG016159	MsaG017608	0.838246	5.923727e-57	2.189115e-54
MsaG016159	MsaG017634	0.801821	1.260715e-48	1.776249e-46
MsaG016159	MsaG017725	0.845899	5.721704e-59	2.700832e-56
MsaG016159	MsaG017825	0.804089	4.304664e-49	6.390075e-47
MsaG016159	MsaG017783	0.832628	1.535423e-55	4.794299e-53
MsaG016159	MsaG017919	0.833736	8.157077e-56	2.631357e-53
MsaG016159	MsaG017887	0.816274	1.044361e-51	2.085163e-49
MsaG016159	MsaG017906	0.861552	1.869749e-63	1.542204e-60
MsaG016159	MsaG017973	0.824911	1.107566e-53	2.779374e-51
MsaG016159	MsaG017992	0.852988	6.174055e-61	3.713520e-58
MsaG016159	MsaG018114	0.821061	8.659535e-53	1.958838e-50
MsaG016159	MsaG018148	0.879143	3.334628e-69	5.785577e-66
MsaG016159	MsaG018150	0.816812	7.921629e-52	1.603575e-49
MsaG016159	MsaG018266	0.831847	2.390334e-55	7.296903e-53
MsaG016159	MsaG018268	0.824932	1.095134e-53	2.749755e-51
MsaG016159	MsaG018385	0.842587	4.393127e-58	1.861653e-55
MsaG016159	MsaG018424	0.820912	9.368127e-53	2.110762e-50
MsaG016159	MsaG018437	0.830566	4.918790e-55	1.446684e-52
MsaG016159	MsaG018440	0.862688	8.415278e-64	7.254355e-61
MsaG016159	MsaG018494	0.818768	2.880603e-52	6.133317e-50
MsaG016159	MsaG018501	0.815516	1.538301e-51	3.012755e-49
MsaG016159	MsaG018680	0.811500	1.164514e-50	2.062903e-48
MsaG016159	MsaG018705	0.827185	3.208273e-54	8.575017e-52
MsaG016159	MsaG018682	0.811431	1.204827e-50	2.130706e-48
MsaG016159	MsaG018807	0.836679	1.487208e-56	5.238955e-54
MsaG016159	MsaG018785	0.878464	5.770249e-69	9.699919e-66
MsaG016159	MsaG018837	0.837233	1.074907e-56	3.850738e-54
MsaG016159	MsaG018889	0.823435	2.451256e-53	5.908908e-51
MsaG016159	MsaG018958	0.838615	4.763876e-57	1.780915e-54
MsaG016159	MsaG019016	0.801091	1.775677e-48	2.460639e-46
MsaG016159	MsaG019134	0.837973	6.959207e-57	2.550265e-54
MsaG016159	MsaG019184	0.808381	5.423791e-50	8.907519e-48
MsaG016159	MsaG019243	0.825179	9.577159e-54	2.421048e-51
MsaG016159	MsaG019298	0.857601	2.846794e-62	2.022385e-59
MsaG016159	MsaG019435	0.863374	5.175671e-64	4.584295e-61
MsaG016159	MsaG019532	0.804204	4.076427e-49	6.067142e-47
MsaG016159	MsaG019507	0.823471	2.403592e-53	5.799788e-51
MsaG016159	MsaG019557	0.816743	8.209193e-52	1.658857e-49
MsaG016159	MsaG019606	0.824365	1.486845e-53	3.676030e-51
MsaG016159	MsaG019648	0.817705	4.997983e-52	1.035262e-49
MsaG016159	MsaG019932	0.804873	2.960946e-49	4.475787e-47
MsaG016159	MsaG019986	0.867636	2.383712e-65	2.505208e-62
MsaG016159	MsaG020385	0.821127	8.366257e-53	1.895719e-50
MsaG016159	MsaG020470	0.808007	6.508711e-50	1.059406e-47
MsaG016159	MsaG020499	0.866624	4.998013e-65	5.041296e-62
MsaG016159	MsaG020533	0.845953	5.535185e-59	2.617338e-56
MsaG016159	MsaG020577	0.801401	1.535632e-48	2.143002e-46
MsaG016159	MsaG020576	0.836748	1.427991e-56	5.040964e-54
MsaG016159	MsaG020607	0.800731	2.101822e-48	2.889141e-46
MsaG016159	MsaG020730	0.871220	1.647308e-66	2.010191e-63
MsaG016159	MsaG020738	0.868018	1.800484e-65	1.922020e-62
MsaG016159	MsaG020697	0.838787	4.302440e-57	1.617076e-54
MsaG016159	MsaG020840	0.820196	1.365855e-52	3.019787e-50
MsaG016159	MsaG020860	0.852320	9.560250e-61	5.616360e-58
MsaG016159	MsaG020863	0.866643	4.931606e-65	4.977872e-62
MsaG016159	MsaG021042	0.844463	1.393093e-58	6.271344e-56
MsaG016159	MsaG021054	0.812280	7.887374e-51	1.424263e-48
MsaG016159	MsaG021057	0.817890	4.543332e-52	9.456014e-50
MsaG016159	MsaG021090	0.858741	1.308845e-62	9.702658e-60
MsaG016159	MsaG021129	0.858128	1.989512e-62	1.441363e-59
MsaG016159	MsaG021131	0.842219	5.493427e-58	2.300378e-55
MsaG016159	MsaG021137	0.827349	2.932351e-54	7.873675e-52
MsaG016159	MsaG021163	0.807961	6.657303e-50	1.082367e-47
MsaG016159	MsaG021164	0.860213	4.748544e-63	3.722593e-60
MsaG016159	MsaG021165	0.847513	2.082166e-59	1.037354e-56
MsaG016159	MsaG021168	0.826080	5.869647e-54	1.521380e-51
MsaG016159	MsaG021160	0.820678	1.059874e-52	2.373113e-50
MsaG016159	MsaG021264	0.873788	2.309257e-67	3.149082e-64
MsaG016159	MsaG021320	0.811622	1.095565e-50	1.946549e-48
MsaG016159	MsaG021324	0.862835	7.584341e-64	6.576572e-61
MsaG016159	MsaG021339	0.818296	3.681029e-52	7.741908e-50
MsaG016159	MsaG021343	0.870837	2.199484e-66	2.640773e-63
MsaG016159	MsaG021344	0.802180	1.064119e-48	1.511555e-46
MsaG016159	MsaG021422	0.810139	2.286928e-50	3.918558e-48
MsaG016159	MsaG021433	0.804242	4.002562e-49	5.962496e-47
MsaG016159	MsaG021438	0.819327	2.151956e-52	4.649892e-50
MsaG016159	MsaG021592	0.871949	9.470505e-67	1.192504e-63
MsaG016159	MsaG021649	0.845262	8.503440e-59	3.929843e-56
MsaG016159	MsaG021927	0.824713	1.232485e-53	3.076027e-51
MsaG016159	MsaG021888	0.891759	6.561251e-74	2.120520e-70
MsaG016159	MsaG021996	0.815431	1.606505e-51	3.139598e-49
MsaG016159	MsaG022080	0.802914	7.524474e-49	1.086941e-46
MsaG016159	MsaG022226	0.840408	1.637367e-57	6.474383e-55
MsaG016159	MsaG022303	0.868546	1.218615e-65	1.329477e-62
MsaG016159	MsaG022305	0.850108	4.000520e-60	2.175886e-57
MsaG016159	MsaG022363	0.802397	9.607999e-49	1.371632e-46
MsaG016159	MsaG022550	0.803030	7.122187e-49	1.031595e-46
MsaG016159	MsaG022553	0.836043	2.153604e-56	7.442749e-54
MsaG016159	MsaG022579	0.863362	5.219314e-64	4.620763e-61
MsaG016159	MsaG022642	0.814084	3.184431e-51	6.015516e-49
MsaG016159	MsaG022767	0.852060	1.132475e-60	6.592745e-58
MsaG016159	MsaG022880	0.906369	3.790060e-80	2.838878e-76
MsaG016159	MsaG023041	0.801805	1.269873e-48	1.788518e-46
MsaG016159	MsaG022998	0.838058	6.618055e-57	2.431662e-54
MsaG016159	MsaG023078	0.897640	2.627376e-76	1.173444e-72
MsaG016159	MsaG023214	0.822836	3.376495e-53	8.008547e-51
MsaG016159	MsaG023302	0.867397	2.841400e-65	2.956979e-62
MsaG016159	MsaG023272	0.812157	8.390396e-51	1.510444e-48
MsaG016159	MsaG023514	0.820990	8.993410e-53	2.030526e-50
MsaG016159	MsaG023913	0.874959	9.294982e-68	1.334414e-64
MsaG016159	MsaG023953	0.806887	1.122347e-49	1.778562e-47
MsaG016159	MsaG023970	0.848815	9.138715e-60	4.756559e-57
MsaG016159	MsaG023979	0.829710	7.936355e-55	2.277871e-52
MsaG016159	MsaG023997	0.923194	9.548659e-89	2.281343e-84
MsaG016159	MsaG024046	0.879256	3.042130e-69	5.305976e-66
MsaG016159	MsaG024098	0.877278	1.491979e-68	2.375899e-65
MsaG016159	MsaG024126	0.864817	1.847920e-64	1.733155e-61
MsaG016159	MsaG024258	0.804044	4.398928e-49	6.523121e-47
MsaG016159	MsaG024311	0.846454	4.047107e-59	1.945842e-56
MsaG016159	MsaG024459	0.861509	1.926830e-63	1.586686e-60
MsaG016159	MsaG024461	0.826666	4.264958e-54	1.123548e-51
MsaG016159	MsaG024728	0.835848	2.412121e-56	8.287540e-54
MsaG016159	MsaG024877	0.889963	3.323802e-73	9.775580e-70
MsaG016159	MsaG024883	0.802738	8.179405e-49	1.176768e-46
MsaG016159	MsaG025076	0.810347	2.062928e-50	3.552932e-48
MsaG016159	MsaG025231	0.843790	2.107208e-58	9.280212e-56
MsaG016159	MsaG025259	0.803133	6.781636e-49	9.846282e-47
MsaG016159	MsaG025332	0.845283	8.391414e-59	3.880792e-56
MsaG016159	MsaG025337	0.828235	1.799770e-54	4.954239e-52
MsaG016159	MsaG025448	0.869543	5.809011e-66	6.603929e-63
MsaG016159	MsaG025643	0.839793	2.364766e-57	9.171875e-55
MsaG016159	MsaG025784	0.818109	4.056850e-52	8.491479e-50
MsaG016159	MsaG025838	0.916792	2.916440e-85	4.363645e-81
MsaG016159	MsaG025897	0.815990	1.207852e-51	2.394149e-49
MsaG016159	MsaG025903	0.844696	1.206651e-58	5.474074e-56
MsaG016159	MsaG025985	0.907718	8.941294e-81	7.299068e-77
MsaG016159	MsaG026152	0.879245	3.067859e-69	5.348202e-66
MsaG016159	MsaG026446	0.887187	3.863242e-72	9.859922e-69
MsaG016159	MsaG026553	0.828532	1.527719e-54	4.240731e-52
MsaG016159	MsaG026675	0.872643	5.574157e-67	7.230841e-64
MsaG016159	MsaG026764	0.820096	1.439497e-52	3.174102e-50
MsaG016159	MsaG026798	0.823616	2.223798e-53	5.387419e-51
MsaG016159	MsaG026818	0.814845	2.165212e-51	4.169176e-49
MsaG016159	MsaG026826	0.877068	1.764026e-68	2.782750e-65
MsaG016159	MsaG026901	0.808566	4.954826e-50	8.173826e-48
MsaG016159	MsaG026960	0.820286	1.302656e-52	2.886893e-50
MsaG016159	MsaG027095	0.834791	4.447854e-56	1.480613e-53
MsaG016159	MsaG027084	0.858412	1.638936e-62	1.200161e-59
MsaG016159	MsaG027124	0.802947	7.406825e-49	1.070783e-46
MsaG016159	MsaG027129	0.831642	2.684666e-55	8.146327e-53
MsaG016159	MsaG027142	0.822461	4.122604e-53	9.679664e-51
MsaG016159	MsaG027155	0.804828	3.024866e-49	4.567674e-47
MsaG016159	MsaG027229	0.802087	1.111864e-48	1.576024e-46
MsaG016159	MsaG027275	0.858951	1.133240e-62	8.467232e-60
MsaG016159	MsaG027411	0.853818	3.576931e-61	2.215467e-58
MsaG016159	MsaG027432	0.871274	1.581637e-66	1.934549e-63
MsaG016159	MsaG027500	0.832946	1.280581e-55	4.036083e-53
MsaG016159	MsaG027543	0.854567	2.180394e-61	1.387026e-58
MsaG016159	MsaG027547	0.841244	9.907976e-58	4.022412e-55
MsaG016159	MsaG027805	0.806960	1.082875e-49	1.719013e-47
MsaG016159	MsaG027821	0.801051	1.808988e-48	2.504534e-46
MsaG016159	MsaG027759	0.846192	4.767565e-59	2.272468e-56
MsaG016159	MsaG027911	0.852724	7.341747e-61	4.374503e-58
MsaG016159	MsaG027891	0.807256	9.381982e-50	1.499776e-47
MsaG016159	MsaG027935	0.837593	8.703637e-57	3.152517e-54
MsaG016159	MsaG027972	0.802773	8.043448e-49	1.158147e-46
MsaG016159	MsaG027994	0.886877	5.060621e-72	1.271620e-68
MsaG016159	MsaG027995	0.895194	2.715762e-75	1.056728e-71
MsaG016159	MsaG028035	0.859508	7.729761e-63	5.898392e-60
MsaG016159	MsaG028039	0.823495	2.373752e-53	5.731406e-51
MsaG016159	MsaG028025	0.837767	7.856875e-57	2.861033e-54
MsaG016159	MsaG028158	0.817373	5.934649e-52	1.218860e-49
MsaG016159	MsaG028181	0.862924	7.118757e-64	6.194599e-61
MsaG016159	MsaG028188	0.849102	7.608984e-60	3.999864e-57
MsaG016159	MsaG028221	0.834215	6.198737e-56	2.028104e-53
MsaG016159	MsaG028232	0.835210	3.491827e-56	1.176982e-53
MsaG016159	MsaG028445	0.810226	2.190154e-50	3.760792e-48
MsaG016159	MsaG028511	0.827570	2.596387e-54	7.015277e-52
MsaG016159	MsaG028483	0.851961	1.208030e-60	7.008426e-58
MsaG016159	MsaG028493	0.828642	1.437328e-54	4.002018e-52
MsaG016159	MsaG028522	0.827849	2.227511e-54	6.065738e-52
MsaG016159	MsaG028575	0.837058	1.191225e-56	4.244873e-54
MsaG016159	MsaG028585	0.908756	2.899819e-81	2.527925e-77
MsaG016159	MsaG028605	0.861064	2.629513e-63	2.128923e-60
MsaG016159	MsaG028627	0.844151	1.687726e-58	7.520904e-56
MsaG016159	MsaG028632	0.859492	7.812861e-63	5.958233e-60
MsaG016159	MsaG028704	0.828427	1.619160e-54	4.481321e-52
MsaG016159	MsaG028762	0.872753	5.123410e-67	6.677257e-64
MsaG016159	MsaG028874	0.807592	7.969048e-50	1.284158e-47
MsaG016159	MsaG028875	0.802881	7.643640e-49	1.103324e-46
MsaG016159	MsaG028943	0.833922	7.332494e-56	2.378252e-53
MsaG016159	MsaG028906	0.846714	3.440223e-59	1.668580e-56
MsaG016159	MsaG028928	0.826944	3.661918e-54	9.722030e-52
MsaG016159	MsaG028986	0.817936	4.436794e-52	9.245352e-50
MsaG016159	MsaG029029	0.924700	1.306375e-89	3.500610e-85
MsaG016159	MsaG029064	0.856665	5.361612e-62	3.680279e-59
MsaG016159	MsaG029076	0.871484	1.349091e-66	1.664943e-63
MsaG016159	MsaG029106	0.873976	1.996494e-67	2.745638e-64
MsaG016159	MsaG029162	0.826005	6.116960e-54	1.582133e-51
MsaG016159	MsaG029172	0.868364	1.393913e-65	1.509419e-62
MsaG016159	MsaG029174	0.812807	6.056800e-51	1.108167e-48
MsaG016159	MsaG029225	0.843694	2.234984e-58	9.813536e-56
MsaG016159	MsaG029295	0.819869	1.621266e-52	3.553277e-50
MsaG016159	MsaG029377	0.899109	6.284649e-77	3.051307e-73
MsaG016159	MsaG029358	0.813940	3.424317e-51	6.445625e-49
MsaG016159	MsaG029401	0.819204	2.295130e-52	4.943149e-50
MsaG016159	MsaG029403	0.846047	5.220094e-59	2.476139e-56
MsaG016159	MsaG029502	0.846742	3.380381e-59	1.641157e-56
MsaG016159	MsaG029477	0.806466	1.375815e-49	2.158882e-47
MsaG016159	MsaG029539	0.813725	3.815806e-51	7.143768e-49
MsaG016159	MsaG029554	0.814176	3.039294e-51	5.754599e-49
MsaG016159	MsaG029562	0.804241	4.004280e-49	5.964915e-47
MsaG016159	MsaG029578	0.801344	1.576881e-48	2.197771e-46
MsaG016159	MsaG029621	0.850103	4.011583e-60	2.181548e-57
MsaG016159	MsaG029630	0.856272	6.984632e-62	4.725996e-59
MsaG016159	MsaG029635	0.883513	9.012239e-71	1.921063e-67
MsaG016159	MsaG029820	0.818143	3.984120e-52	8.346667e-50
MsaG016159	MsaG029810	0.809720	2.812001e-50	4.769664e-48
MsaG016159	MsaG029944	0.834532	5.162997e-56	1.705426e-53
MsaG016159	MsaG029925	0.833541	9.117669e-56	2.924400e-53
MsaG016159	MsaG029986	0.803431	5.887384e-49	8.606948e-47
MsaG016159	MsaG029973	0.805905	1.803619e-49	2.792698e-47
MsaG016159	MsaG030059	0.813463	4.356205e-51	8.101965e-49
MsaG016159	MsaG030036	0.826953	3.644500e-54	9.678247e-52
MsaG016159	MsaG030197	0.850887	2.422472e-60	1.353740e-57
MsaG016159	MsaG030215	0.818727	2.942403e-52	6.258114e-50
MsaG016159	MsaG030216	0.829977	6.839607e-55	1.978159e-52
MsaG016159	MsaG030238	0.892216	4.322852e-74	1.432249e-70
MsaG016159	MsaG030240	0.889729	4.098208e-73	1.191007e-69
MsaG016159	MsaG030353	0.885183	2.182605e-71	5.045012e-68
MsaG016159	MsaG030434	0.817731	4.933200e-52	1.022537e-49
MsaG016159	MsaG030451	0.885233	2.090323e-71	4.843873e-68
MsaG016159	MsaG030455	0.941055	2.393232e-100	2.457683e-95
MsaG016159	MsaG030494	0.888793	9.419583e-73	2.607442e-69
MsaG016159	MsaG030619	0.806689	1.235024e-49	1.948137e-47
MsaG016159	MsaG030698	0.894494	5.243511e-75	1.965354e-71
MsaG016159	MsaG030665	0.876704	2.354851e-68	3.654154e-65
MsaG016159	MsaG030779	0.840584	1.473333e-57	5.858075e-55
MsaG016159	MsaG030818	0.806192	1.570263e-49	2.448021e-47
MsaG016159	MsaG030888	0.816772	8.087400e-52	1.635455e-49
MsaG016159	MsaG030901	0.806415	1.409927e-49	2.209731e-47
MsaG016159	MsaG030914	0.818471	3.360947e-52	7.100929e-50
MsaG016159	MsaG031104	0.811599	1.108064e-50	1.967695e-48
MsaG016159	MsaG031216	0.852747	7.233191e-61	4.313192e-58
MsaG016159	MsaG031475	0.805334	2.373190e-49	3.625905e-47
MsaG016159	MsaG031527	0.857997	2.174911e-62	1.568157e-59
MsaG016159	MsaG031627	0.807733	7.440885e-50	1.203166e-47
MsaG016159	MsaG031647	0.800882	1.958614e-48	2.701376e-46
MsaG016159	MsaG031706	0.844859	1.091330e-58	4.977880e-56
MsaG016159	MsaG032095	0.846646	3.589470e-59	1.736889e-56
MsaG016159	MsaG032102	0.880608	1.009009e-69	1.873884e-66
MsaG016159	MsaG032036	0.848512	1.107569e-59	5.705620e-57
MsaG016159	MsaG032038	0.855584	1.107229e-61	7.306504e-59
MsaG016159	MsaG032274	0.823003	3.087357e-53	7.356091e-51
MsaG016159	MsaG032227	0.837784	7.777507e-57	2.833639e-54
MsaG016159	MsaG032401	0.810570	1.847254e-50	3.198746e-48
MsaG016159	MsaG032437	0.819031	2.511610e-52	5.384853e-50
MsaG016159	MsaG032564	0.884810	3.001653e-71	6.810161e-68
MsaG016159	MsaG032554	0.841766	7.231294e-58	2.984680e-55
MsaG016159	MsaG032560	0.812755	6.218361e-51	1.136252e-48
MsaG016159	MsaG032594	0.841718	7.444822e-58	3.068042e-55
MsaG016159	MsaG032713	0.812651	6.552261e-51	1.194126e-48
MsaG016159	MsaG032927	0.856971	4.361317e-62	3.026792e-59
MsaG016159	MsaG033154	0.831037	3.773781e-55	1.125092e-52
MsaG016159	MsaG033236	0.821042	8.745982e-53	1.977439e-50
MsaG016159	MsaG033289	0.835573	2.830173e-56	9.643935e-54
MsaG016159	MsaG033412	0.839079	3.618819e-57	1.372583e-54
MsaG016159	MsaG033421	0.901244	7.539750e-78	4.150006e-74
MsaG016159	MsaG033487	0.829399	9.438411e-55	2.684841e-52
MsaG016159	MsaG033570	0.865781	9.218534e-65	8.985381e-62
MsaG016159	MsaG033589	0.837386	9.830723e-57	3.538285e-54
MsaG016159	MsaG033588	0.856041	8.153066e-62	5.469960e-59
MsaG016159	MsaG033762	0.811666	1.071925e-50	1.906611e-48
MsaG016159	MsaG033763	0.851764	1.373164e-60	7.910492e-58
MsaG016159	MsaG033794	0.812311	7.767225e-51	1.403653e-48
MsaG016159	MsaG033931	0.802964	7.349267e-49	1.062859e-46
MsaG016159	MsaG033872	0.811171	1.371081e-50	2.409345e-48
MsaG016159	MsaG033892	0.802857	7.729460e-49	1.115085e-46
MsaG016159	MsaG033924	0.858246	1.834776e-62	1.335292e-59
MsaG016159	MsaG034018	0.862290	1.114106e-63	9.456102e-61
MsaG016159	MsaG034019	0.815840	1.303741e-51	2.574444e-49
MsaG016159	MsaG034031	0.826070	5.903372e-54	1.529670e-51
