AlfalfaGEDB | MsaG020669

M. sativa ssp. caerulea / MsaG020669

KEGG: -
GO: -
PFAM: -

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020669	XP_003606419.2	97.561	451	9	1	3	453	47	495	0.0	919

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020669	sp\|Q944L3\|IDD9_ARATH	79.882	169	34	0	2	170	47	215	3.79e-104	320

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020669	tr\|G7JPG1\|G7JPG1_MEDTR	97.561	451	9	1	3	453	47	495	0.0	919

TFs/TRs:

Gene ID	Type	Classification
MsaG020669	TF	C2H2

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000083	MsaG020669	0.806718	1.217787e-49	1.922209e-47
MsaG000153	MsaG020669	0.817937	4.434280e-52	9.240329e-50
MsaG000188	MsaG020669	0.803088	6.929540e-49	1.005057e-46
MsaG000250	MsaG020669	0.808401	5.370286e-50	8.823888e-48
MsaG000321	MsaG020669	0.816335	1.012129e-51	2.023948e-49
MsaG000796	MsaG020669	0.828473	1.578360e-54	4.374104e-52
MsaG000798	MsaG020669	0.810498	1.914916e-50	3.310074e-48
MsaG001027	MsaG020669	0.823324	2.600694e-53	6.250696e-51
MsaG001038	MsaG020669	0.806029	1.698933e-49	2.638284e-47
MsaG001367	MsaG020669	0.817828	4.690617e-52	9.747206e-50
MsaG001369	MsaG020669	0.808437	5.277184e-50	8.678608e-48
MsaG001540	MsaG020669	0.824972	1.071277e-53	2.692782e-51
MsaG002350	MsaG020669	0.818153	3.965044e-52	8.308705e-50
MsaG002528	MsaG020669	0.806421	1.405933e-49	2.203786e-47
MsaG002727	MsaG020669	0.817338	6.043250e-52	1.240036e-49
MsaG003136	MsaG020669	0.801404	1.533313e-48	2.139930e-46
MsaG003684	MsaG020669	0.827190	3.199877e-54	8.553812e-52
MsaG003778	MsaG020669	0.818585	3.167451e-52	6.712051e-50
MsaG003902	MsaG020669	0.816146	1.115128e-51	2.219243e-49
MsaG003905	MsaG020669	0.802625	8.625282e-49	1.237787e-46
MsaG004149	MsaG020669	0.829267	1.015726e-54	2.878333e-52
MsaG004257	MsaG020669	0.807870	6.958837e-50	1.128959e-47
MsaG004297	MsaG020669	0.840024	2.059988e-57	8.048247e-55
MsaG004428	MsaG020669	0.812921	5.720499e-51	1.049615e-48
MsaG004432	MsaG020669	0.811580	1.118936e-50	1.986056e-48
MsaG004653	MsaG020669	0.826291	5.234404e-54	1.364621e-51
MsaG004656	MsaG020669	0.801423	1.519581e-48	2.121693e-46
MsaG004711	MsaG020669	0.802509	9.112387e-49	1.304203e-46
MsaG004841	MsaG020669	0.808169	6.016263e-50	9.830578e-48
MsaG004913	MsaG020669	0.805651	2.038284e-49	3.137313e-47
MsaG004987	MsaG020669	0.811281	1.298191e-50	2.287414e-48
MsaG005063	MsaG020669	0.824277	1.558947e-53	3.844927e-51
MsaG005138	MsaG020669	0.805698	1.992453e-49	3.070170e-47
MsaG005229	MsaG020669	0.804156	4.170456e-49	6.200242e-47
MsaG005256	MsaG020669	0.830406	5.380579e-55	1.575380e-52
MsaG005321	MsaG020669	0.803811	4.915050e-49	7.248879e-47
MsaG005379	MsaG020669	0.825103	9.983410e-54	2.518438e-51
MsaG005500	MsaG020669	0.813965	3.381352e-51	6.368626e-49
MsaG005573	MsaG020669	0.821787	5.897959e-53	1.360005e-50
MsaG005843	MsaG020669	0.802284	1.013285e-48	1.442800e-46
MsaG006033	MsaG020669	0.819322	2.158377e-52	4.662991e-50
MsaG005937	MsaG020669	0.803932	4.639355e-49	6.861599e-47
MsaG006150	MsaG020669	0.813122	5.170729e-51	9.535249e-49
MsaG006085	MsaG020669	0.809849	2.638656e-50	4.489686e-48
MsaG006090	MsaG020669	0.810504	1.908871e-50	3.300145e-48
MsaG006230	MsaG020669	0.805628	2.060955e-49	3.170506e-47
MsaG006240	MsaG020669	0.829601	8.436364e-55	2.413888e-52
MsaG006469	MsaG020669	0.817027	7.091940e-52	1.443668e-49
MsaG006474	MsaG020669	0.802615	8.665885e-49	1.243326e-46
MsaG006507	MsaG020669	0.807907	6.836116e-50	1.110037e-47
MsaG006550	MsaG020669	0.817726	4.945228e-52	1.024887e-49
MsaG006608	MsaG020669	0.801571	1.417412e-48	1.985687e-46
MsaG006669	MsaG020669	0.806154	1.599386e-49	2.491107e-47
MsaG006741	MsaG020669	0.804880	2.950148e-49	4.460272e-47
MsaG006760	MsaG020669	0.802687	8.376223e-49	1.203718e-46
MsaG006767	MsaG020669	0.810338	2.072333e-50	3.568329e-48
MsaG006890	MsaG020669	0.813538	4.193721e-51	7.814486e-49
MsaG006959	MsaG020669	0.831663	2.652665e-55	8.054373e-53
MsaG006979	MsaG020669	0.806105	1.637282e-49	2.547213e-47
MsaG007312	MsaG020669	0.833516	9.249111e-56	2.964404e-53
MsaG007475	MsaG020669	0.804742	3.151548e-49	4.749476e-47
