AlfalfaGEDB | MsaG029979

M. sativa ssp. caerulea / MsaG029979

KEGG: -
GO: -
PFAM: PF03195.17

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG029979	sp\|Q9STS6\|LBD27_ARATH	51.471	68	32	1	1	68	64	130	1.18e-12	69.3

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG029979	tr\|A0A072UGP3\|A0A072UGP3_MEDTR	88.942	208	23	0	1	208	37	244	2.49e-133	384

TFs/TRs:

Gene ID	Type	Classification
MsaG029979	TF	LOB

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000228	MsaG029979	0.819835	1.650222e-52	3.613413e-50
MsaG000439	MsaG029979	0.810344	2.066186e-50	3.558285e-48
MsaG000534	MsaG029979	0.804046	4.395267e-49	6.517985e-47
MsaG001286	MsaG029979	0.840169	1.889663e-57	7.415823e-55
MsaG001377	MsaG029979	0.801740	1.309133e-48	1.841089e-46
MsaG001399	MsaG029979	0.804356	3.790940e-49	5.662204e-47
MsaG001558	MsaG029979	0.831609	2.733995e-55	8.288050e-53
MsaG003039	MsaG029979	0.834239	6.113670e-56	2.001682e-53
MsaG003016	MsaG029979	0.806470	1.372690e-49	2.154215e-47
MsaG003163	MsaG029979	0.801105	1.764480e-48	2.445871e-46
MsaG003245	MsaG029979	0.806976	1.074514e-49	1.706391e-47
MsaG003521	MsaG029979	0.816375	9.916370e-52	1.984990e-49
MsaG003863	MsaG029979	0.801991	1.163651e-48	1.645804e-46
MsaG003912	MsaG029979	0.804018	4.454049e-49	6.600733e-47
MsaG004092	MsaG029979	0.832088	2.085679e-55	6.411780e-53
MsaG004257	MsaG029979	0.803589	5.462165e-49	8.014444e-47
MsaG005239	MsaG029979	0.854255	2.681058e-61	1.686792e-58
MsaG007335	MsaG029979	0.824405	1.455118e-53	3.601396e-51
MsaG007626	MsaG029979	0.800699	2.133456e-48	2.930557e-46
MsaG007796	MsaG029979	0.823545	2.309938e-53	5.585091e-51
MsaG007967	MsaG029979	0.822680	3.668557e-53	8.664712e-51
MsaG008250	MsaG029979	0.809967	2.489345e-50	4.247601e-48
MsaG008436	MsaG029979	0.811453	1.191580e-50	2.108447e-48
MsaG008863	MsaG029979	0.829228	1.038067e-54	2.938234e-52
MsaG009067	MsaG029979	0.809076	3.858889e-50	6.444634e-48
MsaG009370	MsaG029979	0.810394	2.015520e-50	3.475268e-48
MsaG009860	MsaG029979	0.821759	5.986869e-53	1.379492e-50
MsaG010058	MsaG029979	0.806590	1.295447e-49	2.038696e-47
MsaG010372	MsaG029979	0.803463	5.798704e-49	8.483556e-47
MsaG010676	MsaG029979	0.813933	3.435439e-51	6.465497e-49
MsaG011018	MsaG029979	0.835923	2.309286e-56	7.952339e-54
MsaG011405	MsaG029979	0.823030	3.044001e-53	7.257910e-51
MsaG011812	MsaG029979	0.804469	3.591693e-49	5.378496e-47
MsaG012445	MsaG029979	0.817350	6.004357e-52	1.232443e-49
MsaG012496	MsaG029979	0.816142	1.117414e-51	2.223566e-49
MsaG042116	MsaG029979	0.845202	8.824928e-59	4.070439e-56
MsaG044319	MsaG029979	0.807491	8.369297e-50	1.345444e-47
MsaG044821	MsaG029979	0.800318	2.548665e-48	3.470736e-46
MsaG045546	MsaG029979	0.817719	4.962025e-52	1.028191e-49
MsaG045699	MsaG029979	0.834591	4.992290e-56	1.651935e-53
MsaG045820	MsaG029979	0.802038	1.137991e-48	1.611242e-46
MsaG046312	MsaG029979	0.805625	2.063921e-49	3.174813e-47
MsaG009209	MsaG029979	0.813476	4.328091e-51	8.052255e-49
MsaG010534	MsaG029979	0.818383	3.519297e-52	7.418424e-50
MsaG007511	MsaG029979	0.812034	8.921190e-51	1.601215e-48
MsaG009163	MsaG029979	0.807433	8.608028e-50	1.381917e-47
MsaG013007	MsaG029979	0.823706	2.119560e-53	5.147357e-51
MsaG021945	MsaG029979	0.818409	3.471345e-52	7.322324e-50
MsaG019690	MsaG029979	0.801603	1.396447e-48	1.957734e-46
