AlfalfaGEDB | MsaG030345

M. sativa ssp. caerulea / MsaG030345

KEGG: -
GO: -
PFAM: PF00249.34

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG030345	sp\|Q58FS3\|RAD_ANTMA	61.111	72	28	0	3	74	2	73	8.53e-31	106

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG030345	tr\|A0A072UG34\|A0A072UG34_MEDTR	97.436	78	2	0	4	81	2	79	8.25e-50	160

TFs/TRs:

Gene ID	Type	Classification
MsaG030345	TF	MYB-related

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000113	MsaG030345	0.801903	1.212746e-48	1.711867e-46
MsaG000490	MsaG030345	0.800524	2.315045e-48	3.167354e-46
MsaG000976	MsaG030345	0.813464	4.352834e-51	8.095967e-49
MsaG001196	MsaG030345	0.805405	2.293887e-49	3.510475e-47
MsaG001403	MsaG030345	0.815997	1.203123e-51	2.385241e-49
MsaG001434	MsaG030345	0.810380	2.029322e-50	3.497866e-48
MsaG001558	MsaG030345	0.816918	7.502471e-52	1.522937e-49
MsaG001600	MsaG030345	0.819342	2.136013e-52	4.617265e-50
MsaG001809	MsaG030345	0.806264	1.516382e-49	2.368116e-47
MsaG002184	MsaG030345	0.807386	8.807110e-50	1.412281e-47
MsaG002201	MsaG030345	0.804691	3.230348e-49	4.862252e-47
MsaG002878	MsaG030345	0.800702	2.130412e-48	2.926564e-46
MsaG003149	MsaG030345	0.815702	1.398852e-51	2.752635e-49
MsaG003937	MsaG030345	0.822035	5.171976e-53	1.200548e-50
MsaG003963	MsaG030345	0.803382	6.027276e-49	8.801487e-47
MsaG003964	MsaG030345	0.806955	1.085656e-49	1.723214e-47
MsaG005201	MsaG030345	0.803636	5.340846e-49	7.844900e-47
MsaG005217	MsaG030345	0.806264	1.516382e-49	2.368116e-47
MsaG005294	MsaG030345	0.811085	1.430847e-50	2.509077e-48
MsaG006052	MsaG030345	0.807062	1.031033e-49	1.640629e-47
MsaG006120	MsaG030345	0.823795	2.019985e-53	4.917422e-51
MsaG006254	MsaG030345	0.803266	6.367075e-49	9.272731e-47
MsaG007254	MsaG030345	0.823594	2.250351e-53	5.448377e-51
MsaG007426	MsaG030345	0.803488	5.730091e-49	8.388012e-47
MsaG007480	MsaG030345	0.804743	3.151007e-49	4.748694e-47
MsaG007626	MsaG030345	0.811955	9.278035e-51	1.662088e-48
MsaG008081	MsaG030345	0.828391	1.651742e-54	4.566888e-52
MsaG008193	MsaG030345	0.806129	1.618738e-49	2.519778e-47
MsaG008915	MsaG030345	0.802528	9.033308e-49	1.293441e-46
MsaG010098	MsaG030345	0.807258	9.374559e-50	1.498648e-47
MsaG010850	MsaG030345	0.803135	6.776676e-49	9.839401e-47
MsaG011248	MsaG030345	0.825255	9.192270e-54	2.328519e-51
MsaG011773	MsaG030345	0.808069	6.316051e-50	1.029566e-47
MsaG011775	MsaG030345	0.802311	1.000712e-48	1.425775e-46
MsaG012339	MsaG030345	0.809775	2.735803e-50	4.646736e-48
MsaG013191	MsaG030345	0.800965	1.883491e-48	2.602637e-46
MsaG015382	MsaG030345	0.804628	3.328554e-49	5.002785e-47
MsaG015836	MsaG030345	0.833130	1.153534e-55	3.655568e-53
MsaG017198	MsaG030345	0.802099	1.105739e-48	1.567741e-46
MsaG017459	MsaG030345	0.812258	7.976281e-51	1.439514e-48
MsaG017771	MsaG030345	0.800678	2.154556e-48	2.958120e-46
MsaG018059	MsaG030345	0.806323	1.474200e-49	2.305389e-47
MsaG018263	MsaG030345	0.800631	2.202728e-48	3.021026e-46
MsaG018351	MsaG030345	0.815178	1.827645e-51	3.548891e-49
MsaG018670	MsaG030345	0.802603	8.717707e-49	1.250406e-46
MsaG018780	MsaG030345	0.800631	2.202728e-48	3.021026e-46
MsaG018875	MsaG030345	0.815935	1.242094e-51	2.458634e-49
MsaG018997	MsaG030345	0.835717	2.602668e-56	8.906854e-54
MsaG019572	MsaG030345	0.801898	1.215684e-48	1.715824e-46
MsaG019906	MsaG030345	0.844145	1.693930e-58	7.547165e-56