MsaG007403	MsaG020669	0.821661	6.306874e-53	1.449471e-50
MsaG007583	MsaG020669	0.804553	3.449849e-49	5.176224e-47
MsaG007601	MsaG020669	0.819437	2.032568e-52	4.404351e-50
MsaG007658	MsaG020669	0.800970	1.879627e-48	2.597575e-46
MsaG007718	MsaG020669	0.818965	2.599349e-52	5.563301e-50
MsaG007990	MsaG020669	0.824143	1.675696e-53	4.117793e-51
MsaG007966	MsaG020669	0.810116	2.312158e-50	3.959708e-48
MsaG008155	MsaG020669	0.802661	8.480646e-49	1.218031e-46
MsaG008256	MsaG020669	0.805223	2.503594e-49	3.815296e-47
MsaG008412	MsaG020669	0.807825	7.113992e-50	1.152855e-47
MsaG008606	MsaG020669	0.805000	2.786229e-49	4.224123e-47
MsaG009117	MsaG020669	0.804615	3.349778e-49	5.033166e-47
MsaG009261	MsaG020669	0.809343	3.384918e-50	5.689193e-48
MsaG009351	MsaG020669	0.826123	5.734216e-54	1.488035e-51
MsaG010328	MsaG020669	0.815572	1.495081e-51	2.932234e-49
MsaG010372	MsaG020669	0.810043	2.397611e-50	4.098662e-48
MsaG010628	MsaG020669	0.803699	5.185413e-49	7.627811e-47
MsaG010594	MsaG020669	0.835250	3.412176e-56	1.151477e-53
MsaG010694	MsaG020669	0.820300	1.292834e-52	2.866201e-50
MsaG011144	MsaG020669	0.821730	6.080475e-53	1.400009e-50
MsaG011461	MsaG020669	0.819112	2.407727e-52	5.173130e-50
MsaG012058	MsaG020669	0.824821	1.162274e-53	2.909487e-51
MsaG012081	MsaG020669	0.808603	4.865396e-50	8.033383e-48
MsaG012213	MsaG020669	0.815159	1.844997e-51	3.580840e-49
MsaG012291	MsaG020669	0.816444	9.570470e-52	1.919105e-49
MsaG012355	MsaG020669	0.800609	2.224960e-48	3.050021e-46
MsaG012497	MsaG020669	0.809662	2.892154e-50	4.898870e-48
MsaG012609	MsaG020669	0.803387	6.013348e-49	8.782162e-47
MsaG013230	MsaG020669	0.818828	2.791137e-52	5.952198e-50
MsaG013266	MsaG020669	0.801149	1.728550e-48	2.398474e-46
MsaG013327	MsaG020669	0.808333	5.551434e-50	9.106753e-48
MsaG013390	MsaG020669	0.801614	1.389603e-48	1.948610e-46
MsaG013884	MsaG020669	0.803968	4.560976e-49	6.751261e-47
MsaG013974	MsaG020669	0.808060	6.343693e-50	1.033847e-47
MsaG015044	MsaG020669	0.816343	1.007829e-51	2.015806e-49
MsaG015248	MsaG020669	0.815138	1.865504e-51	3.618625e-49
MsaG015692	MsaG020669	0.826188	5.534140e-54	1.438687e-51
MsaG016128	MsaG020669	0.802650	8.526873e-49	1.224332e-46
MsaG016406	MsaG020669	0.803069	6.992762e-49	1.013770e-46
MsaG017003	MsaG020669	0.813375	4.553980e-51	8.450979e-49
MsaG017083	MsaG020669	0.800073	2.857511e-48	3.869909e-46
MsaG017192	MsaG020669	0.804972	2.822980e-49	4.277058e-47
MsaG017203	MsaG020669	0.805431	2.265382e-49	3.468952e-47
MsaG017271	MsaG020669	0.828184	1.851472e-54	5.089379e-52
MsaG017378	MsaG020669	0.809737	2.787239e-50	4.729765e-48
MsaG017504	MsaG020669	0.802205	1.051853e-48	1.494964e-46
MsaG017731	MsaG020669	0.803626	5.368317e-49	7.883295e-47
MsaG017888	MsaG020669	0.821914	5.515264e-53	1.276079e-50
MsaG018045	MsaG020669	0.802362	9.766990e-49	1.393210e-46
MsaG018082	MsaG020669	0.836299	1.855958e-56	6.463974e-54
MsaG018132	MsaG020669	0.802352	9.814218e-49	1.399631e-46
MsaG018256	MsaG020669	0.807980	6.597556e-50	1.073152e-47
MsaG018466	MsaG020669	0.801969	1.175785e-48	1.662145e-46
MsaG018406	MsaG020669	0.834500	5.259931e-56	1.735768e-53
MsaG018511	MsaG020669	0.800170	2.730707e-48	3.706200e-46
MsaG018484	MsaG020669	0.831976	2.222351e-55	6.809388e-53
MsaG018634	MsaG020669	0.818397	3.493589e-52	7.366896e-50
MsaG018756	MsaG020669	0.817381	5.909595e-52	1.213971e-49
MsaG018876	MsaG020669	0.811159	1.379183e-50	2.422877e-48
MsaG018897	MsaG020669	0.821182	8.126055e-53	1.844045e-50
MsaG018998	MsaG020669	0.813541	4.188323e-51	7.804948e-49
MsaG019091	MsaG020669	0.808266	5.737675e-50	9.397296e-48
MsaG019589	MsaG020669	0.807580	8.016325e-50	1.291403e-47
MsaG020022	MsaG020669	0.804259	3.969584e-49	5.915773e-47
MsaG020202	MsaG020669	0.830565	4.919847e-55	1.446979e-52
MsaG020361	MsaG020669	0.817780	4.809900e-52	9.982386e-50
MsaG020648	MsaG020669	0.800284	2.590081e-48	3.524377e-46
MsaG020669	MsaG020716	0.800008	2.945560e-48	3.983382e-46
MsaG020669	MsaG020772	0.802997	7.233866e-49	1.046994e-46
MsaG020669	MsaG020902	0.800587	2.248371e-48	3.080531e-46
MsaG020669	MsaG020885	0.816264	1.049285e-51	2.094491e-49
