AlfalfaGEDB | MsaG020173

M. sativa ssp. caerulea / MsaG020173

KEGG: -
GO: -
PFAM: PF00249.34

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020173	XP_013455622.1	86.486	74	10	0	1	74	1	74	7.99e-39	133

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020173	sp\|O22059\|CPC_ARATH	65.957	47	16	0	26	72	36	82	9.66e-16	68.2

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020173	tr\|A0A072UKM9\|A0A072UKM9_MEDTR	86.486	74	10	0	1	74	1	74	3.81e-39	133

TFs/TRs:

Gene ID	Type	Classification
MsaG020173	TF	MYB-related

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000620	MsaG020173	0.825857	6.628292e-54	1.707357e-51
MsaG001331	MsaG020173	0.816937	7.429819e-52	1.508901e-49
MsaG002373	MsaG020173	0.817580	5.331384e-52	1.100791e-49
MsaG003351	MsaG020173	0.801160	1.719320e-48	2.386239e-46
MsaG004010	MsaG020173	0.804097	4.288887e-49	6.367821e-47
MsaG004984	MsaG020173	0.808250	5.782292e-50	9.466747e-48
MsaG005327	MsaG020173	0.843007	3.401543e-58	1.460983e-55
MsaG007836	MsaG020173	0.893744	1.055663e-74	3.797830e-71
MsaG012162	MsaG020173	0.804797	3.069548e-49	4.631737e-47
MsaG012447	MsaG020173	0.853534	4.314629e-61	2.645352e-58
MsaG012812	MsaG020173	0.810353	2.057395e-50	3.543865e-48
MsaG013781	MsaG020173	0.800499	2.342874e-48	3.203547e-46
MsaG014042	MsaG020173	0.807137	9.939014e-50	1.584362e-47
MsaG014113	MsaG020173	0.810148	2.276040e-50	3.900801e-48
MsaG014314	MsaG020173	0.804158	4.165908e-49	6.193744e-47
MsaG015328	MsaG020173	0.805942	1.771880e-49	2.745947e-47
MsaG015720	MsaG020173	0.826181	5.557810e-54	1.444520e-51
MsaG017887	MsaG020173	0.844467	1.389421e-58	6.255602e-56
MsaG018680	MsaG020173	0.806083	1.654810e-49	2.573129e-47
MsaG018849	MsaG020173	0.811814	9.955574e-51	1.777278e-48
MsaG019060	MsaG020173	0.841191	1.023269e-57	4.147151e-55
MsaG019278	MsaG020173	0.808155	6.055445e-50	9.891223e-48
MsaG020173	MsaG021065	0.801726	1.318138e-48	1.853113e-46
MsaG020173	MsaG021138	0.821401	7.238297e-53	1.652057e-50
MsaG020173	MsaG021266	0.801769	1.291414e-48	1.817329e-46
MsaG020173	MsaG021496	0.816164	1.104824e-51	2.199714e-49
MsaG020173	MsaG023667	0.804057	4.371248e-49	6.484022e-47
MsaG020173	MsaG028968	0.846325	4.387826e-59	2.100769e-56
MsaG020173	MsaG028983	0.802584	8.797407e-49	1.261283e-46
MsaG020173	MsaG029207	0.821427	7.138199e-53	1.630307e-50
MsaG020173	MsaG031104	0.818857	2.750492e-52	5.869866e-50
MsaG020173	MsaG033967	0.804062	4.360344e-49	6.468679e-47
MsaG020173	MsaG035144	0.838390	5.440001e-57	2.019311e-54
MsaG020173	MsaG035673	0.811330	1.267083e-50	2.235303e-48
MsaG020173	MsaG036108	0.825682	7.291846e-54	1.869113e-51
MsaG020173	MsaG036385	0.807946	6.705933e-50	1.089905e-47
MsaG020173	MsaG036690	0.808704	4.631287e-50	7.665851e-48
MsaG020173	MsaG039578	0.801479	1.480065e-48	2.069116e-46
MsaG020173	MsaG040372	0.821982	5.318235e-53	1.232771e-50
MsaG020173	MsaG040767	0.804741	3.153968e-49	4.752872e-47
MsaG020173	MsaG042532	0.807108	1.008007e-49	1.605755e-47
MsaG020173	MsaG042534	0.804923	2.889811e-49	4.373361e-47
MsaG020173	MsaG044316	0.851942	1.222698e-60	7.088712e-58
MsaG020173	MsaG044709	0.822293	4.508742e-53	1.053842e-50
MsaG020173	MsaG046137	0.805500	2.191187e-49	3.360682e-47
MsaG020173	MsaG046368	0.814378	2.743717e-51	5.221481e-49
MsaG020173	MsaG006591	0.842821	3.811430e-58	1.627149e-55
MsaG020173	MsaG014519	0.864389	2.510748e-64	2.314911e-61
MsaG020173	MsaG012002	0.808037	6.415702e-50	1.045007e-47
MsaG020173	MsaG022641	0.803425	5.905521e-49	8.632058e-47
MsaG020173	MsaG018327	0.800906	1.936555e-48	2.672392e-46
MsaG020173	MsaG023305	0.812761	6.200241e-51	1.133094e-48
MsaG020173	MsaG032678	0.800491	2.350614e-48	3.213602e-46
MsaG020173	MsaG032355	0.805031	2.744703e-49	4.164292e-47
MsaG020173	MsaG030823	0.809498	3.136093e-50	5.291279e-48
MsaG020173	MsaG032852	0.820091	1.443156e-52	3.181718e-50
MsaG020173	MsaG035515	0.806323	1.473713e-49	2.304671e-47
MsaG020173	MsaG037049	0.826784	3.997526e-54	1.056535e-51
MsaG020173	MsaG036986	0.834702	4.682486e-56	1.554583e-53