MsaG020294	MsaG030345	0.802359	9.782791e-49	1.395362e-46
MsaG021084	MsaG030345	0.850382	3.353184e-60	1.841242e-57
MsaG021087	MsaG030345	0.814259	2.914067e-51	5.529072e-49
MsaG021108	MsaG030345	0.804149	4.183597e-49	6.218814e-47
MsaG022302	MsaG030345	0.805347	2.358172e-49	3.604111e-47
MsaG022955	MsaG030345	0.801258	1.641679e-48	2.283588e-46
MsaG023119	MsaG030345	0.800766	2.067963e-48	2.844835e-46
MsaG025282	MsaG030345	0.805684	2.005803e-49	3.089715e-47
MsaG027160	MsaG030345	0.818123	4.027059e-52	8.432164e-50
MsaG027359	MsaG030345	0.807091	1.016300e-49	1.618331e-47
MsaG027414	MsaG030345	0.808769	4.485572e-50	7.436182e-48
MsaG027447	MsaG030345	0.837125	1.145473e-56	4.090103e-54
MsaG028043	MsaG030345	0.806311	1.482543e-49	2.317800e-47
MsaG028487	MsaG030345	0.803517	5.652852e-49	8.280490e-47
MsaG028664	MsaG030345	0.812986	5.536442e-51	1.017502e-48
MsaG028990	MsaG030345	0.805948	1.766731e-49	2.738338e-47
MsaG029545	MsaG030345	0.818916	2.666736e-52	5.700042e-50
MsaG030342	MsaG030345	0.916565	3.832380e-85	5.637711e-81
MsaG030345	MsaG030944	0.816171	1.100703e-51	2.191913e-49
MsaG030345	MsaG031645	0.800026	2.921167e-48	3.951936e-46
MsaG030345	MsaG031786	0.808836	4.340849e-50	7.207853e-48
MsaG030345	MsaG031787	0.814920	2.084048e-51	4.020515e-49
MsaG030345	MsaG034221	0.821935	5.453079e-53	1.262396e-50
MsaG030345	MsaG034149	0.835642	2.718910e-56	9.283946e-54
MsaG030345	MsaG034308	0.802178	1.065217e-48	1.513035e-46
MsaG030345	MsaG034398	0.820341	1.265585e-52	2.808840e-50
MsaG030345	MsaG034957	0.803618	5.387203e-49	7.909713e-47
MsaG030345	MsaG036204	0.809410	3.275210e-50	5.513992e-48
MsaG030345	MsaG040365	0.826360	5.040202e-54	1.316543e-51
MsaG030345	MsaG040763	0.801040	1.818923e-48	2.517647e-46
MsaG030345	MsaG041021	0.811059	1.449554e-50	2.540285e-48
MsaG030345	MsaG041210	0.804771	3.108226e-49	4.687277e-47
MsaG030345	MsaG041532	0.802470	9.280401e-49	1.327061e-46
MsaG030345	MsaG045212	0.801071	1.792713e-48	2.483092e-46
MsaG030345	MsaG045558	0.802912	7.531885e-49	1.087966e-46
MsaG030345	MsaG045648	0.805922	1.788976e-49	2.771109e-47
MsaG030345	MsaG046006	0.816863	7.715904e-52	1.563986e-49
MsaG030345	MsaG046265	0.801604	1.395601e-48	1.956610e-46
MsaG030345	MsaG046439	0.827373	2.894719e-54	7.777956e-52
MsaG030345	MsaG046903	0.816217	1.075246e-51	2.143710e-49
MsaG030345	MsaG047088	0.804152	4.178419e-49	6.211526e-47
MsaG030345	MsaG002955	0.813547	4.175084e-51	7.781583e-49
MsaG030345	MsaG001560	0.815254	1.757885e-51	3.420174e-49
MsaG030345	MsaG010441	0.826768	4.033500e-54	1.065578e-51
MsaG030345	MsaG013001	0.805518	2.172515e-49	3.333458e-47
MsaG030345	MsaG013409	0.803407	5.957154e-49	8.703890e-47
MsaG030345	MsaG020234	0.808158	6.046565e-50	9.877567e-48
MsaG030345	MsaG028385	0.814844	2.165642e-51	4.169981e-49
MsaG030345	MsaG028036	0.813733	3.801737e-51	7.118793e-49
MsaG030345	MsaG033056	0.800836	2.001235e-48	2.757331e-46
MsaG030345	MsaG033256	0.806807	1.166374e-49	1.844892e-47
MsaG030345	MsaG033438	0.829631	8.294277e-55	2.375292e-52
MsaG030345	MsaG031702	0.801290	1.617461e-48	2.251518e-46
MsaG030345	MsaG037840	0.810237	2.178590e-50	3.741969e-48
MsaG030345	MsaG039380	0.831853	2.382755e-55	7.274973e-53
MsaG030345	MsaG040619	0.800050	2.887793e-48	3.908946e-46
MsaG030345	MsaG037389	0.818363	3.555330e-52	7.490629e-50
MsaG030345	MsaG036743	0.800860	1.978267e-48	2.727189e-46