MsaG016159	MsaG034119	0.811194	1.355476e-50	2.383244e-48
MsaG016159	MsaG034303	0.836481	1.669375e-56	5.845989e-54
MsaG016159	MsaG034365	0.836898	1.307855e-56	4.637963e-54
MsaG016159	MsaG034370	0.873391	3.138862e-67	4.206423e-64
MsaG016159	MsaG034446	0.856812	4.854154e-62	3.349680e-59
MsaG016159	MsaG034510	0.841298	9.591846e-58	3.900716e-55
MsaG016159	MsaG034554	0.833481	9.436804e-56	3.021468e-53
MsaG016159	MsaG034620	0.859389	8.387285e-63	6.371803e-60
MsaG016159	MsaG034621	0.830733	4.478637e-55	1.323540e-52
MsaG016159	MsaG034689	0.866489	5.514355e-65	5.530454e-62
MsaG016159	MsaG034866	0.810512	1.901469e-50	3.287968e-48
MsaG016159	MsaG035166	0.892742	2.668119e-74	9.093651e-71
MsaG016159	MsaG035130	0.809750	2.770709e-50	4.703076e-48
MsaG016159	MsaG035206	0.832457	1.691551e-55	5.255802e-53
MsaG016159	MsaG035215	0.837076	1.178436e-56	4.201645e-54
MsaG016159	MsaG035216	0.900075	2.421851e-77	1.244658e-73
MsaG016159	MsaG035263	0.871018	1.918488e-66	2.321284e-63
MsaG016159	MsaG035271	0.882021	3.140894e-70	6.232092e-67
MsaG016159	MsaG035467	0.828837	1.290145e-54	3.611760e-52
MsaG016159	MsaG035553	0.867778	2.147775e-65	2.270379e-62
MsaG016159	MsaG035637	0.851091	2.122824e-60	1.194629e-57
MsaG016159	MsaG035655	0.822992	3.106754e-53	7.399786e-51
MsaG016159	MsaG035715	0.824777	1.190613e-53	2.976781e-51
MsaG016159	MsaG036001	0.812472	7.164359e-51	1.299958e-48
MsaG016159	MsaG036049	0.851019	2.224284e-60	1.248592e-57
MsaG016159	MsaG036081	0.817572	5.355151e-52	1.105474e-49
MsaG016159	MsaG036159	0.831310	3.235952e-55	9.723660e-53
MsaG016159	MsaG036283	0.811035	1.467080e-50	2.569458e-48
MsaG016159	MsaG036300	0.818326	3.624619e-52	7.629206e-50
MsaG016159	MsaG036385	0.809200	3.630397e-50	6.080925e-48
MsaG016159	MsaG036482	0.865243	1.359387e-64	1.296998e-61
MsaG016159	MsaG036489	0.889643	4.424029e-73	1.279985e-69
MsaG016159	MsaG036594	0.881058	6.968692e-70	1.321351e-66
MsaG016159	MsaG036616	0.833186	1.117290e-55	3.546515e-53
MsaG016159	MsaG036828	0.803611	5.405301e-49	7.934926e-47
MsaG016159	MsaG037309	0.848529	1.095330e-59	5.645947e-57
MsaG016159	MsaG037421	0.896058	1.198576e-75	4.892853e-72
MsaG016159	MsaG037569	0.833010	1.235277e-55	3.900395e-53
MsaG016159	MsaG037735	0.804586	3.396670e-49	5.100191e-47
MsaG016159	MsaG037919	0.820147	1.401372e-52	3.094215e-50
MsaG016159	MsaG037924	0.829832	7.415624e-55	2.135834e-52
MsaG016159	MsaG037967	0.814707	2.321882e-51	4.455280e-49
MsaG016159	MsaG037969	0.857065	4.092780e-62	2.850411e-59
MsaG016159	MsaG038012	0.815711	1.392853e-51	2.741411e-49
MsaG016159	MsaG038325	0.867624	2.405976e-65	2.527416e-62
MsaG016159	MsaG038327	0.865926	8.303699e-65	8.140662e-62
MsaG016159	MsaG038555	0.820867	9.593216e-53	2.158803e-50
MsaG016159	MsaG038519	0.845132	9.213965e-59	4.240288e-56
MsaG016159	MsaG038520	0.918614	3.179959e-86	5.424291e-82
MsaG016159	MsaG038522	0.930115	7.149693e-93	2.937858e-88
MsaG016159	MsaG038752	0.818009	4.272340e-52	8.919722e-50
MsaG016159	MsaG038993	0.821653	6.334423e-53	1.455492e-50
MsaG016159	MsaG038999	0.825335	8.802801e-54	2.234862e-51
MsaG016159	MsaG039139	0.833750	8.091008e-56	2.611131e-53
MsaG016159	MsaG039175	0.803024	7.143281e-49	1.034505e-46
MsaG016159	MsaG039466	0.806738	1.206007e-49	1.904543e-47
MsaG016159	MsaG039607	0.813147	5.106488e-51	9.422531e-49
MsaG016159	MsaG039633	0.825165	9.650280e-54	2.438583e-51
MsaG016159	MsaG039683	0.856174	7.461428e-62	5.030278e-59
MsaG016159	MsaG039899	0.811440	1.199419e-50	2.121612e-48
MsaG016159	MsaG039975	0.870118	3.779520e-66	4.401789e-63
MsaG016159	MsaG039976	0.832818	1.377890e-55	4.326313e-53
MsaG016159	MsaG039979	0.830603	4.817833e-55	1.418474e-52
MsaG016159	MsaG040209	0.816749	8.181324e-52	1.653503e-49
MsaG016159	MsaG040311	0.859715	6.700964e-63	5.153923e-60
MsaG016159	MsaG040487	0.829167	1.074183e-54	3.035335e-52
MsaG016159	MsaG040450	0.880704	9.332278e-70	1.740875e-66
MsaG016159	MsaG040452	0.845471	7.468809e-59	3.475728e-56
MsaG016159	MsaG040453	0.849916	4.523772e-60	2.444705e-57
MsaG016159	MsaG040460	0.820755	1.017772e-52	2.283531e-50
MsaG016159	MsaG040511	0.900790	1.187757e-77	6.368675e-74
MsaG016159	MsaG040540	0.819631	1.836506e-52	3.999580e-50
MsaG016159	MsaG040640	0.802365	9.753790e-49	1.391417e-46
MsaG016159	MsaG040685	0.854151	2.872315e-61	1.800280e-58
MsaG016159	MsaG040731	0.815825	1.313758e-51	2.593234e-49
MsaG016159	MsaG040748	0.838674	4.600727e-57	1.723067e-54
MsaG016159	MsaG040750	0.807697	7.571234e-50	1.223185e-47
MsaG016159	MsaG040816	0.810848	1.609625e-50	2.806205e-48
MsaG016159	MsaG040833	0.801458	1.495080e-48	2.089126e-46
MsaG016159	MsaG040914	0.808950	4.104021e-50	6.833377e-48
MsaG016159	MsaG041086	0.852689	7.513334e-61	4.471091e-58
MsaG016159	MsaG041157	0.854873	1.779598e-61	1.144421e-58
MsaG016159	MsaG041293	0.882995	1.392402e-70	2.895225e-67
MsaG016159	MsaG041497	0.810128	2.298684e-50	3.937688e-48
MsaG016159	MsaG041565	0.814005	3.313629e-51	6.247260e-49
MsaG016159	MsaG041735	0.865461	1.161854e-64	1.118026e-61
MsaG016159	MsaG041746	0.864980	1.643730e-64	1.551744e-61
MsaG016159	MsaG041771	0.833193	1.112373e-55	3.531667e-53
MsaG016159	MsaG041778	0.818435	3.424147e-52	7.227736e-50
MsaG016159	MsaG041784	0.807059	1.032421e-49	1.642733e-47
MsaG016159	MsaG041812	0.817568	5.366138e-52	1.107625e-49
MsaG016159	MsaG041814	0.825898	6.481543e-54	1.671524e-51
MsaG016159	MsaG041854	0.855203	1.428433e-61	9.295507e-59
MsaG016159	MsaG041841	0.830573	4.899994e-55	1.441438e-52
MsaG016159	MsaG041898	0.822088	5.028978e-53	1.168967e-50
MsaG016159	MsaG041924	0.818326	3.624308e-52	7.628580e-50
MsaG016159	MsaG041935	0.815940	1.238836e-51	2.452534e-49
MsaG016159	MsaG041937	0.801668	1.354805e-48	1.902138e-46
MsaG016159	MsaG042023	0.819248	2.243420e-52	4.837292e-50
MsaG016159	MsaG042016	0.830694	4.578000e-55	1.351377e-52
MsaG016159	MsaG042053	0.852564	8.153133e-61	4.830319e-58
MsaG016159	MsaG042057	0.901164	8.173620e-78	4.477738e-74
MsaG016159	MsaG042149	0.820573	1.120040e-52	2.500986e-50
MsaG016159	MsaG042353	0.828106	1.932791e-54	5.301285e-52
MsaG016159	MsaG042354	0.818542	3.239450e-52	6.856805e-50
MsaG016159	MsaG042534	0.844605	1.276091e-58	5.771804e-56
MsaG016159	MsaG042634	0.828889	1.253585e-54	3.514630e-52
MsaG016159	MsaG042720	0.877545	1.205855e-68	1.943896e-65
MsaG016159	MsaG042729	0.827868	2.204415e-54	6.005915e-52
MsaG016159	MsaG042790	0.851590	1.536919e-60	8.799097e-58
MsaG016159	MsaG042796	0.842951	3.519502e-58	1.508882e-55
MsaG016159	MsaG042801	0.807210	9.594078e-50	1.532001e-47
MsaG016159	MsaG042814	0.836743	1.432483e-56	5.056042e-54
MsaG016159	MsaG042748	0.809534	3.081100e-50	5.202938e-48
MsaG016159	MsaG042917	0.822576	3.878618e-53	9.135029e-51
MsaG016159	MsaG042926	0.815454	1.587800e-51	3.104852e-49
MsaG016159	MsaG042932	0.845938	5.586157e-59	2.640149e-56
MsaG016159	MsaG043169	0.804242	4.002996e-49	5.963113e-47
MsaG016159	MsaG043183	0.860134	5.015752e-63	3.920166e-60
MsaG016159	MsaG043229	0.882245	2.606848e-70	5.226600e-67
MsaG016159	MsaG043395	0.874594	1.235586e-67	1.745729e-64
MsaG016159	MsaG043554	0.867161	3.378694e-65	3.482606e-62
MsaG016159	MsaG043729	0.808897	4.213807e-50	7.007137e-48
MsaG016159	MsaG043847	0.867827	2.071652e-65	2.194377e-62
MsaG016159	MsaG043875	0.818953	2.615450e-52	5.596026e-50
MsaG016159	MsaG044050	0.887353	3.342220e-72	8.603978e-69
MsaG016159	MsaG044265	0.830866	4.154987e-55	1.232686e-52
MsaG016159	MsaG044321	0.852077	1.120015e-60	6.523960e-58
MsaG016159	MsaG044325	0.824254	1.578200e-53	3.889946e-51
MsaG016159	MsaG044330	0.800885	1.955640e-48	2.697458e-46
MsaG016159	MsaG044575	0.877367	1.389243e-68	2.221306e-65
MsaG016159	MsaG044569	0.813822	3.634692e-51	6.821379e-49
MsaG016159	MsaG044570	0.836871	1.328737e-56	4.708083e-54
MsaG016159	MsaG044542	0.832374	1.773707e-55	5.497681e-53
MsaG016159	MsaG044602	0.819118	2.400212e-52	5.157846e-50
MsaG016159	MsaG044581	0.869846	4.631093e-66	5.332023e-63
MsaG016159	MsaG044630	0.900887	1.078595e-77	5.814153e-74
MsaG016159	MsaG044709	0.826474	4.734577e-54	1.240712e-51
MsaG016159	MsaG044768	0.809159	3.703952e-50	6.198199e-48
MsaG016159	MsaG044881	0.825782	6.904640e-54	1.774804e-51
MsaG016159	MsaG044861	0.805508	2.183052e-49	3.348838e-47
MsaG016159	MsaG044865	0.867572	2.499584e-65	2.620188e-62
MsaG016159	MsaG044869	0.824450	1.420138e-53	3.519195e-51
MsaG016159	MsaG044870	0.810920	1.553427e-50	2.712943e-48
MsaG016159	MsaG044901	0.830899	4.078975e-55	1.211261e-52
MsaG016159	MsaG044993	0.814340	2.797548e-51	5.318766e-49
MsaG016159	MsaG045044	0.814203	2.997967e-51	5.680320e-49
MsaG016159	MsaG045052	0.876257	3.354281e-68	5.102066e-65
MsaG016159	MsaG045234	0.868842	9.788764e-66	1.080869e-62
MsaG016159	MsaG045242	0.837458	9.422079e-57	3.398936e-54
MsaG016159	MsaG045275	0.809183	3.661331e-50	6.130344e-48
MsaG016159	MsaG045390	0.808315	5.601317e-50	9.184541e-48
MsaG016159	MsaG045400	0.802289	1.011135e-48	1.439899e-46
MsaG016159	MsaG045413	0.882985	1.404052e-70	2.918302e-67
MsaG016159	MsaG045454	0.867083	3.576417e-65	3.675256e-62
MsaG016159	MsaG045456	0.805498	2.193067e-49	3.363432e-47
MsaG016159	MsaG045556	0.805599	2.089628e-49	3.212372e-47
MsaG016159	MsaG045600	0.809901	2.571186e-50	4.380414e-48
MsaG016159	MsaG045606	0.806018	1.707906e-49	2.651483e-47
MsaG016159	MsaG045646	0.824569	1.332093e-53	3.311676e-51
MsaG016159	MsaG045733	0.803995	4.503386e-49	6.670129e-47
MsaG016159	MsaG045736	0.891254	1.038605e-73	3.268337e-70
MsaG016159	MsaG045796	0.828498	1.556250e-54	4.315873e-52
MsaG016159	MsaG045909	0.834834	4.338405e-56	1.446058e-53
MsaG016159	MsaG045923	0.827894	2.172309e-54	5.922978e-52
MsaG016159	MsaG045939	0.803747	5.066870e-49	7.461893e-47
MsaG016159	MsaG045959	0.808403	5.366267e-50	8.817558e-48
MsaG016159	MsaG045994	0.880010	1.646611e-69	2.972862e-66
MsaG016159	MsaG046074	0.808847	4.318106e-50	7.172031e-48
MsaG016159	MsaG046150	0.804224	4.036219e-49	6.010217e-47
MsaG016159	MsaG046154	0.806493	1.358008e-49	2.132224e-47
MsaG016159	MsaG046163	0.837258	1.059311e-56	3.797616e-54
MsaG016159	MsaG046255	0.805118	2.632176e-49	4.001507e-47
MsaG016159	MsaG046274	0.806961	1.082633e-49	1.718640e-47
MsaG016159	MsaG046275	0.808209	5.897644e-50	9.646075e-48
MsaG016159	MsaG046278	0.912550	4.200174e-83	4.693992e-79
MsaG016159	MsaG046355	0.834863	4.266926e-56	1.423433e-53
MsaG016159	MsaG046438	0.867703	2.269419e-65	2.391528e-62
MsaG016159	MsaG046489	0.822112	4.963625e-53	1.154554e-50
MsaG016159	MsaG046495	0.817990	4.313594e-52	9.001396e-50
MsaG016159	MsaG046511	0.863896	3.570121e-64	3.227553e-61
MsaG016159	MsaG046687	0.841763	7.241120e-58	2.988496e-55
MsaG016159	MsaG046600	0.831932	2.278216e-55	6.971992e-53
MsaG016159	MsaG046724	0.800154	2.751663e-48	3.733301e-46
MsaG016159	MsaG046712	0.850279	3.584546e-60	1.961171e-57
MsaG016159	MsaG046713	0.817513	5.520097e-52	1.137820e-49
MsaG016159	MsaG046718	0.808600	4.871752e-50	8.043337e-48
MsaG016159	MsaG046740	0.841637	7.814507e-58	3.212230e-55
MsaG016159	MsaG046755	0.844898	1.064954e-58	4.864355e-56
MsaG016159	MsaG046860	0.863032	6.595913e-64	5.764181e-61
MsaG016159	MsaG046784	0.835887	2.359081e-56	8.114769e-54
MsaG016159	MsaG046828	0.856231	7.179172e-62	4.850463e-59
MsaG016159	MsaG046830	0.897059	4.600023e-76	1.987100e-72
MsaG016159	MsaG046866	0.836054	2.140818e-56	7.400880e-54
MsaG016159	MsaG046957	0.843277	2.884936e-58	1.249817e-55
MsaG016159	MsaG046967	0.882250	2.595705e-70	5.205541e-67
MsaG016159	MsaG046973	0.832307	1.842257e-55	5.699074e-53
MsaG016159	MsaG046974	0.879590	2.318155e-69	4.106209e-66
MsaG016159	MsaG047023	0.814377	2.745366e-51	5.224517e-49
MsaG016159	MsaG002644	0.831261	3.327320e-55	9.983656e-53
MsaG016159	MsaG003317	0.813408	4.477831e-51	8.316741e-49
MsaG016159	MsaG001594	0.912644	3.771835e-83	4.241466e-79
MsaG016159	MsaG001871	0.855399	1.253583e-61	8.216371e-59
MsaG016159	MsaG001896	0.800804	2.031549e-48	2.797120e-46
MsaG016159	MsaG003078	0.806442	1.392042e-49	2.183092e-47
MsaG016159	MsaG001472	0.849092	7.658170e-60	4.024214e-57
MsaG016159	MsaG000780	0.824028	1.782461e-53	4.366583e-51
MsaG016159	MsaG005823	0.817606	5.261154e-52	1.087024e-49
MsaG016159	MsaG004310	0.800935	1.910115e-48	2.637677e-46
MsaG016159	MsaG000782	0.828272	1.763868e-54	4.860360e-52
MsaG016159	MsaG002980	0.861734	1.645381e-63	1.366738e-60
MsaG016159	MsaG002072	0.850829	2.515524e-60	1.402897e-57
MsaG016159	MsaG003314	0.853778	3.673118e-61	2.271809e-58
MsaG016159	MsaG002665	0.842877	3.681929e-58	1.574799e-55
MsaG016159	MsaG002432	0.885064	2.416364e-71	5.551955e-68
MsaG016159	MsaG002355	0.868873	9.565408e-66	1.057492e-62
MsaG016159	MsaG001868	0.872618	5.685548e-67	7.367209e-64
MsaG016159	MsaG001992	0.868397	1.360943e-65	1.475642e-62
MsaG016159	MsaG000822	0.879479	2.538028e-69	4.472563e-66
MsaG016159	MsaG002387	0.820791	9.988561e-53	2.243237e-50
MsaG016159	MsaG000821	0.807844	7.048225e-50	1.142726e-47
MsaG016159	MsaG001760	0.842543	4.511990e-58	1.909380e-55
MsaG016159	MsaG007676	0.807569	8.058481e-50	1.297859e-47
MsaG016159	MsaG009146	0.930171	6.593163e-93	2.720594e-88
MsaG016159	MsaG007270	0.841392	9.062456e-58	3.696405e-55
MsaG016159	MsaG007510	0.823680	2.149524e-53	5.216397e-51
MsaG016159	MsaG009203	0.854153	2.867935e-61	1.797655e-58
MsaG016159	MsaG007963	0.870450	2.945692e-66	3.478110e-63
MsaG016159	MsaG006009	0.816225	1.070864e-51	2.135431e-49
MsaG016159	MsaG010025	0.870589	2.651327e-66	3.149119e-63
MsaG016159	MsaG009718	0.808919	4.167497e-50	6.933767e-48
MsaG016159	MsaG006540	0.868836	9.830999e-66	1.085249e-62
MsaG016159	MsaG008699	0.852464	8.701634e-61	5.137481e-58
MsaG016159	MsaG008170	0.817762	4.854943e-52	1.007118e-49
MsaG016159	MsaG010536	0.805363	2.340724e-49	3.578671e-47
MsaG016159	MsaG006329	0.802851	7.750426e-49	1.117957e-46
MsaG016159	MsaG007976	0.838775	4.332229e-57	1.627653e-54
MsaG016159	MsaG008505	0.814720	2.306444e-51	4.427069e-49
MsaG016159	MsaG008774	0.891400	9.094976e-74	2.884509e-70
MsaG016159	MsaG008985	0.844821	1.116779e-58	5.087669e-56
MsaG016159	MsaG012533	0.812623	6.643259e-51	1.209891e-48
MsaG016159	MsaG013381	0.813548	4.172591e-51	7.777158e-49
MsaG016159	MsaG015407	0.800901	1.941305e-48	2.678643e-46
MsaG016159	MsaG012002	0.822498	4.043269e-53	9.502800e-51
MsaG016159	MsaG012600	0.841432	8.845217e-58	3.612490e-55
MsaG016159	MsaG014915	0.854582	2.158885e-61	1.374097e-58
MsaG016159	MsaG013256	0.801051	1.809336e-48	2.504977e-46
MsaG016159	MsaG013966	0.811338	1.262242e-50	2.227157e-48
MsaG016159	MsaG013164	0.802897	7.585928e-49	1.095392e-46
MsaG016159	MsaG012745	0.860936	2.874195e-63	2.315593e-60
MsaG016159	MsaG013930	0.827308	2.999060e-54	8.043557e-52
MsaG016159	MsaG013395	0.823189	2.796308e-53	6.695927e-51
MsaG016159	MsaG013040	0.850419	3.275451e-60	1.800883e-57
MsaG016159	MsaG011544	0.843770	2.133137e-58	9.388673e-56
MsaG016159	MsaG012608	0.866492	5.503856e-65	5.520508e-62
MsaG016159	MsaG012731	0.873716	2.441502e-67	3.319072e-64
MsaG016159	MsaG015535	0.880467	1.132757e-69	2.089884e-66
MsaG016159	MsaG013208	0.804554	3.448563e-49	5.174376e-47
MsaG016159	MsaG014169	0.808849	4.313985e-50	7.165453e-48
MsaG016159	MsaG016523	0.804609	3.359002e-49	5.046307e-47
MsaG016159	MsaG013466	0.802140	1.084706e-48	1.539351e-46
MsaG016159	MsaG013414	0.808330	5.560857e-50	9.121487e-48
MsaG016159	MsaG012090	0.841208	1.012633e-57	4.106230e-55
MsaG016159	MsaG013382	0.884663	3.400987e-71	7.661123e-68
MsaG016159	MsaG022641	0.862790	7.828215e-64	6.776301e-61
MsaG016159	MsaG018327	0.856080	7.943258e-62	5.336792e-59
MsaG016159	MsaG020050	0.807264	9.344036e-50	1.493994e-47
MsaG016159	MsaG019320	0.857451	3.152494e-62	2.227255e-59
MsaG016159	MsaG019815	0.825288	9.028419e-54	2.289123e-51
MsaG016159	MsaG021526	0.877208	1.577852e-68	2.504583e-65
MsaG016159	MsaG020160	0.829405	9.408205e-55	2.676724e-52
MsaG016159	MsaG023034	0.830898	4.080622e-55	1.211729e-52