MsaG020669	MsaG020897	0.811121	1.405697e-50	2.467118e-48
MsaG020669	MsaG021046	0.809809	2.690680e-50	4.573856e-48
MsaG020669	MsaG021098	0.800155	2.750689e-48	3.732037e-46
MsaG020669	MsaG022048	0.802882	7.638668e-49	1.102649e-46
MsaG020669	MsaG022081	0.826914	3.722498e-54	9.874689e-52
MsaG020669	MsaG022362	0.817951	4.402135e-52	9.176747e-50
MsaG020669	MsaG022571	0.801496	1.468499e-48	2.053736e-46
MsaG020669	MsaG023301	0.806727	1.212455e-49	1.914218e-47
MsaG020669	MsaG023268	0.807622	7.852256e-50	1.266274e-47
MsaG020669	MsaG023415	0.832020	2.166798e-55	6.648083e-53
MsaG020669	MsaG023663	0.826376	4.995248e-54	1.305399e-51
MsaG020669	MsaG023689	0.809196	3.638306e-50	6.093565e-48
MsaG020669	MsaG023692	0.841573	8.126355e-58	3.333717e-55
MsaG020669	MsaG023892	0.811139	1.393348e-50	2.446492e-48
MsaG020669	MsaG024336	0.815078	1.923323e-51	3.725169e-49
MsaG020669	MsaG024879	0.819534	1.931993e-52	4.196914e-50
MsaG020669	MsaG026689	0.801810	1.266959e-48	1.784593e-46
MsaG020669	MsaG026787	0.805962	1.754191e-49	2.719831e-47
MsaG020669	MsaG026821	0.802084	1.113793e-48	1.578641e-46
MsaG020669	MsaG026867	0.838158	6.240965e-57	2.300109e-54
MsaG020669	MsaG027179	0.802231	1.039259e-48	1.477948e-46
MsaG020669	MsaG027469	0.817341	6.031573e-52	1.237751e-49
MsaG020669	MsaG027567	0.807200	9.639457e-50	1.538918e-47
MsaG020669	MsaG027725	0.807272	9.310381e-50	1.488889e-47
MsaG020669	MsaG027991	0.810141	2.283940e-50	3.913701e-48
MsaG020669	MsaG028038	0.807397	8.760992e-50	1.405237e-47
MsaG020669	MsaG028030	0.816604	8.813962e-52	1.774678e-49
MsaG020669	MsaG028250	0.801487	1.474680e-48	2.061954e-46
MsaG020669	MsaG028254	0.831659	2.658415e-55	8.070970e-53
MsaG020669	MsaG028292	0.801879	1.226347e-48	1.730136e-46
MsaG020669	MsaG028515	0.806790	1.175983e-49	1.859378e-47
MsaG020669	MsaG028635	0.806546	1.323370e-49	2.080485e-47
MsaG020669	MsaG028754	0.836079	2.109250e-56	7.297413e-54
MsaG020669	MsaG028883	0.838514	5.056002e-57	1.884124e-54
MsaG020669	MsaG029005	0.807217	9.562193e-50	1.527174e-47
MsaG020669	MsaG029066	0.811966	9.227317e-51	1.653440e-48
MsaG020669	MsaG029261	0.843071	3.271305e-58	1.407905e-55
MsaG020669	MsaG029389	0.815021	1.980023e-51	3.829540e-49
MsaG020669	MsaG029545	0.804034	4.418869e-49	6.551309e-47
MsaG020669	MsaG030237	0.801873	1.230040e-48	1.735097e-46
MsaG020669	MsaG030421	0.803516	5.654648e-49	8.282969e-47
MsaG020669	MsaG030605	0.831370	3.128881e-55	9.418533e-53
MsaG020669	MsaG030781	0.816811	7.925121e-52	1.604244e-49
MsaG020669	MsaG030992	0.810581	1.837789e-50	3.183143e-48
MsaG020669	MsaG031064	0.825764	6.971279e-54	1.791038e-51
MsaG020669	MsaG031132	0.814403	2.708458e-51	5.157670e-49
MsaG020669	MsaG031267	0.814369	2.756674e-51	5.244939e-49
MsaG020669	MsaG031410	0.808233	5.831516e-50	9.543272e-48
MsaG020669	MsaG032260	0.807727	7.463132e-50	1.206584e-47
MsaG020669	MsaG032764	0.801401	1.535153e-48	2.142370e-46
MsaG020669	MsaG033975	0.804494	3.548112e-49	5.316417e-47
MsaG020669	MsaG034151	0.814195	3.010155e-51	5.702206e-49
MsaG020669	MsaG034778	0.802340	9.867619e-49	1.406877e-46
MsaG020669	MsaG036092	0.821998	5.273581e-53	1.222924e-50
MsaG020669	MsaG036246	0.801091	1.775706e-48	2.460677e-46
MsaG020669	MsaG036468	0.812230	8.088198e-51	1.458686e-48
MsaG020669	MsaG038715	0.825262	9.155477e-54	2.319707e-51
MsaG020669	MsaG039727	0.816579	8.930719e-52	1.797046e-49
MsaG020669	MsaG040052	0.807262	9.356703e-50	1.495929e-47
MsaG020669	MsaG040342	0.834152	6.423894e-56	2.097843e-53
MsaG020669	MsaG040380	0.832022	2.165231e-55	6.643506e-53
MsaG020669	MsaG040499	0.802387	9.652759e-49	1.377702e-46
MsaG020669	MsaG040732	0.807914	6.810496e-50	1.106073e-47
MsaG020669	MsaG041141	0.804036	4.416180e-49	6.547475e-47
MsaG020669	MsaG041224	0.836519	1.632773e-56	5.724107e-54
MsaG020669	MsaG041358	0.828622	1.453024e-54	4.043544e-52
MsaG020669	MsaG041653	0.816822	7.883260e-52	1.596188e-49
MsaG020669	MsaG041906	0.806546	1.323370e-49	2.080485e-47
MsaG020669	MsaG042064	0.817143	6.679790e-52	1.363843e-49
MsaG020669	MsaG042071	0.801146	1.730621e-48	2.401211e-46
MsaG020669	MsaG042087	0.830109	6.351526e-55	1.843961e-52