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG030345	MtrunA17_Chr6g0449111	97.436	78	2	0	4	81	2	79	1.59e-53	160
MsaG030345	MtrunA17_Chr7g0255841	75.410	61	15	0	14	74	14	74	3.94e-32	107
MsaG030345	MtrunA17_Chr3g0081631	64.865	74	25	1	4	76	2	75	1.49e-31	105
MsaG030345	MtrunA17_Chr1g0155181	57.143	70	30	0	7	76	2	71	8.69e-28	95.9
MsaG030345	MtrunA17_Chr3g0144631	56.410	78	30	1	1	74	1	78	1.06e-26	93.2
MsaG030345	MtrunA17_Chr5g0404101	56.338	71	31	0	4	74	11	81	1.25e-25	90.9
MsaG030345	MtrunA17_Chr8g0373111	57.576	66	27	1	9	74	2	66	2.63e-25	89.4
MsaG030345	MtrunA17_Chr8g0373121	57.576	66	27	1	9	74	2	66	2.63e-25	89.4
MsaG030345	MtrunA17_Chr8g0373131	57.576	66	27	1	9	74	2	66	2.76e-25	89.4
MsaG030345	MtrunA17_Chr3g0141601	54.286	70	32	0	7	76	2	71	6.75e-25	89.0
MsaG030345	MtrunA17_Chr8g0373101	51.471	68	32	1	9	76	2	68	1.67e-21	79.7
MsaG030345	MtrunA17_Chr5g0404301	53.968	63	28	1	10	72	2	63	2.68e-21	79.0
MsaG030345	MtrunA17_Chr5g0436501	51.471	68	33	0	7	74	22	89	3.32e-19	78.6
MsaG030345	MtrunA17_Chr3g0141641	47.619	63	33	0	12	74	3	65	4.07e-18	71.6
MsaG030345	MtrunA17_Chr5g0429521	47.222	72	38	0	9	80	26	97	4.27e-18	75.9
MsaG030345	MtrunA17_Chr8g0365011	56.061	66	29	0	9	74	5	70	4.94e-18	75.5
MsaG030345	MtrunA17_Chr3g0104071	46.154	78	42	0	3	80	34	111	1.39e-17	74.7
MsaG030345	MtrunA17_Chr1g0162081	48.649	74	38	0	1	74	1	74	1.48e-17	74.3
MsaG030345	MtrunA17_Chr7g0241761	46.377	69	37	0	7	75	30	98	1.70e-17	74.3
MsaG030345	MtrunA17_Chr8g0364741	50.000	68	34	0	7	74	5	72	1.00e-16	68.9
MsaG030345	MtrunA17_Chr7g0270711	49.206	63	31	1	8	69	7	69	1.47e-15	65.1
MsaG030345	MtrunA17_Chr4g0062741	45.946	74	37	1	6	76	2	75	2.03e-15	68.6
MsaG030345	MtrunA17_Chr1g0194071	48.333	60	30	1	10	68	9	68	9.03e-15	63.2
MsaG030345	MtrunA17_Chr1g0210471	43.284	67	38	0	10	76	22	88	1.72e-14	65.5