MsaG016159	MsaG019765	0.870561	2.709033e-66	3.213641e-63
MsaG016159	MsaG020304	0.805916	1.793373e-49	2.777598e-47
MsaG016159	MsaG019332	0.894899	3.585685e-75	1.373458e-71
MsaG016159	MsaG020545	0.842371	5.009549e-58	2.108252e-55
MsaG016159	MsaG019406	0.861919	1.445844e-63	1.209696e-60
MsaG016159	MsaG018389	0.870368	3.131692e-66	3.685714e-63
MsaG016159	MsaG019826	0.838044	6.675893e-57	2.451698e-54
MsaG016159	MsaG018137	0.836631	1.529479e-56	5.380098e-54
MsaG016159	MsaG019500	0.852976	6.226070e-61	3.742977e-58
MsaG016159	MsaG023042	0.807898	6.865105e-50	1.114496e-47
MsaG016159	MsaG022733	0.853336	4.914772e-61	2.992195e-58
MsaG016159	MsaG022710	0.842574	4.429974e-58	1.876472e-55
MsaG016159	MsaG027471	0.846010	5.341175e-59	2.530549e-56
MsaG016159	MsaG026180	0.804304	3.885075e-49	5.795927e-47
MsaG016159	MsaG027637	0.801325	1.591498e-48	2.217152e-46
MsaG016159	MsaG027150	0.915401	1.532273e-84	2.076409e-80
MsaG016159	MsaG026524	0.800975	1.875227e-48	2.591756e-46
MsaG016159	MsaG028769	0.812407	7.403397e-51	1.341149e-48
MsaG016159	MsaG028048	0.827084	3.391205e-54	9.038513e-52
MsaG016159	MsaG027785	0.836594	1.562243e-56	5.489311e-54
MsaG016159	MsaG027401	0.848987	8.188235e-60	4.287117e-57
MsaG016159	MsaG032293	0.893098	1.920295e-74	6.671695e-71
MsaG016159	MsaG031534	0.850443	3.225937e-60	1.775114e-57
MsaG016159	MsaG031376	0.836313	1.840520e-56	6.413045e-54
MsaG016159	MsaG031514	0.878185	7.218065e-69	1.198239e-65
MsaG016159	MsaG032302	0.823894	1.915964e-53	4.676422e-51
MsaG016159	MsaG032245	0.804226	4.032551e-49	6.005051e-47
MsaG016159	MsaG029995	0.868367	1.391279e-65	1.506710e-62
MsaG016159	MsaG031416	0.855514	1.160357e-61	7.637456e-59
MsaG016159	MsaG030964	0.808475	5.179164e-50	8.525402e-48
MsaG016159	MsaG033463	0.809840	2.650435e-50	4.508791e-48
MsaG016159	MsaG030749	0.878303	6.567651e-69	1.096051e-65
MsaG016159	MsaG033404	0.875804	4.793131e-68	7.144893e-65
MsaG016159	MsaG034617	0.800050	2.887626e-48	3.908724e-46
MsaG016159	MsaG031895	0.802595	8.750596e-49	1.254896e-46
MsaG016159	MsaG033663	0.872421	6.608664e-67	8.490988e-64
MsaG016159	MsaG033107	0.833294	1.050327e-55	3.344374e-53
MsaG016159	MsaG032454	0.886949	4.754812e-72	1.199138e-68
MsaG016159	MsaG032963	0.836483	1.667278e-56	5.838936e-54
MsaG016159	MsaG032707	0.810167	2.254444e-50	3.865659e-48
MsaG016159	MsaG030753	0.823220	2.749798e-53	6.590143e-51
MsaG016159	MsaG033505	0.841213	1.009421e-57	4.093987e-55
MsaG016159	MsaG030906	0.857358	3.355626e-62	2.362708e-59
MsaG016159	MsaG034182	0.813119	5.179466e-51	9.550509e-49
MsaG016159	MsaG032904	0.852204	1.031060e-60	6.032304e-58
MsaG016159	MsaG031389	0.811037	1.465391e-50	2.566633e-48
MsaG016159	MsaG032721	0.862502	9.596497e-64	8.213099e-61
MsaG016159	MsaG031505	0.842137	5.776865e-58	2.412671e-55
MsaG016159	MsaG030125	0.846169	4.835116e-59	2.303004e-56
MsaG016159	MsaG033446	0.892829	2.462292e-74	8.432456e-71
MsaG016159	MsaG030460	0.839463	2.879653e-57	1.105401e-54
MsaG016159	MsaG030574	0.821791	5.885209e-53	1.357191e-50
MsaG016159	MsaG030569	0.813404	4.487943e-51	8.334633e-49
MsaG016159	MsaG037042	0.876568	2.621535e-68	4.043112e-65
MsaG016159	MsaG036959	0.806794	1.173754e-49	1.856029e-47
MsaG016159	MsaG038289	0.821685	6.227837e-53	1.432204e-50
MsaG016159	MsaG036285	0.857198	3.741094e-62	2.618181e-59
MsaG016159	MsaG036792	0.819867	1.622353e-52	3.555548e-50
MsaG016159	MsaG040323	0.804336	3.826221e-49	5.712334e-47
MsaG016159	MsaG036901	0.804038	4.410980e-49	6.540183e-47
MsaG016159	MsaG035919	0.858714	1.333399e-62	9.873981e-60
MsaG016159	MsaG038133	0.907994	6.637588e-81	5.511678e-77
MsaG016159	MsaG036619	0.859442	8.086278e-63	6.155256e-60
MsaG016159	MsaG036937	0.802920	7.503540e-49	1.084067e-46
MsaG016159	MsaG037651	0.830775	4.373725e-55	1.294163e-52
MsaG016159	MsaG036638	0.810739	1.698839e-50	2.953884e-48
MsaG016159	MsaG036794	0.800824	2.011960e-48	2.771394e-46
MsaG016159	MsaG036541	0.845591	6.933334e-59	3.239436e-56
MsaG016159	MsaG036986	0.826341	5.091350e-54	1.329209e-51
MsaG016159	MsaG038583	0.824369	1.484011e-53	3.669379e-51
MsaG016159	MsaG036628	0.855488	1.181304e-61	7.767786e-59
MsaG016159	MsaG036115	0.800466	2.379252e-48	3.250918e-46
MsaG016159	MsaG036557	0.804200	4.083079e-49	6.076527e-47
MsaG016159	MsaG036763	0.833206	1.104427e-55	3.507723e-53
MsaG016159	MsaG037636	0.812882	5.834174e-51	1.069427e-48
MsaG016159	MsaG036361	0.855427	1.229718e-61	8.068082e-59
MsaG016159	MsaG036961	0.805934	1.778224e-49	2.755285e-47
MsaG016159	MsaG036344	0.897976	1.897925e-76	8.635530e-73
MsaG016159	MsaG044603	0.813034	5.404053e-51	9.943824e-49
MsaG016159	MsaG045902	0.815604	1.470825e-51	2.887084e-49
MsaG016159	MsaG043768	0.847525	2.067460e-59	1.030417e-56
MsaG016159	MsaG042570	0.815756	1.361190e-51	2.682102e-49
MsaG016159	MsaG044173	0.817386	5.894333e-52	1.210992e-49
MsaG016159	MsaG043110	0.906139	4.839144e-80	3.574346e-76
MsaG016159	MsaG042910	0.865905	8.431729e-65	8.259136e-62
MsaG016159	MsaG041725	0.850944	2.335707e-60	1.307796e-57
MsaG016159	MsaG043535	0.851046	2.185375e-60	1.227985e-57
MsaG016159	MsaG043849	0.805888	1.818379e-49	2.814438e-47
MsaG016159	MsaG043553	0.877232	1.547577e-68	2.459436e-65

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG016159	MtrunA17_Chr3g0125431	75.774	743	158	8	1	729	1	735	0.0	1139
MsaG016159	MtrunA17_Chr3g0125471	79.070	731	78	6	1	729	1	658	0.0	1114
MsaG016159	MtrunA17_Chr2g0279661	74.425	739	171	6	1	726	3	736	0.0	1090
MsaG016159	MtrunA17_Chr3g0125441	70.199	755	188	6	5	729	18	765	0.0	1070
MsaG016159	MtrunA17_Chr3g0125451	72.081	745	174	9	3	729	2	730	0.0	1046
MsaG016159	MtrunA17_Chr3g0125461	73.239	710	178	5	1	709	23	721	0.0	1040
MsaG016159	MtrunA17_Chr1g0158201	48.315	712	324	16	9	710	14	691	0.0	635
MsaG016159	MtrunA17_Chr1g0158251	47.753	712	332	16	9	710	15	696	0.0	620
MsaG016159	MtrunA17_Chr1g0158261	47.546	713	313	18	14	710	20	687	0.0	608
MsaG016159	MtrunA17_Chr1g0148501	46.174	745	356	18	13	731	16	741	0.0	606
MsaG016159	MtrunA17_Chr1g0148511	45.638	745	347	20	1	720	1	712	0.0	598
MsaG016159	MtrunA17_Chr1g0148461	45.714	735	347	20	10	725	26	727	0.0	592
MsaG016159	MtrunA17_Chr1g0148491	47.676	667	290	19	85	721	3	640	0.0	557
MsaG016159	MtrunA17_Chr3g0125491	79.464	336	67	1	374	709	1	334	0.0	549
MsaG016159	MtrunA17_Chr1g0158211	54.628	443	178	6	300	728	26	459	7.16e-159	468
MsaG016159	MtrunA17_Chr1g0158231	56.971	416	162	6	300	710	4	407	2.44e-155	458
MsaG016159	MtrunA17_Chr1g0158171	55.718	411	171	5	300	708	15	416	1.10e-153	454
MsaG016159	MtrunA17_Chr3g0125481	63.812	362	122	5	1	361	1	354	8.80e-153	447
MsaG016159	MtrunA17_Chr1g0158291	60.440	364	124	4	381	728	4	363	6.01e-146	431
MsaG016159	MtrunA17_Chr2g0293081	39.800	701	336	23	27	704	32	669	7.98e-140	428
MsaG016159	MtrunA17_Chr7g0248904	48.241	398	199	3	311	708	249	639	2.62e-127	394
MsaG016159	MtrunA17_Chr7g0248881	50.000	382	189	2	323	704	249	628	3.24e-126	391
MsaG016159	MtrunA17_Chr2g0293071	57.419	310	127	4	396	704	27	332	5.54e-117	357
MsaG016159	MtrunA17_Chr7g0265391	40.670	418	222	6	304	711	230	631	2.69e-93	303
MsaG016159	MtrunA17_Chr3g0112391	44.086	372	191	5	337	704	264	622	4.36e-93	303
MsaG016159	MtrunA17_Chr5g0403051	37.097	434	232	9	287	704	197	605	3.06e-79	268
MsaG016159	MtrunA17_Chr8g0374031	38.462	390	223	6	323	704	231	611	4.08e-77	262
MsaG016159	MtrunA17_Chr3g0141261	35.307	456	245	9	287	714	198	631	4.08e-74	254
MsaG016159	MtrunA17_Chr7g0251121	46.599	294	150	5	415	704	352	642	1.30e-73	252
MsaG016159	MtrunA17_Chr5g0423061	38.978	372	209	7	348	712	233	593	4.82e-73	249
MsaG016159	MtrunA17_Chr8g0369231	45.714	315	156	6	407	714	250	556	2.76e-71	244
MsaG016159	MtrunA17_Chr6g0467601	38.684	380	217	8	356	727	80	451	1.75e-70	238
MsaG016159	MtrunA17_Chr8g0352381	44.948	287	156	2	416	702	517	801	2.71e-69	244
MsaG016159	MtrunA17_Chr2g0318301	41.818	330	178	5	407	724	473	800	3.01e-69	243
MsaG016159	MtrunA17_Chr8g0361611	44.408	304	166	3	413	715	432	733	5.25e-68	238
MsaG016159	MtrunA17_Chr3g0108351	37.653	409	222	8	318	719	526	908	8.78e-68	240
MsaG016159	MtrunA17_Chr1g0202711	42.857	308	164	5	422	721	495	798	1.38e-67	238
MsaG016159	MtrunA17_Chr1g0165521	45.361	291	156	3	413	702	445	733	1.44e-67	237
MsaG016159	MtrunA17_Chr8g0342071	42.767	318	175	4	414	724	434	751	3.96e-67	237
MsaG016159	MtrunA17_Chr2g0292501	42.368	321	173	4	416	726	507	825	5.60e-67	237
MsaG016159	MtrunA17_Chr1g0209431	44.218	294	157	5	415	704	323	613	5.92e-67	233
MsaG016159	MtrunA17_Chr1g0209361	43.974	307	156	6	415	709	328	630	6.43e-67	234
MsaG016159	MtrunA17_Chr1g0190581	43.144	299	167	3	416	712	508	805	8.27e-67	236
MsaG016159	MtrunA17_Chr8g0376061	37.755	392	229	8	318	704	230	611	2.06e-66	232
MsaG016159	MtrunA17_Chr3g0108361	38.021	384	216	8	335	711	534	902	3.83e-66	236
MsaG016159	MtrunA17_Chr8g0369211	46.689	302	155	4	407	704	603	902	4.27e-66	236
MsaG016159	MtrunA17_Chr4g0030441	44.755	286	155	3	418	702	488	771	8.34e-66	233
MsaG016159	MtrunA17_Chr6g0468691	43.312	314	168	6	415	723	482	790	1.30e-65	232
MsaG016159	MtrunA17_Chr6g0483931	42.763	304	165	6	407	704	344	644	1.68e-65	230
MsaG016159	MtrunA17_Chr8g0364671	39.333	300	177	4	401	696	34	332	2.42e-65	221
MsaG016159	MtrunA17_Chr6g0467631	37.500	376	227	5	341	711	260	632	2.96e-65	229
MsaG016159	MtrunA17_Chr7g0274261	43.144	299	167	3	416	712	513	810	4.17e-65	232
MsaG016159	MtrunA17_Chr2g0327671	45.035	282	152	3	422	702	495	774	5.00e-65	231
MsaG016159	MtrunA17_Chr4g0053521	46.809	282	148	2	422	702	1051	1331	8.21e-65	234
MsaG016159	MtrunA17_Chr3g0123141	39.516	372	207	9	349	709	522	886	1.18e-64	231
MsaG016159	MtrunA17_Chr4g0053591	44.983	289	156	3	415	702	134	420	3.39e-64	221
MsaG016159	MtrunA17_Chr2g0288121	37.421	318	196	3	404	718	16	333	3.94e-64	217
MsaG016159	MtrunA17_Chr6g0485761	40.645	310	177	4	418	722	283	590	4.73e-64	226
MsaG016159	MtrunA17_Chr4g0061081	42.384	302	165	4	407	702	498	796	7.45e-64	228
MsaG016159	MtrunA17_Chr5g0413981	40.264	303	164	7	408	699	46	342	9.63e-64	216
MsaG016159	MtrunA17_Chr4g0034931	40.206	291	166	3	416	702	126	412	1.36e-63	219
MsaG016159	MtrunA17_Chr4g0025961	37.500	416	211	12	318	704	408	803	1.40e-63	228
MsaG016159	MtrunA17_Chr5g0415451	40.256	313	171	4	408	704	405	717	1.50e-63	225
MsaG016159	MtrunA17_Chr7g0262521	40.268	298	166	5	414	704	330	622	2.14e-63	225
MsaG016159	MtrunA17_Chr2g0299301	42.581	310	161	7	401	702	1034	1334	2.25e-63	230
MsaG016159	MtrunA17_Chr4g0053561	47.163	282	146	3	422	702	433	712	3.65e-63	225
MsaG016159	MtrunA17_Chr6g0483731	42.951	305	148	8	416	704	50	344	3.66e-63	215
MsaG016159	MtrunA17_Chr7g0221191	38.871	319	188	4	409	722	374	690	3.76e-63	224
MsaG016159	MtrunA17_Chr6g0485721	39.104	335	176	6	395	708	49	376	4.03e-63	216
MsaG016159	MtrunA17_Chr2g0333181	37.920	327	197	4	408	729	18	343	4.56e-63	214
MsaG016159	MtrunA17_Chr7g0219611	40.000	400	201	13	332	711	417	797	7.13e-63	225
MsaG016159	MtrunA17_Chr3g0143961	37.179	312	184	5	406	710	44	350	1.17e-62	214
MsaG016159	MtrunA17_Chr5g0443691	38.125	320	191	4	394	706	60	379	2.09e-62	214
MsaG016159	MtrunA17_Chr4g0053571	46.809	282	147	3	422	702	490	769	2.11e-62	224
MsaG016159	MtrunA17_Chr3g0109431	39.865	296	170	5	418	709	316	607	2.13e-62	220
MsaG016159	MtrunA17_Chr4g0066761	40.767	287	166	4	418	701	60	345	5.13e-62	212
MsaG016159	MtrunA17_Chr2g0286281	38.390	323	195	4	402	720	60	382	7.11e-62	216
MsaG016159	MtrunA17_Chr4g0033571	43.667	300	158	6	418	707	501	799	1.13e-61	223
MsaG016159	MtrunA17_Chr7g0219651	39.894	376	203	10	338	702	1430	1793	1.49e-61	224
MsaG016159	MtrunA17_Chr7g0219651	36.798	356	180	11	357	704	481	799	1.82e-48	185
MsaG016159	MtrunA17_Chr8g0382101	36.339	366	219	8	350	711	212	567	1.57e-61	217
MsaG016159	MtrunA17_Chr2g0283111	41.640	317	177	7	416	729	597	908	1.71e-61	222
MsaG016159	MtrunA17_Chr1g0205771	35.714	364	214	8	349	709	277	623	1.78e-61	218
MsaG016159	MtrunA17_Chr3g0144551	39.446	289	171	4	416	702	120	406	2.00e-61	213
MsaG016159	MtrunA17_Chr7g0259211	39.779	362	189	9	356	702	213	560	2.33e-61	218
MsaG016159	MtrunA17_Chr1g0209391	40.391	307	172	6	415	715	285	586	2.55e-61	218
MsaG016159	MtrunA17_Chr2g0328171	39.938	323	169	9	412	716	56	371	3.57e-61	211
MsaG016159	MtrunA17_Chr7g0245221	41.562	320	169	6	413	722	604	915	3.73e-61	221
MsaG016159	MtrunA17_Chr7g0221711	41.456	316	167	6	413	718	605	912	3.98e-61	221
MsaG016159	MtrunA17_Chr7g0271451	41.463	287	164	4	418	702	183	467	5.88e-61	213
MsaG016159	MtrunA17_Chr2g0327471	39.792	289	171	3	416	701	77	365	9.02e-61	210
MsaG016159	MtrunA17_Chr4g0017241	37.778	315	180	3	404	702	450	764	9.51e-61	218
MsaG016159	MtrunA17_Chr1g0209381	42.517	294	162	4	415	704	313	603	1.03e-60	216
MsaG016159	MtrunA17_Chr8g0388941	41.066	319	168	7	406	711	47	358	1.34e-60	209
MsaG016159	MtrunA17_Chr5g0408941	39.482	309	163	8	418	713	80	377	1.88e-60	209
MsaG016159	MtrunA17_Chr8g0344141	41.806	299	162	6	415	704	64	359	2.13e-60	211
MsaG016159	MtrunA17_Chr4g0069251	40.767	287	166	4	418	702	167	451	2.21e-60	211
MsaG016159	MtrunA17_Chr5g0443121	39.088	307	181	5	418	720	171	475	2.73e-60	211
MsaG016159	MtrunA17_Chr3g0123891	40.532	301	174	5	415	711	271	570	3.04e-60	214
MsaG016159	MtrunA17_Chr7g0236531	39.373	287	169	4	413	697	23	306	3.95e-60	206
MsaG016159	MtrunA17_Chr7g0236231	35.734	361	219	6	346	697	430	786	4.50e-60	217
MsaG016159	MtrunA17_Chr7g0263521	37.662	308	187	4	410	712	51	358	4.60e-60	207
MsaG016159	MtrunA17_Chr7g0219571	39.510	367	196	9	347	702	457	808	4.91e-60	218
MsaG016159	MtrunA17_Chr2g0302631	40.893	291	160	6	418	702	172	456	5.83e-60	210
MsaG016159	MtrunA17_Chr2g0280681	35.101	396	226	6	357	731	439	824	7.98e-60	216
MsaG016159	MtrunA17_Chr7g0226891	37.762	286	171	3	418	701	38	318	8.32e-60	206
MsaG016159	MtrunA17_Chr5g0432871	38.040	347	199	6	365	704	551	888	9.00e-60	218
MsaG016159	MtrunA17_Chr1g0196391	39.104	335	192	5	376	702	241	571	9.23e-60	213
MsaG016159	MtrunA17_Chr3g0144481	38.462	299	171	4	418	708	77	370	1.07e-59	208
MsaG016159	MtrunA17_Chr4g0044691	36.562	320	179	9	410	715	307	616	1.25e-59	213
MsaG016159	MtrunA17_Chr7g0219601	38.544	371	194	10	347	702	441	792	1.37e-59	216
MsaG016159	MtrunA17_Chr2g0327511	40.203	296	168	5	416	705	94	386	1.66e-59	206
MsaG016159	MtrunA17_Chr3g0109461	39.661	295	173	4	418	709	328	620	1.71e-59	213
MsaG016159	MtrunA17_Chr2g0320111	36.512	367	210	7	352	701	10	370	2.90e-59	206
MsaG016159	MtrunA17_Chr7g0245131	44.599	287	155	4	418	702	523	807	3.19e-59	215
MsaG016159	MtrunA17_Chr4g0074651	39.384	292	174	3	416	704	109	400	3.36e-59	206
MsaG016159	MtrunA17_Chr2g0314201	43.922	255	140	3	423	676	1	253	4.80e-59	200
MsaG016159	MtrunA17_Chr5g0416311	40.000	310	163	7	411	704	57	359	7.00e-59	204
MsaG016159	MtrunA17_Chr2g0314881	40.397	302	162	6	417	709	216	508	7.21e-59	209
MsaG016159	MtrunA17_Chr5g0406841	39.482	309	170	6	415	708	131	437	7.65e-59	206
MsaG016159	MtrunA17_Chr7g0270121	38.806	335	195	7	403	728	350	683	8.29e-59	212
MsaG016159	MtrunA17_Chr2g0284101	41.156	294	166	5	415	704	284	574	8.76e-59	210
MsaG016159	MtrunA17_Chr8g0371311	36.158	354	208	8	356	702	12	354	9.25e-59	205
MsaG016159	MtrunA17_Chr8g0340051	37.543	293	176	3	413	701	12	301	9.36e-59	202
MsaG016159	MtrunA17_Chr5g0411631	40.199	301	175	4	412	710	580	877	1.35e-58	214
MsaG016159	MtrunA17_Chr4g0064201	40.000	300	156	7	418	701	99	390	1.55e-58	205
MsaG016159	MtrunA17_Chr7g0237401	37.580	314	191	4	407	715	70	383	1.63e-58	204
MsaG016159	MtrunA17_Chr3g0109411	37.966	295	177	5	418	709	313	604	1.65e-58	209
MsaG016159	MtrunA17_Chr5g0420161	43.003	293	158	6	418	704	263	552	1.69e-58	208
MsaG016159	MtrunA17_Chr1g0213991	39.792	289	171	3	416	701	83	371	1.85e-58	205
MsaG016159	MtrunA17_Chr1g0161701	39.510	286	168	4	417	697	565	850	2.11e-58	213
MsaG016159	MtrunA17_Chr2g0312561	34.615	312	200	3	415	725	28	336	2.12e-58	202
MsaG016159	MtrunA17_Chr3g0104091	38.782	312	174	7	415	713	38	345	2.25e-58	204