MsaG020669	MsaG042397	0.807940	6.726625e-50	1.093113e-47
MsaG020669	MsaG042419	0.848497	1.117952e-59	5.756037e-57
MsaG020669	MsaG043178	0.808741	4.547566e-50	7.534084e-48
MsaG020669	MsaG043226	0.817251	6.320396e-52	1.294034e-49
MsaG020669	MsaG043815	0.824870	1.132171e-53	2.837878e-51
MsaG020669	MsaG043879	0.805364	2.338836e-49	3.575951e-47
MsaG020669	MsaG044049	0.832837	1.363081e-55	4.282174e-53
MsaG020669	MsaG044576	0.804919	2.896488e-49	4.382980e-47
MsaG020669	MsaG044937	0.803010	7.190169e-49	1.040976e-46
MsaG020669	MsaG044938	0.800723	2.109497e-48	2.899200e-46
MsaG020669	MsaG044945	0.810954	1.527034e-50	2.669141e-48
MsaG020669	MsaG044960	0.810734	1.703379e-50	2.961394e-48
MsaG020669	MsaG045061	0.802910	7.537696e-49	1.088771e-46
MsaG020669	MsaG045093	0.813285	4.763675e-51	8.820207e-49
MsaG020669	MsaG045244	0.801781	1.284448e-48	1.807998e-46
MsaG020669	MsaG045290	0.817505	5.543450e-52	1.142386e-49
MsaG020669	MsaG045535	0.832475	1.674194e-55	5.204606e-53
MsaG020669	MsaG045517	0.844855	1.093910e-58	4.989016e-56
MsaG020669	MsaG045618	0.827971	2.082062e-54	5.689087e-52
MsaG020669	MsaG046018	0.821924	5.485433e-53	1.269534e-50
MsaG020669	MsaG046023	0.816254	1.054795e-51	2.104932e-49
MsaG020669	MsaG046178	0.819033	2.509233e-52	5.379982e-50
MsaG020669	MsaG046614	0.834706	4.672229e-56	1.551365e-53
MsaG020669	MsaG046628	0.831432	3.022272e-55	9.114228e-53
MsaG020669	MsaG046700	0.802500	9.150963e-49	1.309453e-46
MsaG020669	MsaG046926	0.809368	3.342666e-50	5.621782e-48
MsaG020669	MsaG046944	0.834913	4.146456e-56	1.385285e-53
MsaG020669	MsaG047030	0.809924	2.542374e-50	4.333674e-48
MsaG020669	MsaG047154	0.821341	7.468404e-53	1.701906e-50
MsaG020669	MsaG003779	0.818427	3.438412e-52	7.256193e-50
MsaG020669	MsaG009468	0.811052	1.454421e-50	2.548358e-48
MsaG020669	MsaG006008	0.815974	1.217236e-51	2.411876e-49
MsaG020669	MsaG007379	0.816671	8.518308e-52	1.718049e-49
MsaG020669	MsaG008743	0.817491	5.583818e-52	1.150296e-49
MsaG020669	MsaG008541	0.841398	9.031957e-58	3.684639e-55
MsaG020669	MsaG008139	0.830660	4.665702e-55	1.375937e-52
MsaG020669	MsaG008702	0.817546	5.427650e-52	1.119691e-49
MsaG020669	MsaG013545	0.809877	2.602341e-50	4.430821e-48
MsaG020669	MsaG012992	0.817451	5.699151e-52	1.172864e-49
MsaG020669	MsaG013392	0.807373	8.864942e-50	1.421086e-47
MsaG020669	MsaG018216	0.800828	2.008601e-48	2.766967e-46
MsaG020669	MsaG018328	0.816064	1.162733e-51	2.309039e-49
MsaG020669	MsaG018567	0.817785	4.797204e-52	9.957313e-50
MsaG020669	MsaG018951	0.817320	6.099257e-52	1.250960e-49
MsaG020669	MsaG019915	0.828266	1.769397e-54	4.874848e-52
MsaG020669	MsaG026455	0.824795	1.179248e-53	2.949743e-51
MsaG020669	MsaG027478	0.810019	2.426451e-50	4.145517e-48
MsaG020669	MsaG028977	0.800548	2.289306e-48	3.133851e-46
MsaG020669	MsaG026813	0.835934	2.295659e-56	7.907700e-54
MsaG020669	MsaG026290	0.806765	1.190622e-49	1.881434e-47
MsaG020669	MsaG025429	0.806095	1.645373e-49	2.559193e-47
MsaG020669	MsaG032885	0.821958	5.385926e-53	1.247645e-50
MsaG020669	MsaG032938	0.812669	6.490518e-51	1.183435e-48
MsaG020669	MsaG032723	0.802763	8.080470e-49	1.163229e-46
MsaG020669	MsaG031909	0.801777	1.286766e-48	1.811115e-46
MsaG020669	MsaG031611	0.840755	1.329773e-57	5.315489e-55
MsaG020669	MsaG033144	0.820061	1.466197e-52	3.229951e-50
MsaG020669	MsaG031607	0.812300	7.808870e-51	1.410795e-48
MsaG020669	MsaG032074	0.811923	9.427171e-51	1.687498e-48
MsaG020669	MsaG036962	0.804554	3.447743e-49	5.173224e-47
MsaG020669	MsaG037322	0.832300	1.849062e-55	5.719003e-53
MsaG020669	MsaG036198	0.819359	2.117020e-52	4.578107e-50
MsaG020669	MsaG036116	0.830844	4.207770e-55	1.247517e-52
MsaG020669	MsaG037527	0.818662	3.043044e-52	6.461358e-50
MsaG020669	MsaG036928	0.802054	1.129321e-48	1.599575e-46
MsaG020669	MsaG036499	0.800368	2.490172e-48	3.394986e-46
MsaG020669	MsaG044257	0.805677	2.012145e-49	3.098984e-47
MsaG020669	MsaG045038	0.836376	1.774874e-56	6.196038e-54
MsaG020669	MsaG040992	0.821284	7.698865e-53	1.751816e-50
MsaG020669	MsaG041359	0.804538	3.475221e-49	5.212468e-47
MsaG020669	MsaG043306	0.801280	1.625119e-48	2.261656e-46