MsaG020273	MsaG029979	0.805444	2.250731e-49	3.447629e-47
MsaG020277	MsaG029979	0.827769	2.327147e-54	6.322877e-52
MsaG019828	MsaG029979	0.827144	3.281467e-54	8.760745e-52
MsaG030006	MsaG029979	0.821459	7.018852e-53	1.604415e-50
MsaG031428	MsaG029979	0.824200	1.624867e-53	3.999054e-51
MsaG029979	MsaG032683	0.805171	2.566716e-49	3.906861e-47
MsaG029979	MsaG033058	0.811401	1.223283e-50	2.161752e-48
MsaG029979	MsaG038152	0.806140	1.610293e-49	2.507257e-47
MsaG029979	MsaG045013	0.814077	3.195309e-51	6.035024e-49
MsaG013267	MsaG029979	0.847677	1.877774e-59	9.406646e-57
MsaG015025	MsaG029979	0.831617	2.721906e-55	8.253205e-53
MsaG015527	MsaG029979	0.843768	2.135290e-58	9.397529e-56
MsaG016819	MsaG029979	0.831839	2.400889e-55	7.327521e-53
MsaG017303	MsaG029979	0.829976	6.841523e-55	1.978678e-52
MsaG017183	MsaG029979	0.811535	1.144252e-50	2.028733e-48
MsaG017391	MsaG029979	0.819715	1.756766e-52	3.834578e-50
MsaG017908	MsaG029979	0.813720	3.827058e-51	7.163712e-49
MsaG018006	MsaG029979	0.826477	4.727829e-54	1.239027e-51
MsaG018175	MsaG029979	0.826230	5.408999e-54	1.407774e-51
MsaG018212	MsaG029979	0.846101	5.044973e-59	2.397475e-56
MsaG018334	MsaG029979	0.804007	4.477821e-49	6.634204e-47
MsaG018511	MsaG029979	0.810073	2.362544e-50	4.041679e-48
MsaG018842	MsaG029979	0.890232	2.611095e-73	7.787751e-70
MsaG018960	MsaG029979	0.802637	8.579158e-49	1.231489e-46
MsaG019308	MsaG029979	0.813175	5.034306e-51	9.296031e-49
MsaG020361	MsaG029979	0.809227	3.582632e-50	6.004773e-48
MsaG020449	MsaG029979	0.813478	4.324026e-51	8.045043e-49
MsaG020716	MsaG029979	0.820514	1.155387e-52	2.575934e-50
MsaG021017	MsaG029979	0.819803	1.678215e-52	3.671620e-50
MsaG021667	MsaG029979	0.807734	7.435781e-50	1.202379e-47
MsaG022866	MsaG029979	0.810967	1.517803e-50	2.653793e-48
MsaG023962	MsaG029979	0.817427	5.772547e-52	1.187219e-49
MsaG024958	MsaG029979	0.820676	1.061250e-52	2.376051e-50
MsaG027395	MsaG029979	0.829474	9.056095e-55	2.581657e-52
MsaG027505	MsaG029979	0.812539	6.928570e-51	1.259273e-48
MsaG027950	MsaG029979	0.819892	1.601253e-52	3.511640e-50
MsaG028250	MsaG029979	0.822381	4.301569e-53	1.007853e-50
MsaG028367	MsaG029979	0.806587	1.297614e-49	2.041952e-47
MsaG028708	MsaG029979	0.809952	2.506879e-50	4.276117e-48
MsaG028711	MsaG029979	0.811441	1.198901e-50	2.120745e-48
MsaG029097	MsaG029979	0.835873	2.377807e-56	8.175747e-54
MsaG031201	MsaG029979	0.800581	2.254622e-48	3.088688e-46
MsaG033625	MsaG029979	0.816240	1.062674e-51	2.119886e-49
MsaG033768	MsaG029979	0.853784	3.658331e-61	2.263100e-58
MsaG033818	MsaG029979	0.800615	2.218553e-48	3.041673e-46
MsaG033985	MsaG029979	0.834094	6.643163e-56	2.165632e-53
MsaG033987	MsaG029979	0.817760	4.859825e-52	1.008079e-49
MsaG034234	MsaG029979	0.805467	2.226322e-49	3.412006e-47
MsaG034336	MsaG029979	0.802125	1.092518e-48	1.549903e-46
MsaG035171	MsaG029979	0.821573	6.605821e-53	1.514618e-50
MsaG035149	MsaG029979	0.815360	1.666009e-51	3.250024e-49
MsaG035317	MsaG029979	0.840285	1.762779e-57	6.943417e-55
MsaG035947	MsaG029979	0.806922	1.103489e-49	1.750116e-47
MsaG036152	MsaG029979	0.814642	2.400285e-51	4.598120e-49
MsaG039251	MsaG029979	0.814084	3.182945e-51	6.012855e-49
MsaG039755	MsaG029979	0.816693	8.420418e-52	1.699331e-49
MsaG039963	MsaG029979	0.852572	8.106562e-61	4.804344e-58