MsaG016159	MtrunA17_Chr4g0055301	38.154	325	177	9	413	719	52	370	2.37e-58	202
MsaG016159	MtrunA17_Chr7g0220741	39.130	322	185	6	415	731	291	606	2.62e-58	209
MsaG016159	MtrunA17_Chr1g0194541	40.461	304	167	6	416	710	277	575	3.12e-58	209
MsaG016159	MtrunA17_Chr1g0153851	36.760	321	185	8	393	702	11	324	3.15e-58	201
MsaG016159	MtrunA17_Chr1g0191631	40.339	295	163	6	415	701	135	424	3.35e-58	204
MsaG016159	MtrunA17_Chr8g0348451	36.893	309	191	4	416	722	130	436	3.67e-58	204
MsaG016159	MtrunA17_Chr4g0073471	36.288	361	204	7	356	709	231	572	3.78e-58	208
MsaG016159	MtrunA17_Chr8g0370461	39.550	311	165	7	415	708	77	381	3.95e-58	202
MsaG016159	MtrunA17_Chr5g0413171	38.312	308	176	5	418	719	76	375	4.45e-58	203
MsaG016159	MtrunA17_Chr6g0453001	40.064	312	170	7	415	713	39	346	4.92e-58	202
MsaG016159	MtrunA17_Chr8g0348631	41.259	286	162	3	418	698	123	407	5.06e-58	203
MsaG016159	MtrunA17_Chr5g0413511	35.862	290	180	3	417	702	46	333	5.07e-58	202
MsaG016159	MtrunA17_Chr7g0245571	40.940	298	156	8	418	702	79	369	5.11e-58	203
MsaG016159	MtrunA17_Chr4g0048801	33.918	342	224	2	357	697	446	786	5.40e-58	211
MsaG016159	MtrunA17_Chr8g0392271	35.262	363	209	8	358	697	490	849	6.03e-58	212
MsaG016159	MtrunA17_Chr7g0248491	37.255	306	188	4	416	719	147	450	6.21e-58	204
MsaG016159	MtrunA17_Chr7g0236561	39.721	287	169	4	413	697	489	773	6.27e-58	211
MsaG016159	MtrunA17_Chr7g0264461	38.318	321	181	7	415	723	79	394	6.84e-58	202
MsaG016159	MtrunA17_Chr3g0096351	39.236	288	171	4	418	703	169	454	7.18e-58	204
MsaG016159	MtrunA17_Chr5g0413291	40.333	300	175	4	415	711	287	585	7.39e-58	207
MsaG016159	MtrunA17_Chr5g0435211	37.421	318	172	8	402	702	51	358	8.33e-58	202
MsaG016159	MtrunA17_Chr4g0055011	39.236	288	169	5	413	697	55	339	9.45e-58	201
MsaG016159	MtrunA17_Chr4g0071221	33.173	416	231	10	352	729	444	850	9.90e-58	211
MsaG016159	MtrunA17_Chr2g0314821	37.978	366	200	8	349	709	600	943	1.10e-57	212
MsaG016159	MtrunA17_Chr1g0180951	36.923	325	190	5	415	725	74	397	1.33e-57	202
MsaG016159	MtrunA17_Chr8g0373501	37.273	330	180	7	410	723	315	633	1.41e-57	207
MsaG016159	MtrunA17_Chr1g0161711	38.966	290	164	5	417	697	560	845	1.49e-57	211
MsaG016159	MtrunA17_Chr7g0236341	39.865	296	167	5	409	697	494	785	1.53e-57	210
MsaG016159	MtrunA17_Chr5g0420181	43.003	293	158	6	418	704	487	776	1.79e-57	209
MsaG016159	MtrunA17_Chr2g0329401	39.024	328	188	6	380	702	476	796	1.86e-57	211
MsaG016159	MtrunA17_Chr8g0380441	37.224	317	186	7	403	709	45	358	1.94e-57	200
MsaG016159	MtrunA17_Chr7g0216551	38.387	310	177	5	412	709	105	412	1.99e-57	202
MsaG016159	MtrunA17_Chr8g0340081	39.175	291	174	2	413	701	490	779	2.16e-57	209
MsaG016159	MtrunA17_Chr5g0434141	41.197	284	160	4	417	694	579	861	2.20e-57	211
MsaG016159	MtrunA17_Chr1g0181821	36.792	318	196	4	410	722	52	369	2.33e-57	199
MsaG016159	MtrunA17_Chr8g0359641	38.585	311	178	6	407	709	641	946	2.66e-57	211
MsaG016159	MtrunA17_Chr1g0206331	37.584	298	181	5	411	706	318	612	2.86e-57	206
MsaG016159	MtrunA17_Chr2g0314841	40.940	298	166	5	417	709	648	940	3.03e-57	211
MsaG016159	MtrunA17_Chr8g0380681	38.133	375	208	11	347	703	898	1266	4.31e-57	211
MsaG016159	MtrunA17_Chr8g0380681	34.301	379	218	10	347	703	229	598	1.89e-50	191
MsaG016159	MtrunA17_Chr5g0429431	40.138	289	170	3	418	704	117	404	4.75e-57	201
MsaG016159	MtrunA17_Chr8g0359651	38.264	311	179	6	407	709	641	946	5.20e-57	210
MsaG016159	MtrunA17_Chr6g0456231	40.134	299	173	4	415	711	289	583	5.27e-57	205
MsaG016159	MtrunA17_Chr3g0081031	33.433	335	217	3	373	706	300	629	5.97e-57	206
MsaG016159	MtrunA17_Chr6g0455321	42.857	294	163	4	412	702	517	808	8.77e-57	208
MsaG016159	MtrunA17_Chr2g0280831	37.884	293	179	3	406	697	72	362	1.00e-56	199
MsaG016159	MtrunA17_Chr0c01g0489481	37.025	316	178	4	409	713	310	615	1.16e-56	204
MsaG016159	MtrunA17_Chr1g0150741	38.558	319	181	8	401	709	55	368	1.57e-56	197
MsaG016159	MtrunA17_Chr4g0060531	37.179	312	181	6	411	710	63	371	1.69e-56	197
MsaG016159	MtrunA17_Chr7g0251771	39.145	304	167	8	412	705	33	328	1.71e-56	197
MsaG016159	MtrunA17_Chr4g0072901	35.880	301	183	3	408	703	20	315	1.81e-56	197
MsaG016159	MtrunA17_Chr2g0291501	39.319	323	165	7	416	728	625	926	2.09e-56	207
MsaG016159	MtrunA17_Chr7g0263591	33.259	448	258	13	297	718	462	894	2.13e-56	207
MsaG016159	MtrunA17_Chr2g0315061	36.486	296	182	3	417	709	24	316	2.18e-56	197
MsaG016159	MtrunA17_Chr7g0236881	50.917	218	103	3	416	631	603	818	2.29e-56	206
MsaG016159	MtrunA17_Chr8g0358911	35.505	307	196	2	406	711	22	327	2.75e-56	197
MsaG016159	MtrunA17_Chr2g0333691	37.024	289	175	4	414	701	109	391	2.94e-56	197
MsaG016159	MtrunA17_Chr7g0219721	40.645	310	178	3	407	711	507	815	2.96e-56	207
MsaG016159	MtrunA17_Chr7g0274651	35.072	345	203	9	358	697	308	636	3.03e-56	204
MsaG016159	MtrunA17_Chr1g0181731	36.086	327	196	6	407	723	577	900	3.28e-56	207
MsaG016159	MtrunA17_Chr7g0219781	41.611	298	171	2	416	711	522	818	3.80e-56	206
MsaG016159	MtrunA17_Chr5g0403891	37.304	319	182	5	418	726	244	554	3.98e-56	202
MsaG016159	MtrunA17_Chr7g0238671	38.636	308	166	7	412	702	55	356	4.17e-56	197
MsaG016159	MtrunA17_Chr3g0111631	36.688	308	172	7	412	702	58	359	4.43e-56	197
MsaG016159	MtrunA17_Chr8g0389251	38.742	302	180	4	405	703	377	676	4.51e-56	203
MsaG016159	MtrunA17_Chr7g0219691	40.645	310	178	3	407	711	507	815	4.81e-56	206
MsaG016159	MtrunA17_Chr1g0200911	36.950	341	194	8	375	709	261	586	4.96e-56	202
MsaG016159	MtrunA17_Chr8g0366971	39.223	283	163	5	418	696	64	341	5.16e-56	196
MsaG016159	MtrunA17_Chr8g0385051	37.000	300	181	5	415	709	258	554	5.24e-56	201
MsaG016159	MtrunA17_Chr8g0362661	36.928	306	180	3	415	709	119	422	5.26e-56	199
MsaG016159	MtrunA17_Chr1g0159611	40.678	295	163	6	416	703	225	514	5.28e-56	201
MsaG016159	MtrunA17_Chr5g0416011	37.584	298	173	3	415	701	121	416	7.79e-56	199
MsaG016159	MtrunA17_Chr2g0327531	39.590	293	168	5	416	702	29	318	8.29e-56	195
MsaG016159	MtrunA17_Chr3g0121971	38.305	295	170	4	412	694	560	854	8.37e-56	206
MsaG016159	MtrunA17_Chr8g0376131	37.329	292	181	2	411	701	33	323	1.10e-55	196
MsaG016159	MtrunA17_Chr7g0236691	38.754	289	169	5	413	697	484	768	1.10e-55	204
MsaG016159	MtrunA17_Chr1g0183041	35.537	363	212	7	370	713	275	634	1.13e-55	203
MsaG016159	MtrunA17_Chr5g0402071	37.500	288	176	4	418	703	155	440	1.25e-55	198
MsaG016159	MtrunA17_Chr3g0136421	38.742	302	164	8	415	702	67	361	1.26e-55	195
MsaG016159	MtrunA17_Chr1g0204461	37.618	319	159	3	415	698	625	938	1.28e-55	206
MsaG016159	MtrunA17_Chr8g0347571	35.294	357	214	8	341	694	493	835	1.29e-55	205
MsaG016159	MtrunA17_Chr2g0278831	39.274	303	175	5	415	711	278	577	1.42e-55	201
MsaG016159	MtrunA17_Chr6g0474901	35.890	365	211	8	347	706	498	844	1.57e-55	204
MsaG016159	MtrunA17_Chr2g0315151	37.162	296	176	5	418	708	654	944	1.68e-55	205
MsaG016159	MtrunA17_Chr3g0137191	38.567	293	176	3	417	708	53	342	2.01e-55	194
MsaG016159	MtrunA17_Chr8g0341361	40.767	287	162	6	418	702	179	459	2.92e-55	197
MsaG016159	MtrunA17_Chr3g0081001	38.462	299	182	2	415	712	329	626	3.18e-55	201
MsaG016159	MtrunA17_Chr8g0340881	34.637	358	222	7	370	723	516	865	3.53e-55	203
MsaG016159	MtrunA17_Chr7g0236551	37.413	286	176	3	413	697	473	756	3.91e-55	202
MsaG016159	MtrunA17_Chr0c03g0490031	37.217	309	184	5	415	719	286	588	3.91e-55	199
MsaG016159	MtrunA17_Chr6g0475131	38.380	284	170	4	426	706	6	287	4.12e-55	192
MsaG016159	MtrunA17_Chr6g0475111	34.262	359	218	5	346	701	516	859	4.74e-55	203
MsaG016159	MtrunA17_Chr7g0236651	36.223	323	190	6	413	723	470	788	4.91e-55	202
MsaG016159	MtrunA17_Chr7g0236471	38.328	287	172	5	413	697	325	608	5.17e-55	200
MsaG016159	MtrunA17_Chr2g0278861	39.482	309	166	6	415	711	274	573	5.26e-55	199
MsaG016159	MtrunA17_Chr3g0088321	36.897	290	172	7	418	703	43	325	5.39e-55	193
MsaG016159	MtrunA17_Chr1g0206351	34.746	354	215	5	355	706	291	630	5.65e-55	200
MsaG016159	MtrunA17_Chr7g0275131	41.077	297	162	6	418	706	61	352	5.84e-55	199
MsaG016159	MtrunA17_Chr6g0483771	42.264	265	143	6	444	704	5	263	6.32e-55	189
MsaG016159	MtrunA17_Chr2g0312571	35.836	293	182	3	415	703	31	321	7.54e-55	195
MsaG016159	MtrunA17_Chr6g0451071	37.413	286	169	6	419	702	56	333	7.87e-55	192
MsaG016159	MtrunA17_Chr1g0161721	39.655	290	163	7	417	697	567	853	8.43e-55	203
MsaG016159	MtrunA17_Chr6g0455651	37.908	306	168	7	418	716	106	396	9.10e-55	194
MsaG016159	MtrunA17_Chr6g0483831	41.887	265	144	6	444	704	5	263	9.12e-55	189
MsaG016159	MtrunA17_Chr4g0064511	41.034	290	166	4	418	704	204	491	9.86e-55	196
MsaG016159	MtrunA17_Chr2g0277731	35.967	367	205	8	358	703	240	597	1.05e-54	199
MsaG016159	MtrunA17_Chr1g0206451	38.732	284	169	4	417	698	360	640	1.18e-54	199
MsaG016159	MtrunA17_Chr8g0348661	38.667	300	168	6	415	704	473	766	1.42e-54	201
MsaG016159	MtrunA17_Chr1g0206361	33.880	366	228	8	344	706	266	620	1.43e-54	199
MsaG016159	MtrunA17_Chr2g0280791	38.112	286	174	3	413	697	505	788	1.48e-54	201
MsaG016159	MtrunA17_Chr5g0428581	36.149	296	183	5	413	706	29	320	1.73e-54	192
MsaG016159	MtrunA17_Chr7g0219671	40.532	301	173	3	407	702	507	806	1.79e-54	201
MsaG016159	MtrunA17_Chr8g0341111	37.013	308	185	6	407	710	459	761	1.86e-54	200
MsaG016159	MtrunA17_Chr4g0031541	36.337	344	182	10	396	719	57	383	1.91e-54	192
MsaG016159	MtrunA17_Chr8g0359691	38.384	297	171	6	418	708	652	942	1.99e-54	202
MsaG016159	MtrunA17_Chr4g0025601	38.816	304	170	6	405	694	599	900	2.10e-54	202
MsaG016159	MtrunA17_Chr8g0358821	35.756	344	197	6	366	703	634	959	2.12e-54	202
MsaG016159	MtrunA17_Chr1g0150011	37.153	288	165	7	416	697	168	445	2.17e-54	194
MsaG016159	MtrunA17_Chr8g0341881	39.394	297	175	4	416	710	391	684	2.50e-54	199
MsaG016159	MtrunA17_Chr2g0281971	34.375	288	182	3	413	697	32	315	2.58e-54	191
MsaG016159	MtrunA17_Chr4g0070411	38.961	308	168	7	415	709	70	370	2.58e-54	195
MsaG016159	MtrunA17_Chr2g0280711	34.656	378	229	6	336	701	431	802	2.74e-54	201
MsaG016159	MtrunA17_Chr5g0399981	35.906	298	180	4	415	702	49	345	2.97e-54	190
MsaG016159	MtrunA17_Chr8g0340071	37.543	293	176	3	413	701	486	775	3.06e-54	200
MsaG016159	MtrunA17_Chr7g0252321	37.975	316	183	7	404	713	49	357	3.09e-54	191
MsaG016159	MtrunA17_Chr4g0031601	39.322	295	166	5	415	697	77	370	3.24e-54	193
MsaG016159	MtrunA17_Chr2g0280801	38.112	286	174	3	413	697	511	794	3.26e-54	200
MsaG016159	MtrunA17_Chr3g0103791	39.146	281	167	3	418	695	116	395	3.28e-54	193
MsaG016159	MtrunA17_Chr1g0160921	36.770	291	184	0	411	701	33	323	3.39e-54	192
MsaG016159	MtrunA17_Chr8g0341101	34.278	388	225	10	351	730	557	922	4.04e-54	201
MsaG016159	MtrunA17_Chr6g0475091	37.346	324	192	7	388	706	542	859	4.14e-54	201
MsaG016159	MtrunA17_Chr1g0181341	37.024	289	171	6	414	697	32	314	4.15e-54	191
MsaG016159	MtrunA17_Chr5g0413071	39.604	303	168	7	412	704	291	588	4.20e-54	196
MsaG016159	MtrunA17_Chr8g0340111	37.801	291	178	2	413	701	488	777	4.39e-54	200
MsaG016159	MtrunA17_Chr7g0219681	36.740	362	210	5	348	702	448	797	4.44e-54	200
MsaG016159	MtrunA17_Chr8g0358781	38.832	291	164	4	418	703	333	614	4.62e-54	198
MsaG016159	MtrunA17_Chr7g0236641	38.676	287	172	4	413	697	509	793	5.05e-54	200
MsaG016159	MtrunA17_Chr8g0354271	33.524	349	211	7	356	701	278	608	7.08e-54	197
MsaG016159	MtrunA17_Chr8g0340091	37.201	293	177	3	413	701	515	804	7.10e-54	199
MsaG016159	MtrunA17_Chr7g0267441	39.189	296	167	7	410	694	572	865	8.55e-54	200
MsaG016159	MtrunA17_Chr7g0236571	38.062	289	167	6	413	697	323	603	8.57e-54	196
MsaG016159	MtrunA17_Chr8g0361161	36.806	288	175	4	415	697	26	311	1.02e-53	189
MsaG016159	MtrunA17_Chr2g0314911	37.333	300	174	6	417	709	649	941	1.14e-53	200
MsaG016159	MtrunA17_Chr8g0336581	35.737	319	193	5	415	722	61	378	1.15e-53	191
MsaG016159	MtrunA17_Chr3g0079661	37.500	312	194	1	415	725	901	1212	1.20e-53	200
MsaG016159	MtrunA17_Chr1g0169841	38.365	318	173	7	418	725	801	1105	1.34e-53	200
MsaG016159	MtrunA17_Chr8g0366931	38.516	283	165	5	416	694	12	289	1.43e-53	188
MsaG016159	MtrunA17_Chr8g0357831	34.184	392	226	8	333	694	68	457	1.49e-53	192
MsaG016159	MtrunA17_Chr8g0360591	37.037	297	171	6	415	703	29	317	1.69e-53	189
MsaG016159	MtrunA17_Chr1g0206461	37.979	287	173	4	417	701	321	604	1.83e-53	196
MsaG016159	MtrunA17_Chr5g0420151	39.003	341	191	8	379	710	472	804	2.51e-53	197
MsaG016159	MtrunA17_Chr4g0023221	32.746	397	248	6	321	701	607	1000	2.52e-53	199
MsaG016159	MtrunA17_Chr6g0484231	37.063	286	175	3	417	701	38	319	2.58e-53	189
MsaG016159	MtrunA17_Chr8g0357651	33.333	387	230	7	338	697	353	738	2.65e-53	197
MsaG016159	MtrunA17_Chr2g0323231	35.932	295	185	3	412	703	159	452	2.72e-53	192
MsaG016159	MtrunA17_Chr8g0354281	33.426	359	225	5	344	701	262	607	2.84e-53	195
MsaG016159	MtrunA17_Chr2g0280781	30.935	417	258	8	301	698	374	779	3.39e-53	197
MsaG016159	MtrunA17_Chr2g0300711	38.961	308	168	7	415	709	64	364	3.69e-53	192
MsaG016159	MtrunA17_Chr5g0437101	38.298	329	179	8	394	702	457	781	4.23e-53	197
MsaG016159	MtrunA17_Chr2g0313911	34.659	352	213	5	356	702	5	344	5.00e-53	187
MsaG016159	MtrunA17_Chr8g0366981	35.311	354	209	8	350	696	227	567	5.71e-53	193
MsaG016159	MtrunA17_Chr5g0443531	36.120	299	180	5	417	709	664	957	6.07e-53	198
MsaG016159	MtrunA17_Chr2g0314991	37.086	302	172	6	417	709	198	490	7.03e-53	198
MsaG016159	MtrunA17_Chr2g0314991	37.000	300	175	5	417	709	1164	1456	1.14e-52	197
MsaG016159	MtrunA17_Chr8g0361251	39.175	291	173	4	415	703	492	780	7.15e-53	196
MsaG016159	MtrunA17_Chr3g0143951	36.364	341	197	8	394	720	46	380	7.24e-53	188
MsaG016159	MtrunA17_Chr1g0206261	34.356	326	201	8	375	698	43	357	7.50e-53	188
MsaG016159	MtrunA17_Chr7g0274661	37.631	287	169	6	416	697	359	640	7.55e-53	194
MsaG016159	MtrunA17_Chr3g0081011	37.458	299	185	2	415	712	325	622	7.64e-53	194
MsaG016159	MtrunA17_Chr2g0330471	39.057	297	172	5	416	708	393	684	7.74e-53	194
MsaG016159	MtrunA17_Chr7g0236201	37.063	286	177	3	413	697	454	737	7.84e-53	196
MsaG016159	MtrunA17_Chr1g0159711	35.762	302	190	4	408	707	333	632	7.95e-53	194
MsaG016159	MtrunA17_Chr2g0315081	37.000	300	175	6	417	709	641	933	8.77e-53	197
MsaG016159	MtrunA17_Chr6g0452761	36.482	307	180	6	415	709	118	421	9.47e-53	190
MsaG016159	MtrunA17_Chr3g0130431	35.738	305	193	3	400	703	316	618	9.70e-53	194
MsaG016159	MtrunA17_Chr8g0354441	33.423	371	225	6	345	706	270	627	1.05e-52	194
MsaG016159	MtrunA17_Chr7g0236121	37.063	286	177	3	413	697	488	771	1.05e-52	196
MsaG016159	MtrunA17_Chr1g0154371	37.124	299	178	8	412	706	340	632	1.06e-52	194
MsaG016159	MtrunA17_Chr2g0299041	35.274	292	181	4	410	697	94	381	1.09e-52	188
MsaG016159	MtrunA17_Chr8g0379931	36.977	311	181	7	398	703	680	980	1.28e-52	197
MsaG016159	MtrunA17_Chr5g0422921	34.181	354	215	7	352	701	431	770	1.38e-52	195
MsaG016159	MtrunA17_Chr1g0206231	33.898	354	217	5	355	706	285	623	1.66e-52	193
MsaG016159	MtrunA17_Chr4g0060011	33.240	358	228	4	349	702	235	585	1.67e-52	192
MsaG016159	MtrunA17_Chr3g0093381	38.312	308	170	7	412	704	90	392	1.69e-52	187
MsaG016159	MtrunA17_Chr1g0151041	38.380	284	170	1	415	698	608	886	1.77e-52	196
MsaG016159	MtrunA17_Chr5g0448661	38.487	304	171	8	412	704	87	385	1.94e-52	187
MsaG016159	MtrunA17_Chr1g0175421	36.306	314	185	7	401	703	102	411	1.96e-52	188
MsaG016159	MtrunA17_Chr4g0023111	32.426	404	243	9	324	702	589	987	2.01e-52	196
MsaG016159	MtrunA17_Chr2g0314901	36.700	297	180	5	417	709	656	948	2.39e-52	196
MsaG016159	MtrunA17_Chr4g0020081	36.482	307	193	2	401	706	483	788	2.69e-52	194
MsaG016159	MtrunA17_Chr4g0047561	36.806	288	175	3	413	697	30	313	3.12e-52	185
MsaG016159	MtrunA17_Chr5g0433941	37.075	294	175	5	416	703	356	645	3.26e-52	192
MsaG016159	MtrunA17_Chr3g0082941	32.240	366	225	5	345	701	94	445	3.32e-52	188
MsaG016159	MtrunA17_Chr2g0312651	37.582	306	173	7	418	712	796	1094	3.55e-52	196
MsaG016159	MtrunA17_Chr1g0158341	36.986	292	169	8	418	703	19	301	3.62e-52	184
MsaG016159	MtrunA17_Chr1g0206521	37.966	295	174	7	417	707	323	612	3.72e-52	196
MsaG016159	MtrunA17_Chr1g0206521	37.966	295	174	7	417	707	965	1254	1.16e-51	194