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020669	MtrunA17_Chr4g0029521	97.561	451	9	1	3	453	47	495	0.0	919
MsaG020669	MtrunA17_Chr2g0326381	56.447	349	107	13	3	326	41	369	1.92e-120	357
MsaG020669	MtrunA17_Chr1g0181381	53.372	341	121	8	3	310	47	382	3.12e-111	337
MsaG020669	MtrunA17_Chr1g0185121	54.305	302	113	6	2	300	48	327	2.56e-104	317
MsaG020669	MtrunA17_Chr2g0330171	42.463	471	186	16	2	451	54	460	1.05e-103	317
MsaG020669	MtrunA17_Chr8g0342421	86.164	159	21	1	2	160	70	227	1.94e-102	315
MsaG020669	MtrunA17_Chr4g0040571	43.271	483	163	16	2	416	47	486	3.34e-102	313
MsaG020669	MtrunA17_Chr7g0263941	78.652	178	33	4	3	178	43	217	1.26e-101	309
MsaG020669	MtrunA17_Chr8g0373541	75.138	181	42	2	3	181	42	221	1.35e-100	310
MsaG020669	MtrunA17_Chr1g0199101	40.583	515	203	17	3	452	56	532	6.14e-100	309
MsaG020669	MtrunA17_Chr1g0151351	76.608	171	40	0	2	172	49	219	1.91e-98	302
MsaG020669	MtrunA17_Chr1g0191991	77.586	174	36	2	2	175	71	241	2.95e-98	304
MsaG020669	MtrunA17_Chr1g0162971	80.645	155	29	1	3	157	50	203	1.56e-96	297
MsaG020669	MtrunA17_Chr1g0210821	74.854	171	40	2	3	173	53	220	3.55e-96	300
MsaG020669	MtrunA17_Chr7g0268961	81.935	155	27	1	4	158	32	185	5.09e-96	297
MsaG020669	MtrunA17_Chr1g0163001	74.138	174	42	2	3	174	52	224	1.93e-95	297
MsaG020669	MtrunA17_Chr3g0141431	77.181	149	34	0	3	151	31	179	6.25e-90	279
MsaG020669	MtrunA17_Chr2g0324991	86.364	132	17	1	5	136	3	133	2.78e-83	253
MsaG020669	MtrunA17_Chr6g0479921	62.162	148	54	2	3	149	38	184	5.80e-66	219
MsaG020669	MtrunA17_Chr8g0375521	60.544	147	57	1	3	148	36	182	9.65e-66	217
MsaG020669	MtrunA17_Chr2g0320341	34.395	157	90	4	1	144	222	378	7.92e-25	105
MsaG020669	MtrunA17_Chr1g0200421	34.868	152	86	4	8	147	236	386	2.91e-24	105
MsaG020669	MtrunA17_Chr3g0123941	36.424	151	89	4	4	147	118	268	2.04e-23	100
MsaG020669	MtrunA17_Chr5g0422571	38.462	143	78	5	17	150	108	249	1.05e-21	95.1
MsaG020669	MtrunA17_Chr8g0382121	34.459	148	87	4	7	144	109	256	7.96e-21	92.8
MsaG020669	MtrunA17_Chr7g0258011	33.540	161	90	5	17	161	183	342	2.47e-20	92.0
MsaG020669	MtrunA17_Chr4g0026521	37.410	139	78	4	17	147	125	262	4.81e-20	90.1
MsaG020669	MtrunA17_Chr4g0053341	34.868	152	88	5	5	147	69	218	5.48e-20	88.6
MsaG020669	MtrunA17_Chr8g0352011	37.410	139	78	4	17	147	173	310	6.43e-20	90.5
MsaG020669	MtrunA17_Chr1g0198651	34.507	142	81	4	17	147	109	249	7.95e-20	89.7
MsaG020669	MtrunA17_Chr2g0321291	38.129	139	77	4	17	147	140	277	1.05e-19	89.4
MsaG020669	MtrunA17_Chr1g0173841	35.971	139	80	4	17	147	222	359	2.89e-19	89.4
MsaG020669	MtrunA17_Chr2g0328921	35.971	139	80	4	17	147	145	282	4.95e-19	87.8