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG029979	MtrunA17_Chr6g0452661	88.942	208	23	0	1	208	37	244	4.79e-137	384
MsaG029979	MtrunA17_Chr5g0439111	48.309	207	89	5	1	198	37	234	5.94e-38	132
MsaG029979	MtrunA17_Chr6g0452691	58.261	115	48	0	2	116	38	152	1.50e-37	129
MsaG029979	MtrunA17_Chr4g0055441	45.283	159	45	4	1	158	30	147	2.96e-31	112
MsaG029979	MtrunA17_Chr6g0452671	52.727	110	51	1	1	110	39	147	1.99e-30	112
MsaG029979	MtrunA17_Chr6g0449311	48.800	125	52	2	1	116	1	122	1.85e-27	102

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG029979	AT3G47870.1	51.471	68	32	1	1	68	64	130	1.20e-13	69.3
MsaG029979	AT3G26660.1	33.784	74	48	1	2	75	34	106	1.12e-12	63.2
MsaG029979	AT3G26620.1	33.784	74	48	1	2	75	34	106	1.58e-12	62.8

Find 36 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TCTATATTAAAATCCGAATT+AGG	0.233663	6:-573556	None:intergenic
GAAGATACTAAACGAAATTA+AGG	0.321068	6:+573000	MsaT029979.1:CDS
AAACTTGAATATAAATTCTA+TGG	0.323327	6:+573375	MsaT029979.1:CDS
TACTAATGAATTACCTAATT+CGG	0.323845	6:+573543	MsaT029979.1:CDS
GAGAGTTAAAGCAATTAAAA+TGG	0.339508	6:+573149	MsaT029979.1:CDS
ATTGGACGATAATGAAGATT+TGG	0.353325	6:+573459	MsaT029979.1:CDS
ACACCAAGACATCCATGAAT+TGG	0.373425	6:-573088	None:intergenic
CACAAGTTCATCTATAGTAT+TGG	0.373526	6:-573587	None:intergenic
AAATTAGAACAACGTTTGAT+TGG	0.398339	6:+573497	MsaT029979.1:CDS
GGACAATGTCAAATTAGAAT+TGG	0.421588	6:+573441	MsaT029979.1:CDS
GGTGATGCTCATCGTTTGTT+TGG	0.422880	6:+572962	MsaT029979.1:CDS
TTTCCAATTCATGGATGTCT+TGG	0.430724	6:+573085	MsaT029979.1:CDS
AATTAGAACAACGTTTGATT+GGG	0.456356	6:+573498	MsaT029979.1:CDS
GGTGTTATTCATATGTATGC+AGG	0.474469	6:+573106	MsaT029979.1:CDS
AACACTTGAAAACTAGTAGA+AGG	0.479558	6:-573232	None:intergenic
TTGAAAACTAGTAGAAGGTA+TGG	0.492432	6:-573227	None:intergenic
TTTAACAATTATAGTGATGT+TGG	0.493308	6:+573253	MsaT029979.1:CDS
ATATAAATTCTATGGATACA+AGG	0.500818	6:+573383	MsaT029979.1:CDS
GCCGATAAACCAAAGATGTT+CGG	0.515100	6:+572941	None:intergenic
TAGAACAACGTTTGATTGGG+AGG	0.515464	6:+573501	MsaT029979.1:CDS
AGAGAATTATTAACATCATG+AGG	0.523658	6:-573343	None:intergenic
AATTTGACATTGTCCCCACC+AGG	0.540239	6:-573433	None:intergenic
TCACTAACATAAGAAGAAGA+TGG	0.561786	6:-573313	None:intergenic