MsaG016159	MtrunA17_Chr7g0233881	37.231	325	181	8	404	709	635	955	3.79e-52	195
MsaG016159	MtrunA17_Chr1g0206531	36.237	287	179	3	412	697	321	604	3.82e-52	192
MsaG016159	MtrunA17_Chr7g0233841	36.424	302	178	5	413	701	12	312	4.28e-52	183
MsaG016159	MtrunA17_Chr5g0393981	36.644	292	179	6	418	706	385	673	5.19e-52	192
MsaG016159	MtrunA17_Chr2g0328211	38.636	308	170	10	412	704	43	346	5.40e-52	184
MsaG016159	MtrunA17_Chr6g0474871	36.452	310	191	6	400	706	537	843	5.82e-52	194
MsaG016159	MtrunA17_Chr5g0441021	38.636	308	169	7	412	704	52	354	6.34e-52	186
MsaG016159	MtrunA17_Chr8g0354421	32.787	366	224	6	345	701	283	635	6.51e-52	191
MsaG016159	MtrunA17_Chr1g0149711	37.624	303	188	1	406	708	65	366	7.27e-52	185
MsaG016159	MtrunA17_Chr8g0357981	36.149	296	181	5	406	697	282	573	7.33e-52	191
MsaG016159	MtrunA17_Chr6g0474811	36.420	324	195	7	388	706	534	851	8.14e-52	194
MsaG016159	MtrunA17_Chr1g0157931	36.054	294	172	7	418	703	261	546	8.27e-52	190
MsaG016159	MtrunA17_Chr6g0474861	37.282	287	175	5	423	706	280	564	8.47e-52	190
MsaG016159	MtrunA17_Chr4g0049601	32.345	371	234	8	329	697	268	623	8.96e-52	191
MsaG016159	MtrunA17_Chr8g0377951	38.144	291	174	4	409	694	549	838	9.00e-52	194
MsaG016159	MtrunA17_Chr4g0048731	36.332	289	180	4	415	701	32	318	1.24e-51	183
MsaG016159	MtrunA17_Chr8g0360201	38.246	285	171	5	415	697	392	673	1.26e-51	191
MsaG016159	MtrunA17_Chr8g0370571	37.160	331	179	9	396	708	26	345	1.28e-51	183
MsaG016159	MtrunA17_Chr4g0031561	37.658	316	172	9	412	710	75	382	1.44e-51	185
MsaG016159	MtrunA17_Chr2g0318831	31.931	404	246	8	325	703	378	777	1.51e-51	192
MsaG016159	MtrunA17_Chr2g0278871	39.414	307	169	7	415	711	279	578	1.53e-51	189
MsaG016159	MtrunA17_Chr3g0084661	37.457	291	175	5	417	703	20	307	1.61e-51	182
MsaG016159	MtrunA17_Chr6g0475201	35.484	310	194	5	400	706	546	852	1.62e-51	193
MsaG016159	MtrunA17_Chr8g0358161	41.525	236	135	2	415	649	32	265	1.70e-51	182
MsaG016159	MtrunA17_Chr2g0280751	38.062	289	176	3	415	702	512	798	1.72e-51	192
MsaG016159	MtrunA17_Chr5g0394011	33.422	374	237	5	343	707	261	631	1.74e-51	190
MsaG016159	MtrunA17_Chr1g0158751	36.301	292	173	7	418	703	85	369	1.76e-51	185
MsaG016159	MtrunA17_Chr4g0048631	32.615	371	224	8	351	701	440	804	1.87e-51	192
MsaG016159	MtrunA17_Chr1g0154331	35.690	297	187	4	411	706	22	315	2.04e-51	182
MsaG016159	MtrunA17_Chr4g0071371	34.256	289	188	2	410	697	116	403	2.63e-51	185
MsaG016159	MtrunA17_Chr6g0467711	36.552	290	173	7	418	703	391	673	2.66e-51	190
MsaG016159	MtrunA17_Chr7g0215671	38.516	283	160	5	421	698	448	721	2.70e-51	191
MsaG016159	MtrunA17_Chr8g0358081	36.140	285	178	3	415	697	447	729	2.75e-51	191
MsaG016159	MtrunA17_Chr3g0093161	29.730	481	263	10	281	701	304	769	3.17e-51	191
MsaG016159	MtrunA17_Chr5g0407721	31.436	369	205	9	356	703	297	638	3.42e-51	190
MsaG016159	MtrunA17_Chr3g0104881	37.542	301	170	6	418	702	482	780	3.47e-51	191
MsaG016159	MtrunA17_Chr1g0158441	37.113	291	170	8	418	703	19	301	3.67e-51	182
MsaG016159	MtrunA17_Chr6g0467301	32.440	373	232	8	345	713	422	778	3.89e-51	191
MsaG016159	MtrunA17_Chr5g0426941	36.471	340	194	11	374	706	292	616	4.18e-51	189
MsaG016159	MtrunA17_Chr3g0125281	34.899	298	190	4	408	703	386	681	4.27e-51	190
MsaG016159	MtrunA17_Chr4g0018701	38.158	304	159	10	418	703	705	997	5.03e-51	192
MsaG016159	MtrunA17_Chr4g0048661	35.548	301	185	4	407	701	12	309	5.11e-51	181
MsaG016159	MtrunA17_Chr1g0154351	33.429	350	219	4	358	706	298	634	5.23e-51	189
MsaG016159	MtrunA17_Chr4g0063251	36.452	310	171	8	418	709	93	394	5.93e-51	184
MsaG016159	MtrunA17_Chr3g0102451	36.364	286	175	5	416	697	310	592	6.16e-51	188
MsaG016159	MtrunA17_Chr8g0361441	37.762	286	172	3	419	701	496	778	6.71e-51	191
MsaG016159	MtrunA17_Chr1g0157911	31.956	363	213	10	362	702	321	671	6.96e-51	189
MsaG016159	MtrunA17_Chr1g0189791	37.874	301	166	6	418	706	59	350	7.11e-51	187
MsaG016159	MtrunA17_Chr8g0358101	36.491	285	177	3	415	697	450	732	7.32e-51	190
MsaG016159	MtrunA17_Chr8g0361141	36.268	284	178	3	415	697	502	783	7.43e-51	190
MsaG016159	MtrunA17_Chr4g0048581	37.586	290	176	5	415	702	517	803	7.51e-51	191
MsaG016159	MtrunA17_Chr4g0042441	37.075	294	176	6	423	711	493	782	8.01e-51	190
MsaG016159	MtrunA17_Chr8g0366991	33.090	411	217	12	330	697	342	737	8.15e-51	190
MsaG016159	MtrunA17_Chr2g0321921	39.298	285	164	5	417	694	592	874	8.81e-51	191
MsaG016159	MtrunA17_Chr8g0358031	33.666	401	215	10	338	697	357	747	9.04e-51	190
MsaG016159	MtrunA17_Chr4g0048951	37.063	286	166	7	418	701	108	381	9.23e-51	183
MsaG016159	MtrunA17_Chr1g0158411	37.333	300	173	8	410	703	387	677	9.48e-51	189
MsaG016159	MtrunA17_Chr8g0357961	37.153	288	171	5	415	697	470	752	1.01e-50	190
MsaG016159	MtrunA17_Chr8g0361301	37.037	297	183	4	415	709	492	786	1.25e-50	189
MsaG016159	MtrunA17_Chr4g0063701	32.782	363	222	7	346	707	460	801	1.28e-50	189
MsaG016159	MtrunA17_Chr7g0231541	36.897	290	168	6	418	701	433	713	1.36e-50	188
MsaG016159	MtrunA17_Chr8g0358121	36.268	284	179	2	415	697	448	730	1.45e-50	189
MsaG016159	MtrunA17_Chr8g0357991	37.063	286	174	4	415	697	471	753	1.51e-50	189
MsaG016159	MtrunA17_Chr8g0354331	32.537	335	223	3	399	731	70	403	1.63e-50	182
MsaG016159	MtrunA17_Chr4g0042401	37.809	283	167	6	423	701	498	775	1.73e-50	189
MsaG016159	MtrunA17_Chr4g0031571	36.709	316	175	8	412	710	77	384	1.75e-50	182
MsaG016159	MtrunA17_Chr7g0275121	36.786	280	174	2	418	697	234	510	1.80e-50	185
MsaG016159	MtrunA17_Chr8g0340891	35.693	339	208	7	365	702	506	835	1.85e-50	189
MsaG016159	MtrunA17_Chr8g0361261	37.037	297	183	4	415	709	523	817	2.14e-50	189
MsaG016159	MtrunA17_Chr6g0467281	37.500	296	178	6	418	709	477	769	2.22e-50	189
MsaG016159	MtrunA17_Chr4g0030471	36.237	287	173	4	412	697	69	346	2.23e-50	179
MsaG016159	MtrunA17_Chr8g0340931	33.520	358	225	8	370	723	512	860	2.29e-50	189
MsaG016159	MtrunA17_Chr7g0215061	37.413	286	159	5	421	698	520	793	2.33e-50	189
MsaG016159	MtrunA17_Chr8g0358071	36.934	287	173	5	415	697	462	744	2.53e-50	189
MsaG016159	MtrunA17_Chr3g0119041	31.642	335	209	8	370	699	291	610	2.59e-50	186
MsaG016159	MtrunA17_Chr5g0438071	35.333	300	184	5	415	709	645	939	2.60e-50	190
MsaG016159	MtrunA17_Chr1g0157881	35.714	294	173	7	418	703	454	739	2.60e-50	188
MsaG016159	MtrunA17_Chr8g0347661	35.577	312	192	6	416	723	560	866	2.78e-50	189
MsaG016159	MtrunA17_Chr2g0330591	38.112	286	170	5	418	702	564	843	2.93e-50	189
MsaG016159	MtrunA17_Chr1g0194101	36.928	306	175	6	412	702	44	346	3.01e-50	179
MsaG016159	MtrunA17_Chr2g0318811	31.592	402	251	7	325	703	375	775	3.06e-50	188
MsaG016159	MtrunA17_Chr1g0175451	35.938	320	184	9	401	703	302	617	3.76e-50	186
MsaG016159	MtrunA17_Chr3g0129391	38.720	328	167	10	415	720	860	1175	3.81e-50	190
MsaG016159	MtrunA17_Chr3g0084451	38.144	291	173	4	417	703	494	781	4.07e-50	188
MsaG016159	MtrunA17_Chr4g0072221	34.219	301	182	7	414	711	50	337	4.07e-50	180
MsaG016159	MtrunA17_Chr2g0280701	36.242	298	180	6	417	708	488	781	4.32e-50	188
MsaG016159	MtrunA17_Chr4g0042391	34.667	300	192	3	415	711	439	737	4.79e-50	187
MsaG016159	MtrunA17_Chr5g0400681	36.334	311	176	7	400	697	658	959	5.91e-50	189
MsaG016159	MtrunA17_Chr3g0084681	34.615	312	197	4	400	707	435	743	6.05e-50	187
MsaG016159	MtrunA17_Chr8g0345561	38.832	291	174	4	416	704	795	1083	6.41e-50	189
MsaG016159	MtrunA17_Chr4g0049561	36.047	344	194	7	368	697	282	613	7.01e-50	185
MsaG016159	MtrunA17_Chr1g0206391	35.764	288	177	5	418	701	29	312	7.10e-50	179
MsaG016159	MtrunA17_Chr2g0317071	40.000	295	169	5	416	706	780	1070	7.32e-50	189
MsaG016159	MtrunA17_Chr2g0278891	36.000	350	197	8	376	711	249	585	7.72e-50	185
MsaG016159	MtrunA17_Chr4g0020101	35.690	297	176	9	413	704	33	319	7.99e-50	181
MsaG016159	MtrunA17_Chr8g0341151	32.682	358	226	8	370	723	508	854	8.49e-50	187
MsaG016159	MtrunA17_Chr8g0358141	35.690	297	175	5	415	697	52	346	8.81e-50	179
MsaG016159	MtrunA17_Chr8g0341011	35.000	340	206	7	369	702	510	840	8.91e-50	187
MsaG016159	MtrunA17_Chr1g0158571	35.959	292	174	7	418	703	202	486	9.26e-50	182
MsaG016159	MtrunA17_Chr2g0280691	35.862	290	179	4	415	701	512	797	9.35e-50	187
MsaG016159	MtrunA17_Chr8g0367071	35.165	364	211	8	346	697	271	621	9.57e-50	185
MsaG016159	MtrunA17_Chr1g0158541	37.818	275	158	5	436	703	401	669	1.02e-49	186
MsaG016159	MtrunA17_Chr3g0084431	36.897	290	177	4	417	703	482	768	1.04e-49	187
MsaG016159	MtrunA17_Chr8g0357881	36.014	286	177	4	415	697	462	744	1.05e-49	187
MsaG016159	MtrunA17_Chr1g0158091	35.294	289	178	5	418	703	62	344	1.06e-49	178
MsaG016159	MtrunA17_Chr4g0042381	35.395	291	180	4	426	711	450	737	1.09e-49	186
MsaG016159	MtrunA17_Chr5g0446651	35.106	282	178	5	418	697	347	625	1.12e-49	185
MsaG016159	MtrunA17_Chr1g0213501	36.271	295	179	4	418	704	100	393	1.15e-49	179
MsaG016159	MtrunA17_Chr5g0409041	33.159	383	241	5	324	702	203	574	1.21e-49	184
MsaG016159	MtrunA17_Chr5g0428571	38.889	234	141	2	418	650	287	519	1.21e-49	182
MsaG016159	MtrunA17_Chr2g0318171	35.395	291	184	3	418	707	471	758	1.28e-49	186
MsaG016159	MtrunA17_Chr8g0354351	30.890	382	253	5	350	730	263	634	1.47e-49	184
MsaG016159	MtrunA17_Chr8g0357761	36.111	288	182	2	411	697	462	748	1.55e-49	186
MsaG016159	MtrunA17_Chr2g0329871	36.207	290	166	5	415	699	60	335	1.57e-49	177
MsaG016159	MtrunA17_Chr1g0206561	36.364	297	182	6	413	706	314	606	1.58e-49	184
MsaG016159	MtrunA17_Chr7g0232421	34.472	322	183	8	390	703	39	340	1.62e-49	177
MsaG016159	MtrunA17_Chr7g0232131	36.897	290	168	6	418	701	900	1180	1.64e-49	188
MsaG016159	MtrunA17_Chr5g0428111	33.148	359	221	4	352	709	443	783	1.66e-49	186
MsaG016159	MtrunA17_Chr8g0361281	32.493	357	231	4	356	709	445	794	1.69e-49	186
MsaG016159	MtrunA17_Chr4g0042341	36.304	303	186	4	402	701	497	795	1.85e-49	186
MsaG016159	MtrunA17_Chr8g0341081	35.664	286	157	5	418	702	38	297	1.86e-49	176
MsaG016159	MtrunA17_Chr4g0049581	35.889	287	173	6	416	697	337	617	2.03e-49	185
MsaG016159	MtrunA17_Chr1g0202331	35.202	321	192	7	418	731	522	833	2.03e-49	186
MsaG016159	MtrunA17_Chr3g0084691	35.374	294	184	2	411	703	509	797	2.18e-49	186
MsaG016159	MtrunA17_Chr5g0428101	35.452	299	189	3	407	702	477	774	2.35e-49	186
MsaG016159	MtrunA17_Chr4g0042351	35.986	289	181	3	426	711	450	737	2.56e-49	185
MsaG016159	MtrunA17_Chr1g0209471	35.987	314	181	10	400	703	37	340	2.59e-49	177
MsaG016159	MtrunA17_Chr1g0149381	36.332	289	176	4	418	704	492	774	2.68e-49	186
MsaG016159	MtrunA17_Chr4g0069241	36.860	293	174	5	418	702	56	345	2.68e-49	177
MsaG016159	MtrunA17_Chr2g0314611	36.082	291	182	3	418	707	475	762	2.69e-49	185
MsaG016159	MtrunA17_Chr2g0282831	39.310	290	155	7	424	698	652	935	3.02e-49	186
MsaG016159	MtrunA17_Chr2g0319101	35.987	314	180	8	418	724	102	401	3.19e-49	179
MsaG016159	MtrunA17_Chr8g0357631	36.552	290	178	3	411	697	450	736	3.44e-49	185
MsaG016159	MtrunA17_Chr1g0158631	37.226	274	161	6	436	703	389	657	3.45e-49	184
MsaG016159	MtrunA17_Chr1g0160561	31.620	389	242	13	326	702	242	618	4.10e-49	183
MsaG016159	MtrunA17_Chr4g0071481	36.538	312	179	7	412	709	105	411	4.81e-49	178
MsaG016159	MtrunA17_Chr3g0084421	32.161	398	248	6	325	703	342	736	4.86e-49	184
MsaG016159	MtrunA17_Chr8g0340871	35.873	315	192	7	418	728	566	874	5.60e-49	185
MsaG016159	MtrunA17_Chr5g0420171	37.941	340	175	8	379	710	471	782	5.81e-49	184
MsaG016159	MtrunA17_Chr7g0242201	37.377	305	167	7	401	697	22	310	6.64e-49	176
MsaG016159	MtrunA17_Chr1g0206551	34.812	293	183	7	418	706	24	312	6.95e-49	176
MsaG016159	MtrunA17_Chr8g0354431	33.333	336	203	4	375	701	291	614	7.43e-49	182
MsaG016159	MtrunA17_Chr2g0280731	36.301	292	183	3	412	702	533	822	7.78e-49	185
MsaG016159	MtrunA17_Chr1g0154321	37.234	282	174	3	426	706	365	644	7.96e-49	184
MsaG016159	MtrunA17_Chr3g0084441	32.338	402	243	9	325	703	386	781	8.06e-49	184
MsaG016159	MtrunA17_Chr7g0232211	37.943	282	164	5	421	698	796	1070	8.40e-49	186
MsaG016159	MtrunA17_Chr5g0394001	32.768	354	210	10	351	697	266	598	9.52e-49	182
MsaG016159	MtrunA17_Chr5g0419721	29.676	401	234	10	321	704	551	920	9.57e-49	185
MsaG016159	MtrunA17_Chr1g0209511	33.247	385	233	10	327	703	227	595	9.58e-49	182
MsaG016159	MtrunA17_Chr6g0487571	32.337	368	216	7	348	702	505	852	1.01e-48	184
MsaG016159	MtrunA17_Chr6g0484051	33.846	390	221	15	327	703	258	623	1.24e-48	182
MsaG016159	MtrunA17_Chr1g0157811	35.959	292	172	8	418	703	190	472	1.55e-48	179
MsaG016159	MtrunA17_Chr8g0357691	35.417	288	180	3	413	697	462	746	1.56e-48	183
MsaG016159	MtrunA17_Chr8g0358831	33.871	372	203	11	342	702	465	804	1.61e-48	183
MsaG016159	MtrunA17_Chr4g0019041	39.583	288	150	7	425	702	669	942	1.67e-48	184
MsaG016159	MtrunA17_Chr1g0160701	32.031	384	241	11	326	702	247	617	1.68e-48	181
MsaG016159	MtrunA17_Chr2g0323941	38.488	291	171	7	416	701	477	764	1.72e-48	183
MsaG016159	MtrunA17_Chr4g0054521	38.225	293	160	7	418	701	680	960	1.75e-48	184
MsaG016159	MtrunA17_Chr5g0439591	35.962	317	173	10	418	712	59	367	1.85e-48	175
MsaG016159	MtrunA17_Chr5g0423891	37.201	293	169	7	416	702	151	434	1.88e-48	177
MsaG016159	MtrunA17_Chr1g0158761	33.626	342	198	9	369	703	288	607	1.89e-48	181
MsaG016159	MtrunA17_Chr2g0280191	37.015	335	170	11	393	702	645	963	1.98e-48	184
MsaG016159	MtrunA17_Chr7g0218991	37.234	282	163	6	425	701	459	731	2.01e-48	182
MsaG016159	MtrunA17_Chr3g0078521	35.690	297	188	3	415	709	504	799	2.33e-48	183
MsaG016159	MtrunA17_Chr7g0232171	37.241	290	166	7	420	704	807	1085	2.46e-48	184
MsaG016159	MtrunA17_Chr2g0318841	35.374	294	181	4	415	703	487	776	2.48e-48	183
MsaG016159	MtrunA17_Chr3g0091461	39.934	303	153	6	349	634	719	1009	2.51e-48	184
MsaG016159	MtrunA17_Chr3g0084491	36.149	296	182	4	412	703	489	781	2.55e-48	183
MsaG016159	MtrunA17_Chr4g0042361	36.552	290	178	3	415	701	525	811	2.58e-48	183
MsaG016159	MtrunA17_Chr8g0340911	37.063	286	173	6	418	702	557	836	2.83e-48	183
MsaG016159	MtrunA17_Chr5g0394021	35.216	301	189	3	408	707	302	597	3.01e-48	180
MsaG016159	MtrunA17_Chr1g0154311	32.973	370	233	7	338	706	272	627	3.09e-48	181
MsaG016159	MtrunA17_Chr6g0484071	35.962	317	171	12	390	697	35	328	3.48e-48	174
MsaG016159	MtrunA17_Chr2g0289131	34.884	301	179	7	418	710	306	597	4.34e-48	179

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG016159	AT1G21240.1	44.669	741	353	18	3	716	1	711	0.0	593
MsaG016159	AT1G21270.1	45.751	706	342	16	9	706	7	679	0.0	586
MsaG016159	AT1G21230.1	46.770	712	331	23	9	706	6	683	0.0	581
MsaG016159	AT1G21250.1	44.460	731	348	16	12	716	7	705	0.0	575
MsaG016159	AT1G21210.1	42.275	712	369	13	7	706	4	685	0.0	539
MsaG016159	AT1G69730.1	39.329	745	346	18	23	706	24	723	1.03e-158	479
MsaG016159	AT1G79670.1	40.027	737	369	18	7	710	4	700	1.74e-156	472
MsaG016159	AT1G16130.1	40.972	720	329	24	23	704	28	689	3.23e-156	471
MsaG016159	AT1G16160.1	41.457	714	341	20	31	710	41	711	8.04e-155	467
MsaG016159	AT1G16120.1	40.676	740	363	20	9	710	7	708	8.66e-154	464
MsaG016159	AT1G79670.2	39.918	734	337	21	7	710	4	663	2.70e-148	449
MsaG016159	AT1G79680.1	37.992	737	351	18	31	710	26	713	5.67e-147	448
MsaG016159	AT1G16260.1	38.387	719	368	18	1	702	1	661	1.22e-146	446
MsaG016159	AT1G16260.2	38.387	719	368	18	1	702	1	661	1.22e-146	446
MsaG016159	AT1G16150.1	38.731	741	352	23	10	704	13	697	1.68e-145	444
MsaG016159	AT1G16260.3	38.248	719	360	18	1	702	1	652	4.41e-145	441
MsaG016159	AT1G17910.1	36.230	748	379	19	27	710	21	734	2.61e-141	433
MsaG016159	AT1G19390.1	37.203	758	351	19	36	725	38	738	1.34e-140	432
MsaG016159	AT1G16110.1	40.501	679	306	20	8	635	8	639	2.14e-139	424
MsaG016159	AT4G31100.1	38.957	729	358	18	35	715	41	730	3.48e-134	415
MsaG016159	AT4G31110.2	36.884	751	367	19	32	715	7	717	1.52e-132	410
MsaG016159	AT4G31110.1	36.884	751	367	19	32	715	29	739	4.95e-132	410
MsaG016159	AT3G25490.1	59.327	327	132	1	389	715	67	392	9.53e-128	387
MsaG016159	AT1G21240.2	60.900	289	101	2	439	716	163	450	8.62e-116	357
MsaG016159	AT1G21240.2	29.609	179	108	6	3	178	1	164	1.12e-11	68.2