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG020669	AT3G45260.2	79.882	169	34	0	2	170	47	215	3.86e-105	320
MsaG020669	AT3G45260.1	79.882	169	34	0	2	170	47	215	3.86e-105	320
MsaG020669	AT1G55110.3	81.707	164	30	0	2	165	71	234	5.18e-102	312
MsaG020669	AT1G55110.1	81.707	164	30	0	2	165	71	234	5.18e-102	312
MsaG020669	AT1G55110.2	81.707	164	30	0	2	165	71	234	5.18e-102	312
MsaG020669	AT5G03150.1	53.049	328	124	8	3	303	62	386	5.67e-101	311
MsaG020669	AT5G60470.2	77.576	165	37	0	2	166	52	216	9.14e-101	309
MsaG020669	AT5G60470.3	77.576	165	37	0	2	166	48	212	1.03e-100	309
MsaG020669	AT3G50700.1	83.871	155	24	1	3	157	43	196	1.09e-100	308
MsaG020669	AT5G66730.1	85.161	155	22	1	3	157	41	194	1.27e-100	310
MsaG020669	AT1G03840.1	83.439	157	25	1	2	158	49	204	4.15e-100	309
MsaG020669	AT3G13810.6	82.500	160	28	0	2	161	59	218	8.16e-100	308
MsaG020669	AT5G44160.1	45.057	435	192	13	2	416	45	452	1.31e-99	306
MsaG020669	AT3G13810.4	82.500	160	28	0	2	161	78	237	1.33e-99	308
MsaG020669	AT3G13810.1	82.500	160	28	0	2	161	78	237	1.33e-99	308
MsaG020669	AT3G13810.5	82.500	160	28	0	2	161	73	232	1.42e-99	307
MsaG020669	AT2G02080.1	40.879	455	189	11	2	416	62	476	1.58e-99	308
MsaG020669	AT2G02080.4	40.879	455	189	11	2	416	62	476	1.58e-99	308
MsaG020669	AT2G02080.5	40.879	455	189	11	2	416	62	476	1.58e-99	308
MsaG020669	AT2G02080.3	40.879	455	189	11	2	416	62	476	1.58e-99	308
MsaG020669	AT4G02670.1	81.529	157	29	0	2	158	61	217	5.32e-99	302
MsaG020669	AT4G02670.2	81.529	157	29	0	2	158	63	219	5.72e-99	302
MsaG020669	AT5G60470.1	77.160	162	37	0	5	166	46	207	2.16e-98	303
MsaG020669	AT5G44160.2	44.804	433	192	13	4	416	8	413	6.78e-98	300
MsaG020669	AT1G14580.1	78.750	160	33	1	2	161	61	219	9.12e-98	301
MsaG020669	AT1G14580.2	78.750	160	33	1	2	161	61	219	9.12e-98	301
MsaG020669	AT1G14580.3	78.750	160	33	1	2	161	75	233	1.95e-97	301
MsaG020669	AT1G03840.2	82.581	155	26	1	4	158	49	202	1.96e-97	302
MsaG020669	AT3G13810.3	82.166	157	28	0	5	161	68	224	8.22e-97	300
MsaG020669	AT3G13810.2	82.166	157	28	0	5	161	82	238	1.17e-96	300
MsaG020669	AT2G02070.2	74.545	165	37	2	3	163	61	224	1.37e-93	295
MsaG020669	AT2G02070.1	74.545	165	37	2	3	163	61	224	1.37e-93	295
MsaG020669	AT2G02080.6	39.863	439	184	11	18	416	1	399	2.76e-90	281
MsaG020669	AT2G02080.2	39.863	439	184	11	18	416	1	399	2.76e-90	281
MsaG020669	AT1G68130.1	63.265	147	53	1	3	148	50	196	1.95e-68	224
MsaG020669	AT2G01940.1	62.416	149	55	1	3	150	53	201	5.85e-68	224
MsaG020669	AT1G25250.3	62.838	148	53	2	3	148	42	189	1.01e-67	221
MsaG020669	AT1G25250.1	62.585	147	53	2	4	148	20	166	1.05e-66	218
MsaG020669	AT2G01940.3	61.333	150	56	2	3	150	53	202	4.59e-64	213
MsaG020669	AT1G68130.2	61.818	110	41	1	40	148	1	110	4.65e-45	160
MsaG020669	AT2G01940.2	61.607	112	42	1	40	150	1	112	8.38e-45	160
MsaG020669	AT1G25250.2	62.162	111	40	2	40	148	1	111	1.56e-44	158
MsaG020669	AT1G34370.3	33.714	175	103	4	3	164	14	188	1.25e-24	103
MsaG020669	AT1G34370.2	33.714	175	103	4	3	164	224	398	3.85e-24	105
MsaG020669	AT1G34370.1	33.714	175	103	4	3	164	224	398	3.85e-24	105
MsaG020669	AT5G22890.1	33.987	153	88	4	8	147	202	354	6.42e-23	100
MsaG020669	AT1G13290.1	35.484	155	89	6	17	161	95	248	3.37e-20	91.3
MsaG020669	AT1G51220.1	32.317	164	93	5	17	172	172	325	6.09e-20	90.9
MsaG020669	AT1G08290.1	38.519	135	73	4	22	147	179	312	4.86e-19	88.6
MsaG020669	AT3G20880.1	35.252	139	81	4	17	147	250	387	5.07e-19	89.4
MsaG020669	AT3G57670.1	35.252	139	81	4	17	147	211	348	1.41e-18	87.8
MsaG020669	AT1G34790.1	36.691	139	79	4	17	147	139	276	1.83e-18	86.3