AATACTATAGATGAACTTGT+GGG	0.564247	6:+573589	MsaT029979.1:CDS
CAATACTATAGATGAACTTG+TGG	0.567646	6:+573588	MsaT029979.1:CDS
GAGAATTATTAACATCATGA+GGG	0.570604	6:-573342	None:intergenic
TATAAATTCTATGGATACAA+GGG	0.572771	6:+573384	MsaT029979.1:CDS
ATTATTAACATCATGAGGGG+TGG	0.592676	6:-573338	None:intergenic
TTGAGTGGTGATAACAATCC+TGG	0.603575	6:+573415	MsaT029979.1:CDS
ATACTAAACGAAATTAAGGA+TGG	0.622219	6:+573004	MsaT029979.1:CDS
ACAAGGGTTGCGAAATTGAG+TGG	0.626304	6:+573400	MsaT029979.1:CDS
AGAATTATTAACATCATGAG+GGG	0.631491	6:-573341	None:intergenic
GATGCATCTGAATTCAACAC+AGG	0.655939	6:+573616	MsaT029979.1:CDS
GTGGTGATAACAATCCTGGT+GGG	0.677314	6:+573419	MsaT029979.1:CDS
AGTGGTGATAACAATCCTGG+TGG	0.728841	6:+573418	MsaT029979.1:CDS
TGGTGATAACAATCCTGGTG+GGG	0.737923	6:+573420	MsaT029979.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr6	gene	572956	573750	572956	ID=MsaG029979
Chr6	mRNA	572956	573750	572956	ID=MsaT029979.1;Parent=MsaG029979
Chr6	exon	572956	573637	572956	ID=MsaT029979.1.exon1;Parent=MsaT029979.1
Chr6	CDS	572956	573637	572956	ID=cds.MsaT029979.1;Parent=MsaT029979.1
Chr6	exon	573731	573750	573731	ID=MsaT029979.1.exon2;Parent=MsaT029979.1
Chr6	CDS	573731	573750	573731	ID=cds.MsaT029979.1;Parent=MsaT029979.1

Gene Sequence

>MsaT029979.1

ATGTTCGGTGATGCTCATCGTTTGTTTGGTGTTTCAAACATACAGAAGATACTAAACGAAATTAAGGATGGTGATAAAAAAGATGAAGCAATGAAATCAATTATTTTTGAGTCGAAAATTCGTGCAAATTTTCCAATTCATGGATGTCTTGGTGTTATTCATATGTATGCAGGTATGATTAATGAGTCTTCTAGAGAGTTAAAGCAATTAAAATGGCTATTAGCTTATTGTAAGCAAAACAACCATTTACAACAACAAAATCTTTATTCTTCCATACCTTCTACTAGTTTTCAAGTGTTTAACAATTATAGTGATGTTGGTGATTATTATCACAATACTGAAAATAATATGATGATACCATCTTCTTCTTATGTTAGTGAAACCACCCCTCATGATGTTAATAATTCTCTAATTGATACAAACTTGAATATAAATTCTATGGATACAAGGGTTGCGAAATTGAGTGGTGATAACAATCCTGGTGGGGACAATGTCAAATTAGAATTGGACGATAATGAAGATTTGGACGACTTTGATATACAAATTAGAACAACGTTTGATTGGGAGGAAAAAGAAGGATTTTTAGATACTAATGAATTACCTAATTCGGATTTTAATATAGATGAATGGTCCAATACTATAGATGAACTTGTGGGAAGAGATGCATCTGAATTCAACACAGGGTTGACAATTTTCATTTAA

Protein sequence

>MsaT029979.1

MFGDAHRLFGVSNIQKILNEIKDGDKKDEAMKSIIFESKIRANFPIHGCLGVIHMYAGMINESSRELKQLKWLLAYCKQNNHLQQQNLYSSIPSTSFQVFNNYSDVGDYYHNTENNMMIPSSSYVSETTPHDVNNSLIDTNLNINSMDTRVAKLSGDNNPGGDNVKLELDDNEDLDDFDIQIRTTFDWEEKEGFLDTNELPNSDFNIDEWSNTIDELVGRDASEFNTGLTIFI*