MsaG016159	AT5G02070.1	41.766	419	208	9	315	711	249	653	1.53e-92	302
MsaG016159	AT3G53840.1	48.649	296	145	2	416	704	340	635	1.59e-85	283
MsaG016159	AT2G23450.2	37.705	427	243	8	287	706	215	625	6.90e-79	267
MsaG016159	AT2G23450.1	37.705	427	243	8	287	706	215	625	6.90e-79	267
MsaG016159	AT5G66790.1	35.629	421	255	7	293	708	188	597	5.57e-74	252
MsaG016159	AT1G66880.3	43.987	316	167	6	415	726	333	642	6.18e-71	245
MsaG016159	AT5G54380.1	45.333	300	161	3	416	714	496	793	1.14e-70	248
MsaG016159	AT1G25390.1	37.221	403	229	8	317	709	184	572	1.47e-70	243
MsaG016159	AT1G25390.2	37.221	403	229	8	317	709	184	572	1.47e-70	243
MsaG016159	AT1G18390.2	38.221	416	227	10	307	704	216	619	2.56e-70	243
MsaG016159	AT1G30570.1	43.770	313	169	4	418	725	508	818	1.55e-69	244
MsaG016159	AT1G18390.1	38.071	394	224	9	322	704	229	613	1.62e-69	240
MsaG016159	AT1G66880.2	43.987	316	167	6	415	726	575	884	1.77e-69	245
MsaG016159	AT5G38210.1	44.333	300	155	6	415	710	345	636	1.38e-68	239
MsaG016159	AT1G66880.1	43.987	316	167	6	415	726	954	1263	1.54e-68	245
MsaG016159	AT5G38210.3	44.333	300	155	6	415	710	339	630	2.13e-68	238
MsaG016159	AT5G38210.2	44.333	300	155	6	415	710	357	648	4.29e-68	238
MsaG016159	AT3G46290.1	45.907	281	149	3	423	702	478	756	9.83e-68	239
MsaG016159	AT4G39110.1	45.296	287	155	2	416	702	512	796	1.16e-67	239
MsaG016159	AT5G59700.1	38.058	381	203	8	339	702	389	753	1.20e-67	239
MsaG016159	AT1G61860.1	40.453	309	179	5	401	705	56	363	2.97e-67	227
MsaG016159	AT2G21480.1	44.948	287	156	2	416	702	511	795	4.17e-66	235
MsaG016159	AT3G24540.1	41.883	308	172	4	418	720	171	476	5.82e-66	226
MsaG016159	AT1G79620.1	45.215	303	154	6	407	702	612	909	7.11e-66	236
MsaG016159	AT1G79620.5	45.215	303	154	6	407	702	638	935	9.52e-66	236
MsaG016159	AT3G04690.1	44.444	288	157	3	416	702	503	788	1.18e-65	233
MsaG016159	AT5G56890.1	42.540	315	168	5	414	720	707	1016	1.25e-65	236
MsaG016159	AT5G47850.1	42.395	309	161	4	410	702	423	730	5.64e-65	230
MsaG016159	AT1G24030.2	40.000	295	169	5	417	704	49	342	8.57e-65	219
MsaG016159	AT3G24550.1	40.566	318	174	5	418	726	268	579	9.00e-65	228
MsaG016159	AT1G24030.1	40.000	295	169	5	417	704	63	356	1.13e-64	219
MsaG016159	AT5G28680.1	44.444	288	157	3	416	702	507	792	1.20e-64	231
MsaG016159	AT5G28680.2	44.444	288	157	3	416	702	507	792	1.20e-64	231
MsaG016159	AT1G67720.1	41.925	322	168	7	397	714	584	890	2.85e-64	231
MsaG016159	AT2G39360.1	42.705	281	159	2	423	702	480	759	3.07e-64	229
MsaG016159	AT5G58940.4	41.060	302	172	4	417	714	134	433	6.51e-64	221
MsaG016159	AT5G58940.1	41.060	302	172	4	417	714	134	433	6.51e-64	221
MsaG016159	AT5G58940.3	41.060	302	172	4	417	714	134	433	6.51e-64	221
MsaG016159	AT5G58940.2	41.060	302	172	4	417	714	134	433	6.51e-64	221
MsaG016159	AT5G24010.1	41.176	323	181	7	391	710	452	768	1.17e-63	228
MsaG016159	AT5G61350.1	41.139	316	178	3	416	724	511	825	1.34e-63	228
MsaG016159	AT4G00330.1	41.311	305	170	5	408	704	96	399	1.44e-63	218
MsaG016159	AT4G00330.2	41.311	305	170	5	408	704	96	399	1.44e-63	218
MsaG016159	AT5G49770.1	44.695	311	154	5	416	717	620	921	1.86e-63	228
MsaG016159	AT2G23200.1	47.670	279	141	4	426	702	484	759	2.52e-63	227
MsaG016159	AT1G24030.3	40.569	281	159	5	423	696	1	280	3.59e-63	213
MsaG016159	AT3G59420.1	42.466	292	160	5	416	702	498	786	3.88e-63	227
MsaG016159	AT1G07570.1	40.968	310	160	7	412	704	50	353	4.75e-63	216
MsaG016159	AT1G07570.5	40.968	310	160	7	412	704	50	353	4.75e-63	216
MsaG016159	AT1G07570.2	40.968	310	160	7	412	704	50	353	4.75e-63	216
MsaG016159	AT1G20650.1	38.019	313	187	5	409	718	60	368	5.30e-63	215
MsaG016159	AT3G20530.1	37.025	316	195	3	401	712	53	368	5.42e-63	215
MsaG016159	AT5G01950.2	40.541	296	162	4	415	704	526	813	6.21e-63	226
MsaG016159	AT1G07570.3	40.968	310	160	7	412	704	61	364	7.08e-63	216
MsaG016159	AT3G17420.1	39.721	287	169	4	418	702	142	426	7.25e-63	218
MsaG016159	AT3G58690.1	38.356	365	203	8	349	701	9	363	7.56e-63	216
MsaG016159	AT1G26150.1	38.700	323	182	6	409	722	409	724	1.19e-62	224
MsaG016159	AT1G06840.1	38.728	346	198	5	365	704	560	897	1.80e-62	226
MsaG016159	AT5G01950.3	40.541	296	162	4	415	704	611	898	1.97e-62	226
MsaG016159	AT5G01950.1	40.541	296	162	4	415	704	611	898	1.97e-62	226
MsaG016159	AT5G01950.4	40.541	296	162	4	415	704	611	898	1.97e-62	226
MsaG016159	AT5G01950.8	40.541	296	162	4	415	704	611	898	1.97e-62	226
MsaG016159	AT1G60800.2	40.196	306	179	4	415	717	219	523	2.95e-62	218
MsaG016159	AT5G18500.2	40.210	286	169	2	418	702	154	438	3.41e-62	216
MsaG016159	AT5G18500.5	40.210	286	169	2	418	702	154	438	3.41e-62	216
MsaG016159	AT5G18500.4	40.210	286	169	2	418	702	154	438	3.41e-62	216
MsaG016159	AT5G18500.1	40.210	286	169	2	418	702	154	438	3.41e-62	216
MsaG016159	AT5G18500.3	40.210	286	169	2	418	702	154	438	3.41e-62	216
MsaG016159	AT5G18500.6	40.210	286	169	2	418	702	154	438	3.41e-62	216
MsaG016159	AT1G52290.1	38.125	320	185	5	417	728	130	444	4.15e-62	217
MsaG016159	AT1G76370.1	37.152	323	196	4	387	705	33	352	4.35e-62	213
MsaG016159	AT1G68690.1	38.272	324	185	4	407	722	354	670	8.03e-62	220
MsaG016159	AT1G68690.3	38.272	324	185	4	407	722	354	670	8.03e-62	220
MsaG016159	AT1G68690.2	38.272	324	185	4	407	722	354	670	8.03e-62	220
MsaG016159	AT1G70530.1	34.959	369	221	6	337	703	242	593	1.15e-61	219
MsaG016159	AT1G60800.1	40.196	306	179	4	415	717	286	590	1.23e-61	218
MsaG016159	AT4G02010.1	40.373	322	174	8	409	717	356	672	1.71e-61	220
MsaG016159	AT2G20300.1	39.863	291	171	1	414	704	333	619	2.64e-61	219
MsaG016159	AT2G48010.1	37.363	364	216	4	344	702	202	558	3.52e-61	217
MsaG016159	AT5G01950.7	39.867	301	162	5	415	704	611	903	1.05e-60	221
MsaG016159	AT1G70530.2	39.057	297	169	3	337	633	242	526	1.79e-60	213
MsaG016159	AT3G53590.1	40.446	314	171	5	415	721	606	910	2.41e-60	219
MsaG016159	AT1G68690.4	40.134	299	164	4	407	697	354	645	2.45e-60	215
MsaG016159	AT5G49760.1	43.671	316	173	5	416	729	617	929	2.58e-60	219
MsaG016159	AT5G38560.1	38.835	309	170	7	418	716	327	626	3.21e-60	215
MsaG016159	AT5G40380.1	36.533	375	217	8	327	697	227	584	3.59e-60	214
MsaG016159	AT1G07870.1	37.037	324	196	4	398	718	76	394	4.04e-60	209
MsaG016159	AT1G51850.1	35.396	404	217	11	312	701	454	827	4.32e-60	218
MsaG016159	AT1G09440.1	39.721	287	169	4	418	702	145	429	4.70e-60	210
MsaG016159	AT1G09440.2	39.721	287	169	4	418	702	145	429	4.70e-60	210
MsaG016159	AT2G28930.1	38.730	315	170	7	412	709	62	370	4.85e-60	209
MsaG016159	AT1G51850.2	35.396	404	217	11	312	701	474	847	5.02e-60	218
MsaG016159	AT3G21340.1	35.308	422	244	11	312	727	486	884	5.52e-60	218
MsaG016159	AT2G28930.2	38.730	315	170	7	412	709	51	359	5.63e-60	208
MsaG016159	AT2G28930.3	38.730	315	170	7	412	709	54	362	7.77e-60	208
MsaG016159	AT5G40380.2	40.391	307	168	5	327	633	227	518	1.23e-59	211
MsaG016159	AT3G25560.1	35.437	412	234	11	314	711	198	591	1.68e-59	213
MsaG016159	AT3G25560.2	35.437	412	234	11	314	711	199	592	1.76e-59	213
MsaG016159	AT1G56130.3	35.075	402	225	10	309	703	393	765	1.80e-59	216
MsaG016159	AT3G25560.3	35.437	412	234	11	314	711	198	591	1.90e-59	213
MsaG016159	AT1G70460.1	39.604	303	163	6	410	702	335	627	3.28e-59	213
MsaG016159	AT1G56130.1	35.075	402	225	10	309	703	444	816	3.45e-59	216
MsaG016159	AT3G51550.1	43.554	287	158	4	418	702	524	808	3.73e-59	216
MsaG016159	AT3G28690.1	37.855	317	168	8	412	709	8	314	3.88e-59	205
MsaG016159	AT3G24790.2	39.100	289	173	3	416	701	51	339	4.53e-59	205
MsaG016159	AT1G56720.3	39.373	287	170	4	418	702	167	451	5.24e-59	207
MsaG016159	AT1G56720.1	39.373	287	170	4	418	702	167	451	5.24e-59	207
MsaG016159	AT1G56720.2	39.373	287	170	4	418	702	167	451	5.24e-59	207
MsaG016159	AT1G56720.4	39.373	287	170	4	418	702	167	451	5.24e-59	207
MsaG016159	AT4G05200.1	36.901	355	206	6	355	706	284	623	5.40e-59	212
MsaG016159	AT1G56130.2	35.075	402	225	10	309	703	592	964	5.55e-59	216
MsaG016159	AT3G24790.1	39.100	289	173	3	416	701	33	321	5.60e-59	204
MsaG016159	AT2G42960.3	38.676	287	172	4	418	702	171	455	5.76e-59	207
MsaG016159	AT2G42960.5	38.676	287	172	4	418	702	171	455	5.76e-59	207
MsaG016159	AT2G42960.4	38.676	287	172	4	418	702	171	455	5.76e-59	207
MsaG016159	AT2G42960.1	38.676	287	172	4	418	702	171	455	5.76e-59	207
MsaG016159	AT1G24650.1	42.049	283	159	4	417	694	534	816	5.91e-59	215
MsaG016159	AT2G18470.1	40.256	313	169	6	418	720	272	576	6.87e-59	211
MsaG016159	AT2G18470.3	40.256	313	169	6	418	720	272	576	6.87e-59	211
MsaG016159	AT2G18470.2	40.256	313	169	6	418	720	272	576	6.87e-59	211
MsaG016159	AT1G61490.3	31.197	468	289	11	243	699	165	610	8.26e-59	211
MsaG016159	AT4G05200.2	36.901	355	206	6	355	706	302	641	8.68e-59	212
MsaG016159	AT1G07870.2	37.654	324	194	5	398	718	76	394	1.06e-58	208
MsaG016159	AT5G02290.2	37.179	312	173	7	415	709	53	358	1.13e-58	204
MsaG016159	AT5G02290.1	37.179	312	173	7	415	709	53	358	1.13e-58	204
MsaG016159	AT5G10290.1	39.088	307	178	5	415	715	275	578	1.26e-58	209
MsaG016159	AT5G10290.2	39.088	307	178	5	415	715	275	578	1.26e-58	209
MsaG016159	AT1G69790.1	37.888	322	180	7	412	721	66	379	1.40e-58	204
MsaG016159	AT1G69790.2	37.888	322	180	7	412	721	55	368	1.56e-58	203
MsaG016159	AT5G45780.2	34.316	373	218	9	338	704	181	532	1.63e-58	208
MsaG016159	AT5G38990.1	40.940	298	166	5	412	702	507	801	1.78e-58	213
MsaG016159	AT1G24030.4	44.351	239	125	5	417	649	49	285	1.86e-58	200
MsaG016159	AT3G28690.3	37.855	317	168	8	412	709	57	363	1.89e-58	204
MsaG016159	AT1G61370.2	33.884	363	217	7	343	697	270	617	2.20e-58	210
MsaG016159	AT2G17220.2	39.385	325	182	7	415	726	71	393	2.21e-58	204
MsaG016159	AT2G17220.1	39.385	325	182	7	415	726	72	394	2.22e-58	204
MsaG016159	AT1G26150.2	45.902	244	127	4	409	651	409	648	2.69e-58	209
MsaG016159	AT1G61490.6	31.197	468	289	11	243	699	289	734	3.05e-58	211
MsaG016159	AT1G61490.7	31.197	468	289	11	243	699	289	734	3.05e-58	211
MsaG016159	AT5G62230.2	39.437	284	167	1	415	698	585	863	3.26e-58	213
MsaG016159	AT1G69910.1	37.003	327	177	6	405	704	298	622	3.69e-58	209
MsaG016159	AT2G28970.2	38.532	327	179	8	406	720	420	736	4.24e-58	211
MsaG016159	AT1G61490.4	31.197	468	289	11	243	699	315	760	4.31e-58	211
MsaG016159	AT1G61490.1	31.197	468	289	11	243	699	315	760	4.31e-58	211
MsaG016159	AT1G61490.2	31.197	468	289	11	243	699	315	760	4.31e-58	211
MsaG016159	AT1G61490.5	31.197	468	289	11	243	699	315	760	4.31e-58	211
MsaG016159	AT1G51830.1	35.696	395	225	10	312	701	285	655	4.38e-58	209
MsaG016159	AT1G51830.2	35.696	395	225	10	312	701	292	662	4.53e-58	210
MsaG016159	AT5G45780.1	34.316	373	218	9	338	704	224	575	4.64e-58	208
MsaG016159	AT5G62230.1	39.437	284	167	1	415	698	633	911	4.64e-58	213
MsaG016159	AT2G28970.1	38.532	327	179	8	406	720	455	771	4.71e-58	211
MsaG016159	AT3G28690.2	37.855	317	168	8	412	709	108	414	4.81e-58	204
MsaG016159	AT5G37450.4	34.626	361	206	8	359	704	354	699	5.38e-58	211
MsaG016159	AT5G07180.2	35.734	361	219	4	338	698	471	818	5.91e-58	212
MsaG016159	AT2G28590.1	39.590	293	174	3	416	705	84	376	5.98e-58	203
MsaG016159	AT1G56120.3	41.638	293	154	5	418	703	532	814	6.20e-58	212
MsaG016159	AT5G02800.1	38.754	289	174	3	416	701	59	347	6.69e-58	201
MsaG016159	AT5G56460.1	36.420	324	183	7	402	709	48	364	7.47e-58	202
MsaG016159	AT1G53420.1	35.714	364	218	6	356	708	544	902	9.49e-58	212
MsaG016159	AT5G07180.1	35.734	361	219	4	338	698	567	914	9.50e-58	212
MsaG016159	AT1G56140.1	41.980	293	153	5	418	703	681	963	1.04e-57	213
MsaG016159	AT5G39000.1	40.816	294	164	5	416	702	504	794	1.08e-57	211
MsaG016159	AT5G01020.1	40.000	300	160	8	418	704	57	349	1.10e-57	202
MsaG016159	AT3G07070.1	39.661	295	173	4	416	705	65	359	1.21e-57	202
MsaG016159	AT1G61590.1	39.527	296	167	6	418	704	87	379	1.24e-57	202
MsaG016159	AT2G11520.1	40.690	290	167	4	418	704	213	500	1.24e-57	204
MsaG016159	AT3G26940.1	39.404	302	173	6	404	697	48	347	1.25e-57	202
MsaG016159	AT4G02630.1	35.443	316	198	5	418	730	150	462	1.38e-57	204
MsaG016159	AT2G19230.2	37.602	367	194	10	342	702	502	839	1.66e-57	211
MsaG016159	AT1G01540.2	36.120	299	187	4	416	712	140	436	1.68e-57	203
MsaG016159	AT1G56120.2	41.638	293	154	5	418	703	680	962	1.90e-57	212
MsaG016159	AT3G02810.1	38.079	302	182	3	414	710	48	349	1.93e-57	205
MsaG016159	AT1G61370.1	33.884	363	217	7	343	697	421	768	1.99e-57	209
MsaG016159	AT5G13160.1	37.975	316	183	6	394	701	50	360	2.07e-57	202
MsaG016159	AT1G56120.1	41.608	286	164	2	418	703	698	980	2.25e-57	211
MsaG016159	AT1G23540.1	39.394	297	172	4	410	702	353	645	2.60e-57	208
MsaG016159	AT1G70450.1	37.919	298	176	5	410	702	31	324	2.61e-57	200
MsaG016159	AT2G28940.2	38.415	328	183	6	415	724	87	413	2.94e-57	202
MsaG016159	AT2G23950.1	34.688	369	225	5	343	709	222	576	3.54e-57	206
MsaG016159	AT3G19300.1	37.884	293	171	5	408	697	306	590	3.65e-57	206
MsaG016159	AT5G18610.1	39.792	289	171	3	416	701	69	357	4.48e-57	203
MsaG016159	AT5G18610.2	39.792	289	171	3	416	701	69	357	4.48e-57	203
MsaG016159	AT5G18610.3	39.792	289	171	3	416	701	69	357	4.48e-57	203
MsaG016159	AT1G34210.1	39.203	301	174	5	415	709	290	587	5.15e-57	205
MsaG016159	AT1G34210.2	39.203	301	174	5	415	709	290	587	5.15e-57	205
MsaG016159	AT5G37450.1	34.626	361	206	8	359	704	533	878	5.33e-57	210
MsaG016159	AT2G37050.3	38.776	294	176	3	418	709	594	885	6.53e-57	209
MsaG016159	AT2G37050.1	38.776	294	176	3	418	709	593	884	6.93e-57	209
MsaG016159	AT1G10620.1	39.446	289	169	3	418	702	358	644	7.15e-57	207
MsaG016159	AT3G59110.1	37.299	311	189	5	418	724	178	486	7.62e-57	202
MsaG016159	AT5G37450.3	34.626	361	206	8	359	704	557	902	9.38e-57	209
MsaG016159	AT2G19230.1	37.057	367	197	9	342	702	502	840	1.03e-56	209
MsaG016159	AT5G37450.2	34.626	361	206	8	359	704	581	926	1.03e-56	209
MsaG016159	AT5G48740.1	41.980	293	156	7	416	702	594	878	1.07e-56	208
MsaG016159	AT1G29720.1	40.625	288	165	4	418	703	661	944	1.57e-56	209
MsaG016159	AT2G01820.1	39.597	298	171	5	417	706	572	868	1.72e-56	208
MsaG016159	AT4G34440.2	39.865	296	159	5	418	703	300	586	1.73e-56	205
MsaG016159	AT4G34440.1	39.865	296	159	5	418	703	300	586	1.73e-56	205
MsaG016159	AT1G61500.2	33.871	372	228	6	335	699	383	743	1.76e-56	206
MsaG016159	AT2G28960.1	39.865	296	168	5	416	708	429	717	1.95e-56	206
MsaG016159	AT3G20530.2	40.625	256	144	4	401	652	53	304	2.02e-56	195
MsaG016159	AT1G61500.1	33.871	372	228	6	335	699	401	761	2.08e-56	207
MsaG016159	AT1G61500.3	33.871	372	228	6	335	699	406	766	2.16e-56	207
MsaG016159	AT1G61480.1	35.772	369	210	9	343	699	413	766	2.23e-56	206
MsaG016159	AT3G55450.1	38.689	305	171	8	411	701	42	344	2.25e-56	197
MsaG016159	AT5G49780.1	41.325	317	173	5	416	730	520	825	2.75e-56	207
MsaG016159	AT2G02800.1	37.267	322	187	6	411	720	64	382	2.78e-56	198
MsaG016159	AT2G02800.2	37.267	322	187	6	411	720	64	382	2.78e-56	198
MsaG016159	AT1G61360.2	35.795	352	204	5	355	697	348	686	2.90e-56	205
MsaG016159	AT1G61360.3	35.795	352	204	5	355	697	348	686	2.90e-56	205
MsaG016159	AT1G61360.4	35.795	352	204	5	355	697	348	686	2.90e-56	205
MsaG016159	AT5G49780.3	36.830	429	227	12	331	730	511	924	3.21e-56	207
MsaG016159	AT2G26290.1	36.859	312	185	6	406	708	64	372	3.30e-56	198
MsaG016159	AT3G55450.2	38.689	305	171	8	411	701	79	381	3.43e-56	198
MsaG016159	AT5G15080.1	37.224	317	170	8	412	709	124	430	3.50e-56	200
MsaG016159	AT4G23240.2	39.298	285	164	6	418	697	16	296	3.65e-56	196
MsaG016159	AT3G18810.1	37.333	300	173	4	418	709	325	617	3.93e-56	204
MsaG016159	AT5G65240.1	38.762	307	179	5	415	715	269	572	5.19e-56	202
MsaG016159	AT4G33430.1	39.274	303	175	5	415	711	274	573	5.39e-56	202
MsaG016159	AT2G28960.2	39.465	299	171	5	416	711	561	852	5.41e-56	206
MsaG016159	AT1G52290.2	42.735	234	133	1	417	650	130	362	5.96e-56	196
MsaG016159	AT4G01330.3	36.552	290	180	4	416	703	148	435	6.34e-56	198
MsaG016159	AT5G16000.1	34.826	402	229	10	326	711	209	593	6.92e-56	202
MsaG016159	AT1G61360.1	35.795	352	204	5	355	697	429	767	7.10e-56	205
MsaG016159	AT5G49780.2	41.325	317	173	5	416	730	641	946	7.32e-56	207