Find 79 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
GTTGAATAAGTTGGTGAATT+TGG	0.142711	4:-56441338	MsaT020669.1:CDS
CAAGAACTTGGTGAGTTTAA+TGG	0.196940	4:-56441067	MsaT020669.1:CDS
TTTCAGTTTCACTCAGAATT+TGG	0.212422	4:-56441787	MsaT020669.1:CDS
AGATTGAACTGCATATTTCT+TGG	0.249648	4:+56442465	None:intergenic
TCAAATTCAAACAATATGTT+TGG	0.277577	4:-56441265	MsaT020669.1:CDS
GCCGATGAAGCTGCAAATTC+TGG	0.302791	4:+56442677	None:intergenic
TTTAATGGAATGGGATCATT+AGG	0.305018	4:-56441052	MsaT020669.1:CDS
TGTGAATGGTACAAAGGATT+TGG	0.314338	4:-56441239	MsaT020669.1:CDS
ACCACTTCTGATTCCGGATC+TGG	0.324071	4:+56442775	None:intergenic
CCATGAACCTTCTAGAGCTT+TGG	0.326353	4:-56442560	MsaT020669.1:CDS
CAAATTCAAACAATATGTTT+GGG	0.356792	4:-56441264	MsaT020669.1:CDS
AATAGACAAATGTATGATTC+AGG	0.359404	4:-56441181	MsaT020669.1:CDS
CAGCAGCATTAAGCAACTTT+CGG	0.370255	4:-56441864	MsaT020669.1:CDS
CATGAACCTTCTAGAGCTTT+GGG	0.370674	4:-56442559	MsaT020669.1:CDS
AATCTCTTGTAAAACCCATT+TGG	0.383514	4:+56441137	None:intergenic
AGCAATAGCAGCACCAATCT+TGG	0.398971	4:-56441310	MsaT020669.1:CDS
CGAAAGTTGCTTAATGCTGC+TGG	0.400098	4:+56441865	None:intergenic
GTTGTTACTGACAAGTGATT+TGG	0.406986	4:+56441505	None:intergenic
CCAAAGCTCTAGAAGGTTCA+TGG	0.410521	4:+56442560	None:intergenic
AATAATCTCCAGAGCCAGTA+TGG	0.415643	4:-56441028	MsaT020669.1:CDS
CTTGGTGAGTTTAATGGAAT+GGG	0.417145	4:-56441061	MsaT020669.1:CDS
CCATGTAGCATTGGCAAAGA+TGG	0.419067	4:+56441628	None:intergenic
GAAGACTGTGTTATTATCAT+TGG	0.421766	4:+56441432	None:intergenic
GCTGCAAATTCTGGTCTCTC+TGG	0.424694	4:+56442686	None:intergenic
AATATGCAGTTCAATCTGAT+TGG	0.433651	4:-56442459	MsaT020669.1:CDS
CCACTTTCACATTGTTAATG+AGG	0.436319	4:-56441398	MsaT020669.1:CDS
AAATCTCCCAAAGCTCTAGA+AGG	0.438385	4:+56442553	None:intergenic
GCTCTTTGCTTCAGCTTCCA+TGG	0.444326	4:+56442640	None:intergenic
ATGCAAACAATGGATGTGTT+TGG	0.447388	4:-56441688	MsaT020669.1:CDS
TAAATACCCACCTCCAAGAT+TGG	0.449616	4:+56441297	None:intergenic
GTTGCAGAAAGAATCTCAAA+TGG	0.449863	4:-56441476	MsaT020669.1:CDS
CAAAGATCAAATTCGAAAGA+AGG	0.450162	4:-56442614	MsaT020669.1:CDS
TTATGTGAAATCTGCAACAA+GGG	0.451384	4:-56442712	MsaT020669.1:CDS
TATGTCACCAAAGTCATTGA+TGG	0.456254	4:-56442749	MsaT020669.1:CDS
TTTGCTTCAGCTTCCATGGT+AGG	0.459248	4:+56442644	None:intergenic
ACTTGGTGAGTTTAATGGAA+TGG	0.460921	4:-56441062	MsaT020669.1:CDS
AGTAGTGTCCACCACCATAC+TGG	0.466451	4:+56441014	None:intergenic
GAAAACATGGTGAGAAGAAG+TGG	0.467136	4:-56442504	MsaT020669.1:CDS
TTCATTACTCCATGTAGCAT+TGG	0.470776	4:+56441619	None:intergenic
CCTCATTAACAATGTGAAAG+TGG	0.472482	4:+56441398	None:intergenic
CCATCTTTGCCAATGCTACA+TGG	0.474776	4:-56441628	MsaT020669.1:CDS
TTTGTCGCCATCAATGACTT+TGG	0.484591	4:+56442742	None:intergenic
ACCAGAATTTGCAGCTTCAT+CGG	0.488033	4:-56442678	MsaT020669.1:CDS
ATAGCAACCACTTCTGATTC+CGG	0.489329	4:+56442769	None:intergenic
TGGTGCACACAAGTCTTCTC+AGG	0.500242	4:+56442580	None:intergenic
AGAGCTTTGGGAGATTTGAC+AGG	0.501432	4:-56442547	MsaT020669.1:CDS
AGCAGCACCAATCTTGGAGG+TGG	0.501855	4:-56441304	MsaT020669.1:CDS
AAAGCTCATAGCAAGATTTG+TGG	0.506969	4:-56442436	MsaT020669.1:CDS
TGCAGATTTCACATAAGAAA+CGG	0.507472	4:+56442719	None:intergenic
GTCCACCACCATACTGGCTC+TGG	0.507855	4:+56441020	None:intergenic
GAATAAGTTGGTGAATTTGG+AGG	0.513790	4:-56441335	MsaT020669.1:CDS
AACATCATCAGAACCACCAT+TGG	0.518482	4:-56441755	MsaT020669.1:CDS
AATATGTTTGGGATTGTGAA+TGG	0.518566	4:-56441253	MsaT020669.1:CDS
CTCCAGAGCCAGTATGGTGG+TGG	0.533266	4:-56441022	MsaT020669.1:CDS
AAATGTATGATTCAGGTTCA+AGG	0.535524	4:-56441174	MsaT020669.1:CDS
TTCTGATATAATGCAAACAA+TGG	0.536311	4:-56441698	MsaT020669.1:CDS
AATAAGTTGGTGAATTTGGA+GGG	0.537676	4:-56441334	MsaT020669.1:CDS
TTGCAGAAAGAATCTCAAAT+GGG	0.545569	4:-56441475	MsaT020669.1:CDS
TACAAAGGATTTGGAACATG+TGG	0.546663	4:-56441230	MsaT020669.1:CDS
CTTATGTGAAATCTGCAACA+AGG	0.550563	4:-56442713	MsaT020669.1:CDS
CACATGAATGAATCCAGATC+CGG	0.553014	4:-56442788	None:intergenic
ACATCATCAGAACCACCATT+GGG	0.553100	4:-56441754	MsaT020669.1:CDS
TTAGTGTAATTTCCCAATGG+TGG	0.567890	4:+56441742	None:intergenic
AATAGCAGCACCAATCTTGG+AGG	0.592274	4:-56441307	MsaT020669.1:CDS
TGGGATTGTGAATGGTACAA+AGG	0.593396	4:-56441245	MsaT020669.1:CDS
AAGTGAAGAGTTGAATAAGT+TGG	0.597167	4:-56441347	MsaT020669.1:CDS
AATCTCAAATGGGATCTACA+AGG	0.601252	4:-56441465	MsaT020669.1:CDS
TCTGAGTGAAACTGAAAACC+AGG	0.601782	4:+56441793	None:intergenic
AGAGAGTACAAATGTGATTG+TGG	0.604424	4:-56442409	MsaT020669.1:CDS
GGCGAGGACACAACCTACCA+TGG	0.608097	4:-56442657	MsaT020669.1:CDS
TCCAGATCCGGAATCAGAAG+TGG	0.621390	4:-56442776	MsaT020669.1:CDS
GCAGCACCAATCTTGGAGGT+GGG	0.638474	4:-56441303	MsaT020669.1:CDS
AAACATTATAGTAGAAAACA+TGG	0.647572	4:-56442517	MsaT020669.1:CDS
ATGTTAGTGTAATTTCCCAA+TGG	0.651961	4:+56441739	None:intergenic
AATTTGCAGCTTCATCGGCG+AGG	0.683827	4:-56442673	MsaT020669.1:CDS
AATCTCCAGAGCCAGTATGG+TGG	0.695447	4:-56441025	MsaT020669.1:CDS
TTATTATAATTCAGCCACTG+TGG	0.703090	4:+56441658	None:intergenic
ACAAAGTGCAAAGATAACAA+CGG	0.712713	4:-56441890	MsaT020669.1:CDS
TGTTTGGATCACAACCACAG+TGG	0.860213	4:-56441672	MsaT020669.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr4	gene	56441009	56442803	56441009	ID=MsaG020669
Chr4	mRNA	56441009	56442803	56441009	ID=MsaT020669.1;Parent=MsaG020669
Chr4	exon	56441009	56441960	56441009	ID=MsaT020669.1.exon2;Parent=MsaT020669.1
Chr4	CDS	56441009	56441960	56441009	ID=cds.MsaT020669.1;Parent=MsaT020669.1
Chr4	exon	56442394	56442803	56442394	ID=MsaT020669.1.exon1;Parent=MsaT020669.1
Chr4	CDS	56442394	56442803	56442394	ID=cds.MsaT020669.1;Parent=MsaT020669.1