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020173	MtrunA17_Chr4g0024181	86.486	74	10	0	1	74	1	74	7.35e-43	133
MsaG020173	MtrunA17_Chr2g0322831	70.000	50	15	0	24	73	30	79	4.20e-20	76.3
MsaG020173	MtrunA17_Chr5g0396771	65.217	46	16	0	26	71	37	82	5.23e-18	71.2
MsaG020173	MtrunA17_Chr2g0288361	49.333	75	35	2	1	73	1	74	5.52e-18	70.5
MsaG020173	MtrunA17_Chr7g0229101	57.143	42	18	0	27	68	29	70	4.82e-13	60.8
MsaG020173	MtrunA17_Chr4g0044421	58.537	41	17	0	28	68	70	110	1.12e-12	59.7
MsaG020173	MtrunA17_Chr4g0055981	63.415	41	15	0	28	68	113	153	2.50e-12	59.3
MsaG020173	MtrunA17_Chr4g0037141	58.537	41	17	0	28	68	70	110	2.81e-12	59.7
MsaG020173	MtrunA17_Chr8g0360111	58.537	41	17	0	28	68	83	123	3.51e-12	59.3
MsaG020173	MtrunA17_Chr5g0435101	56.098	41	18	0	28	68	69	109	3.67e-12	58.5
MsaG020173	MtrunA17_Chr7g0240821	54.545	44	20	0	28	71	59	102	4.51e-12	58.5
MsaG020173	MtrunA17_Chr3g0121241	57.143	42	18	0	27	68	99	140	6.00e-12	58.9
MsaG020173	MtrunA17_Chr4g0070641	58.537	41	17	0	28	68	70	110	7.60e-12	57.0
MsaG020173	MtrunA17_Chr4g0070611	57.500	40	16	1	29	68	72	110	1.16e-11	58.2
MsaG020173	MtrunA17_Chr8g0346561	56.098	41	18	0	28	68	70	110	2.21e-11	57.4
MsaG020173	MtrunA17_Chr7g0275911	57.143	42	17	1	30	71	73	113	2.21e-11	57.0
MsaG020173	MtrunA17_Chr7g0220341	56.098	41	18	0	28	68	85	125	2.24e-11	57.0
MsaG020173	MtrunA17_Chr3g0135311	50.000	42	21	0	28	69	71	112	6.42e-11	55.8
MsaG020173	MtrunA17_Chr1g0152011	52.381	42	20	0	28	69	71	112	6.45e-11	55.8
MsaG020173	MtrunA17_Chr5g0434901	51.220	41	20	0	28	68	31	71	7.00e-11	53.5
MsaG020173	MtrunA17_Chr7g0228991	51.220	41	20	0	28	68	87	127	8.19e-11	55.5