MsaG016159	AT2G07180.1	40.264	303	161	8	413	702	73	368	7.67e-56	197
MsaG016159	AT2G07180.2	40.264	303	161	8	413	702	73	368	7.67e-56	197
MsaG016159	AT2G39660.1	37.864	309	169	7	411	702	48	350	7.68e-56	196
MsaG016159	AT4G33430.2	39.274	303	175	5	415	711	321	620	8.60e-56	202
MsaG016159	AT4G01330.1	35.786	299	188	4	416	712	148	444	9.33e-56	198
MsaG016159	AT5G65240.2	38.762	307	179	5	415	715	269	572	9.33e-56	202
MsaG016159	AT2G26330.1	38.983	295	175	1	415	709	633	922	1.04e-55	206
MsaG016159	AT4G00970.1	31.714	391	245	8	324	705	245	622	1.15e-55	202
MsaG016159	AT2G28990.2	40.418	287	163	5	418	702	567	847	1.22e-55	205
MsaG016159	AT2G28990.1	40.418	287	163	5	418	702	567	847	1.22e-55	205
MsaG016159	AT1G66150.1	40.278	288	158	5	417	694	575	858	1.44e-55	206
MsaG016159	AT1G49730.1	38.567	293	166	8	411	697	340	624	1.46e-55	202
MsaG016159	AT4G01330.2	36.552	290	180	4	416	703	148	435	1.53e-55	198
MsaG016159	AT2G13790.1	37.101	345	192	9	375	711	251	578	1.58e-55	201
MsaG016159	AT4G32710.1	39.748	317	171	7	417	719	376	686	1.70e-55	203
MsaG016159	AT2G04300.1	40.830	289	161	5	416	701	529	810	1.86e-55	204
MsaG016159	AT5G03320.2	37.908	306	175	5	415	709	66	367	1.89e-55	196
MsaG016159	AT5G03320.1	37.908	306	175	5	415	709	66	367	1.89e-55	196
MsaG016159	AT1G11410.2	33.687	377	228	7	335	701	314	678	1.92e-55	203
MsaG016159	AT1G11280.2	34.104	346	217	4	357	697	435	774	2.01e-55	204
MsaG016159	AT4G30520.1	36.517	356	209	7	357	709	239	580	2.09e-55	201
MsaG016159	AT2G04300.2	40.830	289	161	5	416	701	570	851	2.49e-55	204
MsaG016159	AT1G11280.1	34.104	346	217	4	357	697	445	784	2.59e-55	204
MsaG016159	AT3G01300.1	39.073	302	155	8	415	697	121	412	2.72e-55	197
MsaG016159	AT4G04570.1	41.404	285	156	7	426	707	344	620	3.40e-55	201
MsaG016159	AT1G51805.2	36.096	374	204	10	342	701	470	822	3.42e-55	204
MsaG016159	AT1G51800.1	38.843	363	204	9	357	713	516	866	3.63e-55	204
MsaG016159	AT5G56790.1	40.203	296	168	4	416	707	376	666	3.89e-55	201
MsaG016159	AT3G09830.2	38.983	295	166	6	415	697	69	361	4.33e-55	195
MsaG016159	AT3G09830.3	38.983	295	166	6	415	697	69	361	4.33e-55	195
MsaG016159	AT3G09830.1	38.983	295	166	6	415	697	69	361	4.33e-55	195
MsaG016159	AT1G51805.1	36.096	374	204	10	342	701	494	846	4.40e-55	204
MsaG016159	AT1G11410.3	33.687	377	228	7	335	701	405	769	4.41e-55	203
MsaG016159	AT3G46420.1	41.935	279	156	4	425	702	528	801	4.76e-55	203
MsaG016159	AT1G11410.1	33.687	377	228	7	335	701	429	793	5.15e-55	203
MsaG016159	AT5G11020.3	34.078	358	213	7	356	701	3	349	5.32e-55	193
MsaG016159	AT5G59670.2	40.278	288	166	4	411	697	547	829	5.39e-55	203
MsaG016159	AT5G59670.1	40.278	288	166	4	411	697	547	829	5.39e-55	203
MsaG016159	AT1G11410.4	33.687	377	228	7	335	701	436	800	5.52e-55	203
MsaG016159	AT1G51810.1	41.034	290	161	5	416	702	438	720	5.80e-55	202
MsaG016159	AT1G71830.1	38.538	301	176	5	415	709	287	584	6.68e-55	199
MsaG016159	AT4G29990.1	36.631	374	213	11	335	702	488	843	6.73e-55	203
MsaG016159	AT5G62710.2	37.368	380	193	12	344	702	194	549	7.11e-55	198
MsaG016159	AT1G51820.2	35.127	353	211	7	356	701	244	585	8.78e-55	199
MsaG016159	AT2G28590.2	45.188	239	124	4	416	651	84	318	8.99e-55	191
MsaG016159	AT2G30740.5	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.2	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.10	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.11	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.6	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.15	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.4	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.14	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.7	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.1	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.13	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.8	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.12	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.3	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT2G30740.9	36.306	314	187	5	403	704	40	352	9.06e-55	192
MsaG016159	AT1G78530.1	35.657	373	198	10	350	706	3	349	9.11e-55	192
MsaG016159	AT2G25220.5	34.341	364	224	4	356	708	15	374	9.45e-55	193
MsaG016159	AT3G23750.1	39.286	280	165	3	420	694	568	847	9.46e-55	203
MsaG016159	AT1G67520.5	34.915	295	190	2	411	703	240	534	9.48e-55	198
MsaG016159	AT1G61420.3	32.967	364	220	7	343	697	263	611	9.68e-55	199
MsaG016159	AT1G70520.1	36.562	320	193	4	418	729	313	630	1.01e-54	199
MsaG016159	AT1G67520.8	34.915	295	190	2	411	703	269	563	1.06e-54	199
MsaG016159	AT1G67520.7	34.915	295	190	2	411	703	269	563	1.06e-54	199
MsaG016159	AT3G16030.2	35.395	291	186	2	415	703	389	679	1.11e-54	201
MsaG016159	AT4G34500.1	36.333	300	182	6	410	702	122	419	1.17e-54	194
MsaG016159	AT5G62710.1	37.368	380	193	12	344	702	228	583	1.30e-54	198
MsaG016159	AT5G11020.2	34.078	358	213	7	356	701	30	376	1.59e-54	193
MsaG016159	AT1G61420.5	37.631	287	171	5	415	697	331	613	1.69e-54	199
MsaG016159	AT5G11020.4	34.078	358	213	7	356	701	26	372	1.73e-54	192
MsaG016159	AT2G25220.1	34.341	364	224	4	356	708	64	423	1.78e-54	194
MsaG016159	AT1G49270.1	45.532	235	121	3	418	651	324	552	2.03e-54	199
MsaG016159	AT3G46370.2	41.438	292	157	5	416	702	475	757	2.10e-54	201
MsaG016159	AT3G46370.1	41.438	292	157	5	416	702	475	757	2.10e-54	201
MsaG016159	AT1G11280.3	34.402	343	208	5	357	697	435	762	2.17e-54	201
MsaG016159	AT1G34300.1	32.668	401	248	9	311	708	382	763	2.19e-54	201
MsaG016159	AT1G11280.4	34.402	343	208	5	357	697	445	772	2.65e-54	201
MsaG016159	AT2G18470.4	46.383	235	116	4	418	650	272	498	2.82e-54	196
MsaG016159	AT4G23240.1	39.298	285	164	6	418	697	323	603	2.95e-54	198
MsaG016159	AT5G11020.1	34.078	358	213	7	356	701	64	410	3.29e-54	193
MsaG016159	AT3G16030.1	35.395	291	186	2	415	703	512	802	3.32e-54	201
MsaG016159	AT1G29730.1	36.422	313	191	3	401	709	611	919	3.34e-54	202
MsaG016159	AT1G56145.3	36.913	298	176	6	418	710	572	862	3.44e-54	201
MsaG016159	AT1G07650.4	37.000	300	174	6	418	709	453	745	3.54e-54	200
MsaG016159	AT1G55200.3	38.562	306	177	5	416	716	365	664	3.56e-54	198
MsaG016159	AT1G55200.4	38.562	306	177	5	416	716	365	664	3.56e-54	198
MsaG016159	AT1G55200.1	38.562	306	177	5	416	716	365	664	3.56e-54	198
MsaG016159	AT1G55200.2	38.562	306	177	5	416	716	365	664	3.56e-54	198
MsaG016159	AT1G51890.5	34.152	407	238	11	309	701	176	566	3.79e-54	197
MsaG016159	AT1G61440.3	30.958	407	259	7	300	697	357	750	3.86e-54	200
MsaG016159	AT4G04490.1	41.577	279	152	7	426	701	336	606	3.88e-54	198
MsaG016159	AT1G76360.1	37.898	314	172	7	412	709	145	451	4.04e-54	194
MsaG016159	AT1G61400.1	31.204	407	258	7	300	697	374	767	4.08e-54	200
MsaG016159	AT3G46330.2	39.103	312	177	5	416	719	530	836	4.31e-54	201
MsaG016159	AT3G16030.6	35.395	291	186	2	415	703	533	823	4.86e-54	201
MsaG016159	AT1G56145.1	36.913	298	176	6	418	710	675	965	5.05e-54	201
MsaG016159	AT2G39110.2	40.328	305	169	5	412	704	57	360	5.53e-54	192
MsaG016159	AT5G35580.1	39.799	299	168	6	415	704	61	356	6.10e-54	194
MsaG016159	AT2G39110.1	40.328	305	169	5	412	704	72	375	6.30e-54	192
MsaG016159	AT3G46330.1	39.103	312	177	5	416	719	554	860	6.60e-54	200
MsaG016159	AT1G61420.1	32.967	364	220	7	343	697	413	761	6.73e-54	199
MsaG016159	AT3G46400.1	40.210	286	165	4	418	702	566	846	6.77e-54	200
MsaG016159	AT1G65800.1	33.241	361	223	6	357	701	440	798	7.78e-54	200
MsaG016159	AT1G61420.2	37.631	287	171	5	415	697	481	763	8.06e-54	199
MsaG016159	AT1G61420.4	37.631	287	171	5	415	697	481	763	8.06e-54	199
MsaG016159	AT5G35580.2	39.799	299	168	6	415	704	73	368	8.29e-54	194
MsaG016159	AT4G23270.3	40.767	287	165	5	418	701	314	598	8.52e-54	197
MsaG016159	AT1G54820.1	40.777	309	155	9	412	701	129	428	8.69e-54	192
MsaG016159	AT1G11340.1	36.806	288	179	2	415	701	500	785	1.01e-53	199
MsaG016159	AT1G77280.2	36.949	295	182	4	412	703	386	679	1.03e-53	198
MsaG016159	AT1G77280.1	36.949	295	182	4	412	703	386	679	1.03e-53	198
MsaG016159	AT4G23270.2	40.767	287	165	5	418	701	314	598	1.07e-53	196
MsaG016159	AT4G23270.1	40.767	287	165	5	418	701	314	598	1.07e-53	196
MsaG016159	AT4G27290.2	33.051	354	223	3	349	698	437	780	1.14e-53	199
MsaG016159	AT4G04540.4	42.294	279	150	7	426	701	320	590	1.17e-53	196
MsaG016159	AT4G20450.1	40.278	288	166	4	416	702	579	861	1.19e-53	199
MsaG016159	AT1G67520.4	34.915	295	190	2	411	703	434	728	1.31e-53	198
MsaG016159	AT3G57750.2	34.862	327	202	5	387	704	6	330	1.44e-53	188
MsaG016159	AT3G57750.1	34.862	327	202	5	387	704	6	330	1.44e-53	188
MsaG016159	AT1G07650.3	37.000	300	174	6	418	709	640	932	1.56e-53	200
MsaG016159	AT1G51820.1	35.127	353	211	7	356	701	506	847	1.58e-53	199
MsaG016159	AT5G55830.1	32.584	356	218	7	347	697	297	635	1.70e-53	196
MsaG016159	AT4G04540.1	38.109	349	192	11	357	701	291	619	1.76e-53	196
MsaG016159	AT1G07650.2	37.000	300	174	6	418	709	672	964	1.82e-53	200
MsaG016159	AT1G07650.1	37.000	300	174	6	418	709	666	958	1.98e-53	200
MsaG016159	AT1G67520.3	34.915	295	190	2	411	703	477	771	1.99e-53	198
MsaG016159	AT5G03140.1	38.000	300	172	7	418	709	362	655	2.01e-53	197
MsaG016159	AT1G67520.6	34.915	295	190	2	411	703	484	778	2.15e-53	198
MsaG016159	AT4G23220.1	36.013	311	190	5	398	701	300	608	2.51e-53	196
MsaG016159	AT1G49100.1	38.291	316	180	6	416	723	569	877	2.53e-53	199
MsaG016159	AT4G13190.1	37.255	306	189	3	416	718	57	362	2.54e-53	189
MsaG016159	AT4G23130.2	40.068	292	170	5	418	706	332	621	2.65e-53	196
MsaG016159	AT4G23130.1	40.068	292	170	5	418	706	328	617	2.70e-53	196
MsaG016159	AT1G61430.11	30.657	411	257	8	299	697	339	733	2.91e-53	197
MsaG016159	AT1G61430.12	30.657	411	257	8	299	697	339	733	2.91e-53	197
MsaG016159	AT1G61430.13	30.657	411	257	8	299	697	339	733	2.91e-53	197
MsaG016159	AT1G14370.1	37.942	311	178	6	411	709	67	374	2.93e-53	190
MsaG016159	AT4G23200.1	35.077	325	208	3	385	707	291	614	3.16e-53	195
MsaG016159	AT1G51890.4	34.152	407	238	11	309	701	384	774	3.25e-53	197
MsaG016159	AT1G70740.1	36.364	308	191	4	393	699	27	330	3.76e-53	190
MsaG016159	AT4G04570.3	46.190	210	110	3	426	633	180	388	3.90e-53	189
MsaG016159	AT1G11050.1	35.849	371	206	8	352	703	224	581	4.08e-53	194
MsaG016159	AT1G61430.9	30.657	411	257	8	299	697	362	756	4.31e-53	197
MsaG016159	AT1G11300.2	38.488	291	166	4	410	697	474	754	4.43e-53	197
MsaG016159	AT2G05940.1	38.356	292	168	6	415	697	72	360	4.71e-53	191
MsaG016159	AT3G09010.1	34.694	294	175	6	412	697	28	312	5.02e-53	189
MsaG016159	AT1G11300.1	35.673	342	200	7	366	697	438	769	5.05e-53	197
MsaG016159	AT4G35600.2	36.697	327	183	7	412	722	69	387	5.42e-53	189
MsaG016159	AT1G01540.1	38.710	248	138	5	416	650	140	386	5.43e-53	188
MsaG016159	AT4G35600.1	36.697	327	183	7	412	722	68	386	5.67e-53	189
MsaG016159	AT1G26970.1	36.420	324	176	9	411	718	64	373	6.50e-53	189
MsaG016159	AT1G51890.1	34.152	407	238	11	309	701	448	838	6.60e-53	197
MsaG016159	AT4G11490.1	36.082	291	183	3	418	706	309	598	7.07e-53	194
MsaG016159	AT1G61440.1	31.204	407	253	8	300	697	357	745	7.59e-53	196
MsaG016159	AT4G27290.1	36.268	284	180	1	415	697	450	733	9.19e-53	196
MsaG016159	AT5G63710.2	36.333	300	183	5	415	709	239	535	9.82e-53	192
MsaG016159	AT5G63710.4	36.333	300	183	5	415	709	239	535	9.82e-53	192
MsaG016159	AT4G23180.1	38.811	286	171	4	423	706	341	624	9.83e-53	194
MsaG016159	AT5G63710.3	36.333	300	183	5	415	709	275	571	1.14e-52	193
MsaG016159	AT1G29730.2	37.500	296	176	4	418	709	661	951	1.22e-52	197
MsaG016159	AT2G25220.2	37.627	295	181	2	415	708	136	428	1.22e-52	189
MsaG016159	AT5G63710.1	36.333	300	183	5	415	709	274	570	1.25e-52	193
MsaG016159	AT1G24030.6	40.833	240	137	4	469	704	13	251	1.34e-52	183
MsaG016159	AT3G55950.1	38.750	320	170	6	406	702	475	791	1.38e-52	196
MsaG016159	AT1G72300.1	37.864	309	189	3	405	712	778	1084	1.43e-52	197
MsaG016159	AT2G02220.1	40.550	291	169	4	416	704	720	1008	1.57e-52	197
MsaG016159	AT1G52540.1	34.884	301	189	4	414	713	24	318	1.82e-52	186
MsaG016159	AT3G13690.2	38.514	296	179	3	416	710	397	690	1.91e-52	194
MsaG016159	AT3G13690.1	38.514	296	179	3	416	710	397	690	1.91e-52	194
MsaG016159	AT3G13690.3	38.514	296	179	3	416	710	397	690	1.91e-52	194
MsaG016159	AT5G63930.2	38.908	293	164	7	418	701	728	1014	1.95e-52	197
MsaG016159	AT1G51860.2	36.559	372	213	10	347	708	357	715	2.09e-52	194
MsaG016159	AT3G15890.1	35.404	322	200	4	414	728	23	343	2.12e-52	186
MsaG016159	AT4G23250.1	39.929	283	165	5	418	697	347	627	2.17e-52	193
MsaG016159	AT1G53430.2	37.457	291	172	5	418	703	616	901	2.20e-52	196
MsaG016159	AT1G21590.2	35.714	294	185	4	412	703	351	642	2.24e-52	194
MsaG016159	AT1G51880.1	41.958	286	155	7	419	701	557	834	2.39e-52	196
MsaG016159	AT1G78530.2	38.246	285	155	5	350	629	3	271	2.41e-52	183
MsaG016159	AT5G63930.1	38.908	293	164	7	418	701	792	1078	2.56e-52	197
MsaG016159	AT1G51880.2	41.522	289	158	7	416	701	572	852	2.65e-52	196
MsaG016159	AT1G53430.1	37.457	291	172	5	418	703	657	942	2.69e-52	196
MsaG016159	AT1G51880.3	41.958	286	155	7	419	701	583	860	2.76e-52	196
MsaG016159	AT1G65790.1	33.426	359	225	5	357	701	436	794	3.03e-52	195
MsaG016159	AT1G61550.1	34.278	353	202	8	357	697	422	756	3.16e-52	194
MsaG016159	AT4G21380.1	33.611	360	223	7	357	701	442	800	3.28e-52	195
MsaG016159	AT2G14440.1	41.869	289	153	7	418	701	554	832	3.28e-52	195
MsaG016159	AT2G19130.1	37.793	299	170	6	414	704	479	769	3.35e-52	195
MsaG016159	AT1G07570.4	43.697	238	121	6	474	704	6	237	3.61e-52	183
MsaG016159	AT4G23260.2	38.699	292	174	5	418	706	316	605	3.62e-52	192
MsaG016159	AT1G61430.10	32.303	356	220	6	299	645	339	682	3.68e-52	193
MsaG016159	AT4G23260.1	38.699	292	174	5	418	706	327	616	4.02e-52	192
MsaG016159	AT4G39400.1	38.580	324	176	9	413	726	866	1176	4.50e-52	196
MsaG016159	AT1G16670.1	35.017	297	183	3	413	703	24	316	4.57e-52	186
MsaG016159	AT4G23250.3	39.384	292	172	5	418	706	342	631	4.68e-52	193
MsaG016159	AT1G11330.1	32.454	379	240	6	358	728	445	815	4.75e-52	194
MsaG016159	AT3G45860.1	35.905	337	201	7	374	706	304	629	4.83e-52	192
MsaG016159	AT2G23950.2	36.482	307	181	3	343	648	222	515	5.65e-52	189
MsaG016159	AT4G11480.3	36.577	298	185	4	411	706	306	601	6.03e-52	191
MsaG016159	AT1G21590.1	35.714	294	185	4	412	703	391	682	6.11e-52	193
MsaG016159	AT1G51860.1	36.388	371	215	9	347	708	501	859	6.41e-52	194
MsaG016159	AT1G06700.1	34.936	312	190	5	405	704	39	349	6.43e-52	184
MsaG016159	AT1G06700.3	34.936	312	190	5	405	704	39	349	6.43e-52	184
MsaG016159	AT1G06700.2	34.936	312	190	5	405	704	39	349	6.43e-52	184
MsaG016159	AT2G19190.1	37.003	327	193	8	394	717	544	860	6.46e-52	194
MsaG016159	AT4G11480.4	36.577	298	185	4	411	706	303	598	6.55e-52	191
MsaG016159	AT1G61430.8	32.303	356	220	6	299	645	362	705	6.59e-52	192
MsaG016159	AT1G61430.7	32.303	356	220	6	299	645	362	705	6.59e-52	192
MsaG016159	AT1G53440.1	36.770	291	174	5	418	703	655	940	7.15e-52	195
MsaG016159	AT1G52540.2	34.884	301	189	4	414	713	21	315	7.41e-52	184
MsaG016159	AT3G14840.2	35.535	318	192	7	418	730	660	969	1.18e-51	194
MsaG016159	AT1G61400.2	30.602	415	258	8	300	697	374	775	1.19e-51	193
MsaG016159	AT4G04570.2	46.190	210	110	3	426	633	344	552	1.36e-51	189
MsaG016159	AT2G14510.1	41.869	289	153	7	418	701	553	831	1.43e-51	193
MsaG016159	AT1G11303.1	37.419	310	173	6	403	701	474	773	1.50e-51	192
MsaG016159	AT4G04540.2	47.619	210	107	3	426	633	349	557	1.55e-51	189
MsaG016159	AT2G14510.2	41.869	289	153	7	418	701	561	839	1.64e-51	193
MsaG016159	AT2G29000.1	38.065	310	182	5	416	720	553	857	1.74e-51	193
MsaG016159	AT4G11470.2	36.242	298	186	4	411	706	326	621	1.94e-51	191
MsaG016159	AT4G23250.2	39.384	292	172	5	418	706	342	631	1.94e-51	194
MsaG016159	AT4G11470.1	36.242	298	186	4	411	706	321	616	2.04e-51	190
MsaG016159	AT1G31420.2	34.571	350	210	6	358	702	239	574	2.12e-51	189
MsaG016159	AT1G29740.2	33.426	359	203	6	343	697	617	943	2.13e-51	194
MsaG016159	AT5G65700.1	37.299	311	173	7	400	697	660	961	2.18e-51	194