Gene Sequence

>MsaT020669.1

ATGAATCCAGATCCGGAATCAGAAGTGGTTGCTATGTCACCAAAGTCATTGATGGCGACAAACCGTTTCTTATGTGAAATCTGCAACAAGGGTTTCCAGAGAGACCAGAATTTGCAGCTTCATCGGCGAGGACACAACCTACCATGGAAGCTGAAGCAAAGAGCAAACAAAGATCAAATTCGAAAGAAGGTTTATGTGTGTCCTGAGAAGACTTGTGTGCACCATGAACCTTCTAGAGCTTTGGGAGATTTGACAGGAATAAAGAAACATTATAGTAGAAAACATGGTGAGAAGAAGTGGAAGTGTGAGAAGTGTTCCAAGAAATATGCAGTTCAATCTGATTGGAAAGCTCATAGCAAGATTTGTGGAACTAGAGAGTACAAATGTGATTGTGGCACAATTTTCTCCAGGAAGGACAGCTTCATAACACATAGAGCTTTTTGTGATGCATTAACTGAACAAAGTGCAAAGATAACAACGGTTCCAGCAGCATTAAGCAACTTTCGGAATGATCATTTGACGAATACTCAAACTCCAAGAATTCCTCATATTTTTCCTGGTTTTCAGTTTCACTCAGAATTTGGTAATTCAGCAACATCATCAGAACCACCATTGGGAAATTACACTAACATTTCTCATCTTCATCAAAATTCTGATATAATGCAAACAATGGATGTGTTTGGATCACAACCACAGTGGCTGAATTATAATAATACTAATCCATCTTTGCCAATGCTACATGGAGTAATGAAACAAGAACAAGAAGAAAACAAAGATTTGTCTGCTAGTGTAATAAGCTCTTTGTACTTGAGTAGAAGTCAGAATCAGAATCAACAAGAAGCACCAAATCACTTGTCAGTAACAACATCACTGTTGCAGAAAGAATCTCAAATGGGATCTACAAGGACAATAATTACCAATGATAATAACACAGTCTTCAACAATTTGAACCACTTTCACATTGTTAATGAGGTTCAGAAATTTTATAACAAGCAATGTGAAAGTGAAGAGTTGAATAAGTTGGTGAATTTGGAGGGAAGCAATAGCAGCACCAATCTTGGAGGTGGGTATTTATTAAATGATTCAAATTCAAACAATATGTTTGGGATTGTGAATGGTACAAAGGATTTGGAACATGTGGTTTTGTCTGTGGATAAAGAGACAACAAATAGACAAATGTATGATTCAGGTTCAAGGTCAAAAGAAAAAAACCAAATGGGTTTTACAAGAGATTTTCTTGGGGTTGGAGAAGATGTCTCAATGAGTAGACCTTTTTTGCAGCAAGAACTTGGTGAGTTTAATGGAATGGGATCATTAGGAAATAATCTCCAGAGCCAGTATGGTGGTGGACACTACTGCTAG

Protein sequence

>MsaT020669.1

MNPDPESEVVAMSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQRANKDQIRKKVYVCPEKTCVHHEPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYKCDCGTIFSRKDSFITHRAFCDALTEQSAKITTVPAALSNFRNDHLTNTQTPRIPHIFPGFQFHSEFGNSATSSEPPLGNYTNISHLHQNSDIMQTMDVFGSQPQWLNYNNTNPSLPMLHGVMKQEQEENKDLSASVISSLYLSRSQNQNQQEAPNHLSVTTSLLQKESQMGSTRTIITNDNNTVFNNLNHFHIVNEVQKFYNKQCESEELNKLVNLEGSNSSTNLGGGYLLNDSNSNNMFGIVNGTKDLEHVVLSVDKETTNRQMYDSGSRSKEKNQMGFTRDFLGVGEDVSMSRPFLQQELGEFNGMGSLGNNLQSQYGGGHYC*