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020173	AT2G46410.1	65.957	47	16	0	26	72	36	82	9.82e-17	68.2
MsaG020173	AT1G01380.1	68.293	41	13	0	26	66	32	72	1.40e-15	65.1
MsaG020173	AT5G53200.1	58.696	46	19	0	26	71	31	76	4.11e-14	62.0
MsaG020173	AT4G01060.3	63.415	41	15	0	26	66	31	71	9.21e-14	60.1
MsaG020173	AT4G01060.1	63.415	41	15	0	26	66	33	73	9.89e-14	60.1
MsaG020173	AT4G01060.2	63.415	41	15	0	26	66	30	70	9.92e-14	60.1
MsaG020173	AT2G30420.1	56.522	46	20	0	26	71	38	83	1.68e-12	58.2
MsaG020173	AT1G22640.3	58.537	41	17	0	28	68	13	53	3.07e-12	58.9
MsaG020173	AT4G38620.1	58.537	41	17	0	28	68	70	110	4.81e-12	59.3
MsaG020173	AT1G22640.1	58.537	41	17	0	28	68	70	110	6.62e-12	58.9
MsaG020173	AT5G14750.4	52.273	44	21	0	28	71	13	56	1.11e-11	56.6
MsaG020173	AT5G14750.2	52.273	44	21	0	28	71	13	56	1.11e-11	56.6
MsaG020173	AT5G35550.2	62.500	40	14	1	29	68	77	115	1.84e-11	57.8
MsaG020173	AT3G49690.1	54.762	42	19	0	28	69	71	112	1.89e-11	57.8
MsaG020173	AT4G09460.1	51.220	41	20	0	28	68	70	110	2.23e-11	57.0
MsaG020173	AT5G14750.3	52.273	44	21	0	28	71	40	83	2.24e-11	56.2
MsaG020173	AT3G27920.1	50.000	48	24	0	24	71	68	115	2.83e-11	57.0
MsaG020173	AT2G30424.1	48.077	52	24	1	26	74	34	85	3.01e-11	54.3
MsaG020173	AT3G13540.1	58.537	41	17	0	28	68	81	121	3.17e-11	57.0
MsaG020173	AT2G30432.1	52.174	46	22	0	26	71	33	78	3.68e-11	53.9
MsaG020173	AT5G14750.1	52.273	44	21	0	28	71	74	117	4.28e-11	56.2
MsaG020173	AT5G65790.1	52.381	42	20	0	28	69	71	112	6.48e-11	56.6

Find 13 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
AGAGGAAATGCTTATTAAAA+TGG	0.190572	4:+46365699	MsaT020173.1:CDS
ATCTCTTCTGCTGTTCTTCC+AGG	0.213845	4:-46366057	None:intergenic
AAATGGTTTATAATCTTGTT+GGG	0.339232	4:+46365716	MsaT020173.1:CDS
TTGATTGCTGGAAGAATTCC+TGG	0.342209	4:+46366039	MsaT020173.1:CDS
AAAATGGTTTATAATCTTGT+TGG	0.380870	4:+46365715	MsaT020173.1:CDS
CATAGGTGGTCATTGATTGC+TGG	0.399125	4:+46366027	MsaT020173.1:intron
TCAACCTTTGAACCTTGGTC+TGG	0.418134	4:-46365664	None:intergenic
AAAATTCAACCTTTGAACCT+TGG	0.444402	4:-46365669	None:intergenic
TTTATAATCTTGTTGGGGAG+AGG	0.507013	4:+46365722	MsaT020173.1:CDS
AATGGTTTATAATCTTGTTG+GGG	0.563787	4:+46365717	MsaT020173.1:CDS
GCAACCAGACCAAGGTTCAA+AGG	0.564494	4:+46365660	MsaT020173.1:CDS
AATGTTTCAACAGATTCCAA+AGG	0.606722	4:+46365511	MsaT020173.1:CDS
ACAGATCAGCAACCAGACCA+AGG	0.650716	4:+46365652	MsaT020173.1:intron

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr4	gene	46365484	46366119	46365484	ID=MsaG020173
Chr4	mRNA	46365484	46366119	46365484	ID=MsaT020173.1;Parent=MsaG020173
Chr4	exon	46365484	46365532	46365484	ID=MsaT020173.1.exon1;Parent=MsaT020173.1
Chr4	CDS	46365484	46365532	46365484	ID=cds.MsaT020173.1;Parent=MsaT020173.1
Chr4	exon	46365656	46365743	46365656	ID=MsaT020173.1.exon2;Parent=MsaT020173.1
Chr4	CDS	46365656	46365743	46365656	ID=cds.MsaT020173.1;Parent=MsaT020173.1
Chr4	exon	46366032	46366119	46366032	ID=MsaT020173.1.exon3;Parent=MsaT020173.1
Chr4	CDS	46366032	46366119	46366032	ID=cds.MsaT020173.1;Parent=MsaT020173.1

Gene Sequence	>MsaT020173.1 ATGGCTGACTCAGAACACTCCTCTAAAAATGTTTCAACAGATTCCAAAGATCAGCAACCAGACCAAGGTTCAAAGGTTGAATTTTCTGAAGAAGAGGAAATGCTTATTAAAATGGTTTATAATCTTGTTGGGGAGAGGTGGTCATTGATTGCTGGAAGAATTCCTGGAAGAACAGCAGAAGAGATAGAAAAATATTGGAATTCAAGACACTCGACTAGCAAATGA
Protein sequence	>MsaT020173.1 MADSEHSSKNVSTDSKDQQPDQGSKVEFSEEEEMLIKMVYNLVGERWSLIAGRIPGRTAEEIEKYWNSRHSTSK*