MsaG016159	AT5G65700.2	37.299	311	173	7	400	697	660	961	2.18e-51	194
MsaG016159	AT4G00960.1	35.231	281	175	3	426	701	52	330	2.28e-51	184
MsaG016159	AT1G61430.1	30.435	414	257	9	299	697	362	759	2.32e-51	192
MsaG016159	AT4G23140.1	38.811	286	171	4	423	706	344	627	2.47e-51	190
MsaG016159	AT2G19210.1	36.413	368	206	10	342	702	501	847	2.80e-51	192
MsaG016159	AT2G13800.4	37.049	305	179	6	415	711	143	442	2.82e-51	186
MsaG016159	AT2G13800.2	37.049	305	179	6	415	711	143	442	2.82e-51	186
MsaG016159	AT1G29740.1	33.426	359	203	6	343	697	617	943	2.84e-51	193
MsaG016159	AT4G11480.1	36.455	299	179	4	418	706	309	606	3.37e-51	189
MsaG016159	AT4G38830.1	37.086	302	180	6	411	706	326	623	3.70e-51	189
MsaG016159	AT5G15730.3	37.153	288	167	5	411	697	97	371	5.12e-51	184
MsaG016159	AT5G15730.2	37.153	288	167	5	411	697	97	371	5.12e-51	184
MsaG016159	AT1G11340.3	42.273	220	126	1	415	633	568	787	5.81e-51	191
MsaG016159	AT1G61390.2	32.432	370	230	7	343	705	269	625	5.90e-51	189
MsaG016159	AT4G04510.2	32.967	455	239	18	274	706	205	615	6.56e-51	189
MsaG016159	AT4G11530.1	35.664	286	181	3	418	701	340	624	6.80e-51	189
MsaG016159	AT4G04510.1	36.637	333	187	11	383	706	296	613	8.45e-51	188
MsaG016159	AT1G49730.4	44.000	225	118	5	411	631	310	530	8.64e-51	188
MsaG016159	AT2G25220.6	37.061	313	178	5	356	657	64	368	9.46e-51	181
MsaG016159	AT5G15730.1	37.500	288	164	6	411	697	97	369	1.00e-50	183
MsaG016159	AT2G25220.4	35.241	332	200	4	356	676	15	342	1.03e-50	182
MsaG016159	AT2G35620.3	34.197	386	231	8	324	702	203	572	1.07e-50	187
MsaG016159	AT2G35620.1	34.197	386	231	8	324	702	203	572	1.07e-50	187
MsaG016159	AT2G35620.2	34.197	386	231	8	324	702	203	572	1.07e-50	187

Find 163 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TTAAACACCATTCTGCAATT+AGG	0.194985	3:-94788306	None:intergenic
CCACATTTCTATGGTTGATT+TGG	0.204627	3:-94787712	None:intergenic
ACGTCTCCTTCATATCCTTC+TGG	0.209171	3:-94786863	None:intergenic
TAATTGCAGAATGGTGTTTA+AGG	0.225339	3:+94788308	MsaT016159.1:CDS
TCCCATTGCCACTTCTTTCA+TGG	0.231930	3:-94788353	None:intergenic
GTCTTAAATATCTCACTTAA+TGG	0.243980	3:+94785792	MsaT016159.1:CDS
TATGTACTCTTTACTTGATT+TGG	0.254034	3:-94786924	None:intergenic
CTCAAAATTCCCTTCCCATT+TGG	0.257159	3:+94785654	MsaT016159.1:CDS
TTGAAGTCATGTACTTCTAT+TGG	0.272889	3:-94786146	None:intergenic
GCAGATGCTTGGATGGATAT+TGG	0.274723	3:+94786384	MsaT016159.1:CDS
CGAGCTTTACCACATTTCTA+TGG	0.286956	3:-94787721	None:intergenic
GACGTAAAATTTAATGGAAC+AGG	0.289292	3:+94786881	MsaT016159.1:CDS
GAAGGAGACGTAAAATTTAA+TGG	0.295913	3:+94786875	MsaT016159.1:CDS
CAGATGCTTGGATGGATATT+GGG	0.296701	3:+94786385	MsaT016159.1:CDS
TAAACACCATTCTGCAATTA+GGG	0.297012	3:-94788305	None:intergenic
CACATTTCTATGGTTGATTT+GGG	0.299512	3:-94787711	None:intergenic
TCTTAGCTTGCTGGCACGTT+TGG	0.320632	3:-94786283	None:intergenic
AAAGATCATTCTTAGCTTGC+TGG	0.323552	3:-94786292	None:intergenic
TCCATGTAAGCTTTAAAGTT+TGG	0.330949	3:-94787832	None:intergenic
CTCTTTACTTGATTTGGTAC+TGG	0.337979	3:-94786918	None:intergenic
CGTCTCCTTCATATCCTTCT+GGG	0.340275	3:-94786862	None:intergenic
GGAGAGAAGGCATTATCTTT+TGG	0.343804	3:+94788154	MsaT016159.1:CDS
CATTGATGAACGACTCAATC+TGG	0.345230	3:-94787673	None:intergenic
TGAAGTCATGTACTTCTATT+GGG	0.347639	3:-94786145	None:intergenic
TTGCATAAACACATGACCTT+TGG	0.357536	3:-94786093	None:intergenic
GTTGTCTAGGGAGCAATCTT+TGG	0.362639	3:-94785682	None:intergenic
TGCATAAACACATGACCTTT+GGG	0.369726	3:-94786092	None:intergenic
TAAGCTTTAAAGTTTGGTTT+TGG	0.379664	3:-94787826	None:intergenic
AAGAGTGATGTTTATAGCTT+CGG	0.382378	3:+94788106	MsaT016159.1:CDS
TTGTAAAACTCCTTTGTAAA+CGG	0.389638	3:-94787603	None:intergenic
CAATCCGCTACTAGAAATAT+AGG	0.393192	3:-94786120	None:intergenic
ATGAACGACTCAATCTGGTT+TGG	0.394494	3:-94787668	None:intergenic
GTGAAATGCATCAACCTTCC+TGG	0.395129	3:+94786821	MsaT016159.1:CDS
TGGCTTGTGTGGAAGTACTC+TGG	0.396826	3:-94788073	None:intergenic
CATAAACAACGGTAGCTTCC+AGG	0.401563	3:-94786839	None:intergenic
GATCCTAGGCCAAGGTGGTC+AGG	0.402201	3:+94787577	MsaT016159.1:CDS
CAATCTTTGGTGATTCCAAA+TGG	0.404944	3:-94785669	None:intergenic
TGAACGACTCAATCTGGTTT+GGG	0.406745	3:-94787667	None:intergenic
ATTGCCACTTCTTTCATGGT+TGG	0.408118	3:-94788349	None:intergenic
AATTGCAGAATGGTGTTTAA+GGG	0.410147	3:+94788309	MsaT016159.1:CDS
GTGGCCAATGAATCTTGTTC+CGG	0.410582	3:+94786044	MsaT016159.1:CDS
TGTTGATATCCTGGACTGTC+TGG	0.413300	3:-94785878	None:intergenic
AATGAATCTTGTTCCGGCCC+TGG	0.417111	3:+94786050	MsaT016159.1:CDS
TTGCAATGTACTTTGTGTCT+TGG	0.417401	3:+94788200	MsaT016159.1:CDS
CCACACTTTCCTATACAGTT+TGG	0.418090	3:-94785627	None:intergenic
ACTGCAAAGGTGGCTGACTT+TGG	0.419054	3:+94787977	MsaT016159.1:CDS
CTTGCCTTCATCGAAGTTGT+TGG	0.424183	3:-94787555	None:intergenic
ATACAGTTTGGTAGTGATAT+CGG	0.425342	3:-94785615	None:intergenic
TCTTTCAAGTTATGCATGTA+AGG	0.435548	3:+94786310	MsaT016159.1:CDS
GATGCACCAACCCACAAATC+TGG	0.439316	3:+94786353	MsaT016159.1:CDS
CTTTAACTTGCGGAGGTCTG+TGG	0.440282	3:-94786219	None:intergenic
ATATCACTACCAAACTGTAT+AGG	0.443112	3:+94785618	MsaT016159.1:CDS
CATCACTCTTCTCTGTTAGC+TGG	0.450667	3:-94788093	None:intergenic
ACTCTAGTACAAGGTACGTT+GGG	0.451246	3:+94788040	MsaT016159.1:CDS
ATCAAGTAAAGAGTACATAT+TGG	0.454997	3:+94786928	MsaT016159.1:CDS
TGTAAGCCTCGTAGGACTAC+TGG	0.456312	3:+94787364	MsaT016159.1:CDS
GCAGTTGGATGTGACACAAT+TGG	0.458390	3:+94785942	MsaT016159.1:CDS
GCAAGGTTTCTATCTACCTC+TGG	0.458395	3:-94788181	None:intergenic
TACCTTGGCAACCATGTTTG+AGG	0.459761	3:-94786418	None:intergenic
TTGACATCTCTATGTATGAT+TGG	0.459915	3:-94787923	None:intergenic
TGATGAGGAAAGTGTTGTCT+AGG	0.462303	3:-94785695	None:intergenic
ACCAAACTTTAAAGCTTACA+TGG	0.462736	3:+94787831	MsaT016159.1:CDS
AACGTTGAAGATGGCGTTAG+CGG	0.463402	3:+94788439	MsaT016159.1:CDS
TGCAAAGGTAACCAGATTTG+TGG	0.464636	3:-94786364	None:intergenic
AAAAGAAACTGCTGGAGTCC+TGG	0.464775	3:+94787874	MsaT016159.1:CDS
GACAAATATTGAACATCTAA+AGG	0.467236	3:+94788276	MsaT016159.1:CDS
GGCTTGTGTGGAAGTACTCT+GGG	0.468336	3:-94788072	None:intergenic
TGGCTGACTTTGGAGCTTCA+AGG	0.470427	3:+94787987	MsaT016159.1:CDS
TGGTTACCTTTGCAGATGCT+TGG	0.474410	3:+94786373	MsaT016159.1:CDS
ACTTAAAATCTTCACTATTG+AGG	0.480651	3:+94787517	MsaT016159.1:CDS
ACATAACAATCACTGGCTAC+TGG	0.483084	3:-94785834	None:intergenic
GCCATCTTCAACGTTGATAA+CGG	0.484730	3:-94788431	None:intergenic
TCCGTTATCAACGTTGAAGA+TGG	0.484887	3:+94788430	MsaT016159.1:CDS
CGAAACAAGTTGATAGCAGT+TGG	0.484952	3:+94785927	MsaT016159.1:CDS
AGTTTCCTGTGTTGTTGGAC+TGG	0.492443	3:+94786249	MsaT016159.1:CDS
TGGCAACCATGTTTGAGGTA+AGG	0.496205	3:-94786413	None:intergenic
TTTAACTTGCGGAGGTCTGT+GGG	0.498795	3:-94786218	None:intergenic
AGGGCCGGAACAAGATTCAT+TGG	0.503307	3:-94786048	None:intergenic
GTTTATGAATTTATTCCCAA+TGG	0.504075	3:+94787779	MsaT016159.1:CDS
CAACAGGCTTAGTGATATTG+TGG	0.504084	3:+94786025	MsaT016159.1:CDS
GCAAAGGTAACCAGATTTGT+GGG	0.506715	3:-94786363	None:intergenic
GCTATCAACTTGTTTCGAGT+TGG	0.509398	3:-94785921	None:intergenic
TGTTCATAAACTGTACCATT+GGG	0.511897	3:-94787794	None:intergenic
AGAATAGCAAAAGAAACTGC+TGG	0.512260	3:+94787866	MsaT016159.1:CDS
CACATACACCACTGCATGTG+TGG	0.515120	3:+94785995	MsaT016159.1:CDS
TTTACAAAATAAAAGTATTG+TGG	0.521143	3:+94787619	MsaT016159.1:CDS
TACCTTTGCAGATGCTTGGA+TGG	0.523516	3:+94786377	MsaT016159.1:CDS
ACCATGAAAGAAGTGGCAAT+GGG	0.527246	3:+94788352	MsaT016159.1:CDS
GCAACCAACAACTTCGATGA+AGG	0.527707	3:+94787551	MsaT016159.1:CDS
TTCGATGAAGGCAAGATCCT+AGG	0.532337	3:+94787563	MsaT016159.1:CDS
AATGTGGCATGTTGATATCC+TGG	0.533505	3:-94785887	None:intergenic
AATCTTTGGTGATTCCAAAT+GGG	0.533514	3:-94785668	None:intergenic
TTATGCCCAGAAGGATATGA+AGG	0.533871	3:+94786857	MsaT016159.1:CDS
ATCCTAGGCCAAGGTGGTCA+GGG	0.535136	3:+94787578	MsaT016159.1:CDS
CAGCAGAATGTAAGTATGCC+AGG	0.536046	3:-94787892	None:intergenic
TCTCTGTTAGCTGGCTTGTG+TGG	0.543380	3:-94788084	None:intergenic
GTCCTAGCAGAGCTACTGAC+AGG	0.545266	3:+94788133	MsaT016159.1:CDS
CAGATAACCACTCTAGTACA+AGG	0.545526	3:+94788031	MsaT016159.1:CDS
AACAAATAGTGAAGCATGGA+GGG	0.546127	3:+94787483	MsaT016159.1:CDS
CTTTGTGTCTTGGATGAAAG+AGG	0.546784	3:+94788210	MsaT016159.1:CDS
ATAAATTCATAAACAAGCAA+TGG	0.547292	3:-94787770	None:intergenic
TTCCCTGACCACCTTGGCCT+AGG	0.548427	3:-94787580	None:intergenic
ATGTTCATAAACTGTACCAT+TGG	0.552785	3:-94787795	None:intergenic
TTTGGTGATTCCAAATGGGA+AGG	0.557833	3:-94785664	None:intergenic
TTTAGATGTTGATGAATGCA+AGG	0.558401	3:+94786775	MsaT016159.1:intron
TTGAAGATGGCGTTAGCGGA+AGG	0.560231	3:+94788443	MsaT016159.1:CDS
CTCAAAACAGCTGTTTCTCA+TGG	0.566551	3:+94785554	MsaT016159.1:CDS
CACTCTAGTACAAGGTACGT+TGG	0.567331	3:+94788039	MsaT016159.1:CDS
GAACAACAAATAGTGAAGCA+TGG	0.569603	3:+94787479	MsaT016159.1:CDS
AACCATGAAAGAAGTGGCAA+TGG	0.570272	3:+94788351	MsaT016159.1:CDS
CTCCTGTCAGTAGCTCTGCT+AGG	0.570885	3:-94788135	None:intergenic
AGGTAACCAGATTTGTGGGT+TGG	0.574074	3:-94786359	None:intergenic
TACCTCAAACATGGTTGCCA+AGG	0.577879	3:+94786416	MsaT016159.1:CDS
AGAGCTACTGACAGGAGAGA+AGG	0.585431	3:+94788141	MsaT016159.1:CDS
TTGGTGATTCCAAATGGGAA+GGG	0.588676	3:-94785663	None:intergenic
AAACGGTTCCCTGACCACCT+TGG	0.589454	3:-94787586	None:intergenic
ACAAGTGAACCAGACAGTCC+AGG	0.589553	3:+94785869	MsaT016159.1:CDS
GTGTTGTTGGACTGGACAGT+AGG	0.589882	3:+94786257	MsaT016159.1:CDS
GTCTGTGGGTTCAAAGCTGT+AGG	0.592252	3:-94786204	None:intergenic
AGCAAGTTAAGCCATGGCTG+TGG	0.592486	3:+94785527	None:intergenic
TACCGTTGTTTATGCCCAGA+AGG	0.594012	3:+94786848	MsaT016159.1:CDS
GTATCCTATATTTCTAGTAG+CGG	0.594839	3:+94786116	MsaT016159.1:CDS
TATCTCACAACAACCAGGGC+CGG	0.595671	3:-94786063	None:intergenic
AGATCATTAAACTTAAAGAA+CGG	0.598783	3:+94787426	MsaT016159.1:CDS
GATGAGGAAAGTGTTGTCTA+GGG	0.599183	3:-94785694	None:intergenic
GGTGTCAGTGTAAGCCTCGT+AGG	0.599514	3:+94787356	MsaT016159.1:intron
AGATGAAAATCTCACTGCAA+AGG	0.599647	3:+94787964	MsaT016159.1:CDS
AAGACACAAAGTACATTGCA+AGG	0.601267	3:-94788198	None:intergenic
AGAAGTGGCAATGGGACTAG+AGG	0.602523	3:+94788360	MsaT016159.1:CDS
TGAGTCGTTCATCAATGAAG+TGG	0.604013	3:+94787679	MsaT016159.1:CDS
ATCCATCCAAGCATCTGCAA+AGG	0.612269	3:-94786379	None:intergenic
AGATGCTTGGATGGATATTG+GGG	0.612547	3:+94786386	MsaT016159.1:CDS
CCAAATCAACCATAGAAATG+TGG	0.613579	3:+94787712	MsaT016159.1:CDS
TGTTGTTGGACTGGACAGTA+GGG	0.616544	3:+94786258	MsaT016159.1:CDS
CCAAACTGTATAGGAAAGTG+TGG	0.618283	3:+94785627	MsaT016159.1:CDS
ATTGATATCTCACAACAACC+AGG	0.623322	3:-94786068	None:intergenic
AGAAATGTGGTAAAGCTCGT+AGG	0.625831	3:+94787725	MsaT016159.1:CDS
GTGTTTAAGGGTGAAGAGTG+AGG	0.625964	3:+94788321	MsaT016159.1:CDS
GAAGTGGCAATGGGACTAGA+GGG	0.626292	3:+94788361	MsaT016159.1:CDS
AAAACAGCTGTTTCTCATGG+TGG	0.628166	3:+94785557	MsaT016159.1:CDS
GAAGGCAAGATCCTAGGCCA+AGG	0.628204	3:+94787569	MsaT016159.1:CDS
GGAAATCCTTACCTCAAACA+TGG	0.630039	3:+94786407	MsaT016159.1:CDS
ATCTCTATGTATGATTGGTG+TGG	0.630447	3:-94787918	None:intergenic
AAGACCAACCATGAAAGAAG+TGG	0.631305	3:+94788345	MsaT016159.1:CDS
CAACGTACCTTGTACTAGAG+TGG	0.633126	3:-94788038	None:intergenic
AAGTTGCCCTAATTGCAGAA+TGG	0.638227	3:+94788299	MsaT016159.1:CDS
TGAAAATCTCACTGCAAAGG+TGG	0.647145	3:+94787967	MsaT016159.1:CDS
ATCCTTCTGGGCATAAACAA+CGG	0.648769	3:-94786850	None:intergenic
GGTCAGGGAACCGTTTACAA+AGG	0.649701	3:+94787593	MsaT016159.1:CDS
ACTGTCCAGTCCAACAACAC+AGG	0.656370	3:-94786254	None:intergenic
CAACAAATAGTGAAGCATGG+AGG	0.657775	3:+94787482	MsaT016159.1:CDS
CTCTAGTACAAGGTACGTTG+GGG	0.657948	3:+94788041	MsaT016159.1:CDS
GGCAAGATCCTAGGCCAAGG+TGG	0.659029	3:+94787572	MsaT016159.1:CDS
GTTGGCGAGACATGAAAATG+TGG	0.659822	3:-94785903	None:intergenic
ATGGTGAATTGAGTGTTGCA+TGG	0.666471	3:+94785811	MsaT016159.1:CDS
AAGCCTCGTAGGACTACTGG+TGG	0.672914	3:+94787367	MsaT016159.1:CDS
AACAACGGTAGCTTCCAGGA+AGG	0.697798	3:-94786835	None:intergenic
ACGTAAAATTTAATGGAACA+GGG	0.700822	3:+94786882	MsaT016159.1:CDS
TGTGAGATATCAATACCCAA+AGG	0.702047	3:+94786077	MsaT016159.1:CDS
GTACATGACTTCAATCCATG+TGG	0.711792	3:+94786155	MsaT016159.1:CDS
TTGATATCTCACAACAACCA+GGG	0.712276	3:-94786067	None:intergenic
AGCCTCGTAGGACTACTGGT+GGG	0.712784	3:+94787368	MsaT016159.1:CDS
TTCCCACCAGTAGTCCTACG+AGG	0.754400	3:-94787370	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr3	gene	94785540	94788471	94785540	ID=MsaG016159
Chr3	mRNA	94785540	94788471	94785540	ID=MsaT016159.1;Parent=MsaG016159
Chr3	exon	94785540	94786437	94785540	ID=MsaT016159.1.exon1;Parent=MsaT016159.1
Chr3	CDS	94785540	94786437	94785540	ID=cds.MsaT016159.1;Parent=MsaT016159.1
Chr3	exon	94786780	94786962	94786780	ID=MsaT016159.1.exon2;Parent=MsaT016159.1
Chr3	CDS	94786780	94786962	94786780	ID=cds.MsaT016159.1;Parent=MsaT016159.1
Chr3	exon	94787357	94788471	94787357	ID=MsaT016159.1.exon3;Parent=MsaT016159.1
Chr3	CDS	94787357	94788471	94787357	ID=cds.MsaT016159.1;Parent=MsaT016159.1

Gene Sequence

>MsaT016159.1

ATGGCTGTGGAGTACTCAAAACAGCTGTTTCTCATGGTGGTTGTTGCTGTCCTTTATACAAAAGTAGCAACTCAACCGATATCACTACCAAACTGTATAGGAAAGTGTGGTTCCCTCAAAATTCCCTTCCCATTTGGAATCACCAAAGATTGCTCCCTAGACAACACTTTCCTCATCAATTGCAACAAAACATCATCAACTACATCAAACTCAACGAAACATGTAGCTTTTTTGTCAAAAACTAATCAACGTGTCTTAAATATCTCACTTAATGGTGAATTGAGTGTTGCATGGCCAGTAGCCAGTGATTGTTATGTAAAAAAGAGCATACAAGTGAACCAGACAGTCCAGGATATCAACATGCCACATTTTCATGTCTCGCCAACTCGAAACAAGTTGATAGCAGTTGGATGTGACACAATTGGACTTCTCGAAGCAATTGATTTTAAAGGAAACACATACACCACTGCATGTGTGGCTTTTTGCAACAGGCTTAGTGATATTGTGGCCAATGAATCTTGTTCCGGCCCTGGTTGTTGTGAGATATCAATACCCAAAGGTCATGTGTTTATGCAAGTATCCTATATTTCTAGTAGCGGATTGAACCCAATAGAAGTACATGACTTCAATCCATGTGGTTATACGTTTTTGGTGGAAAATGGAGCCTACAGCTTTGAACCCACAGACCTCCGCAAGTTAAAGAAGAAAAAGTTTCCTGTGTTGTTGGACTGGACAGTAGGGAACCAAACGTGCCAGCAAGCTAAGAATGATCTTTCAAGTTATGCATGTAAGGCAAACAACAGTGCATGCGACGATGCACCAACCCACAAATCTGGTTACCTTTGCAGATGCTTGGATGGATATTGGGGAAATCCTTACCTCAAACATGGTTGCCAAGATGTTGATGAATGCAAGGAATCCAATTACTGTTTTGAGGGGGTGAAATGCATCAACCTTCCTGGAAGCTACCGTTGTTTATGCCCAGAAGGATATGAAGGAGACGTAAAATTTAATGGAACAGGGTGCATTTCAAAATCCAGTACCAAATCAAGTAAAGAGTACATATTGGTTATTGCATTGAGTGTCAGTGTAAGCCTCGTAGGACTACTGGTGGGAAGCTTTTATGCTTATTGGGCTTTGAAGAAAATAAAGATCATTAAACTTAAAGAACGGTTTTTTAAACAAAACGGTGGCTTACTGTTAGAACAACAAATAGTGAAGCATGGAGGGTCGTCTGAAACACTTAAAATCTTCACTATTGAGGAGTTAAATGAAGCAACCAACAACTTCGATGAAGGCAAGATCCTAGGCCAAGGTGGTCAGGGAACCGTTTACAAAGGAGTTTTACAAAATAAAAGTATTGTGGCAATAAAGAAGTCAAAAATCAGTGACCCAAACCAGATTGAGTCGTTCATCAATGAAGTGGTCGTGCTTTCCCAAATCAACCATAGAAATGTGGTAAAGCTCGTAGGTTGTTGTTTAGAAACAGAAGTTCCATTGCTTGTTTATGAATTTATTCCCAATGGTACAGTTTATGAACATCTTCATGACCAAAACCAAACTTTAAAGCTTACATGGAAAACAAGATTGAGAATAGCAAAAGAAACTGCTGGAGTCCTGGCATACTTACATTCTGCTGCTTCCACACCAATCATACATAGAGATGTCAAATCTACAAATATACTACTAGATGAAAATCTCACTGCAAAGGTGGCTGACTTTGGAGCTTCAAGGATCGTTCCTCTTGATAAAACTCAGATAACCACTCTAGTACAAGGTACGTTGGGGTATCTTGACCCAGAGTACTTCCACACAAGCCAGCTAACAGAGAAGAGTGATGTTTATAGCTTCGGAGTTGTCCTAGCAGAGCTACTGACAGGAGAGAAGGCATTATCTTTTGGCAGGCCAGAGGTAGATAGAAACCTTGCAATGTACTTTGTGTCTTGGATGAAAGAGGATCAATTACTTCATATTCTAGACAAAAATATGGATGAGAATGAGACAAATATTGAACATCTAAAGGAAGTTGCCCTAATTGCAGAATGGTGTTTAAGGGTGAAGAGTGAGGAAAGACCAACCATGAAAGAAGTGGCAATGGGACTAGAGGGAATATCAGTTATTGAAGAGAATGAAAACATGCTCAATGCAACATCGTCCGTTATCAACGTTGAAGATGGCGTTAGCGGAAGGTATTAA

Protein sequence

>MsaT016159.1

MAVEYSKQLFLMVVVAVLYTKVATQPISLPNCIGKCGSLKIPFPFGITKDCSLDNTFLINCNKTSSTTSNSTKHVAFLSKTNQRVLNISLNGELSVAWPVASDCYVKKSIQVNQTVQDINMPHFHVSPTRNKLIAVGCDTIGLLEAIDFKGNTYTTACVAFCNRLSDIVANESCSGPGCCEISIPKGHVFMQVSYISSSGLNPIEVHDFNPCGYTFLVENGAYSFEPTDLRKLKKKKFPVLLDWTVGNQTCQQAKNDLSSYACKANNSACDDAPTHKSGYLCRCLDGYWGNPYLKHGCQDVDECKESNYCFEGVKCINLPGSYRCLCPEGYEGDVKFNGTGCISKSSTKSSKEYILVIALSVSVSLVGLLVGSFYAYWALKKIKIIKLKERFFKQNGGLLLEQQIVKHGGSSETLKIFTIEELNEATNNFDEGKILGQGGQGTVYKGVLQNKSIVAIKKSKISDPNQIESFINEVVVLSQINHRNVVKLVGCCLETEVPLLVYEFIPNGTVYEHLHDQNQTLKLTWKTRLRIAKETAGVLAYLHSAASTPIIHRDVKSTNILLDENLTAKVADFGASRIVPLDKTQITTLVQGTLGYLDPEYFHTSQLTEKSDVYSFGVVLAELLTGEKALSFGRPEVDRNLAMYFVSWMKEDQLLHILDKNMDENETNIEHLKEVALIAEWCLRVKSEERPTMKEVAMGLEGISVIEENENMLNATSSVINVEDGVSGRY*