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG030345	AT1G75250.2	60.811	74	29	0	1	74	1	74	3.03e-30	102
MsaG030345	AT1G75250.1	60.811	74	29	0	1	74	1	74	9.09e-30	102
MsaG030345	AT2G21650.1	66.667	63	21	0	12	74	14	76	1.21e-29	101
MsaG030345	AT4G39250.1	68.254	63	20	0	12	74	14	76	1.24e-29	101
MsaG030345	AT1G19510.1	62.069	58	22	0	17	74	17	74	6.12e-23	84.3
MsaG030345	AT2G18328.1	59.016	61	25	0	16	76	15	75	1.04e-22	83.2
MsaG030345	AT5G08520.1	47.436	78	41	0	1	78	1	78	6.21e-19	78.6
MsaG030345	AT5G05790.2	50.000	66	33	0	9	74	28	93	1.54e-17	74.3
MsaG030345	AT5G05790.1	50.000	66	33	0	9	74	28	93	1.54e-17	74.3
MsaG030345	AT5G58900.1	46.479	71	38	0	4	74	26	96	5.88e-17	73.2
MsaG030345	AT5G23650.1	51.471	68	33	0	7	74	8	75	6.81e-17	73.2
MsaG030345	AT4G36570.1	59.091	44	18	0	12	55	12	55	8.95e-17	67.8
MsaG030345	AT3G11280.2	46.250	80	43	0	1	80	22	101	1.14e-16	72.0
MsaG030345	AT3G11280.1	46.250	80	43	0	1	80	22	101	1.14e-16	72.0
MsaG030345	AT2G38090.1	48.485	66	34	0	9	74	26	91	1.37e-16	72.0
MsaG030345	AT1G49010.1	43.662	71	37	1	7	74	3	73	3.97e-14	65.5
MsaG030345	AT5G01200.1	46.154	65	34	1	11	74	29	93	6.99e-12	58.9

Find 25 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ATGAATTAAGTGGGATGTTT+AGG	0.212233	6:-6726994	None:intergenic
TAATGGCTCTTGACTTGTTC+AGG	0.298811	6:-6726904	None:intergenic
GACATTCACCTTATTGAATC+AGG	0.315005	6:+6726943	MsaT030345.1:CDS
GCAATATTGTACCAACGTTC+AGG	0.389152	6:-6726859	None:intergenic
TGAATTAAGTGGGATGTTTA+GGG	0.390410	6:-6726993	None:intergenic
TACAATATTGCTAAGGTTGT+TGG	0.405177	6:+6726871	MsaT030345.1:CDS
ATTCCATGTAGTACTGGAAC+TGG	0.418503	6:-6726782	None:intergenic
GAACTTGGCCTGATTCAATA+AGG	0.435223	6:-6726951	None:intergenic
CTTGGAGAAGGAGTTGATAA+TGG	0.437914	6:-6726921	None:intergenic
TGTTTAGGGTTGGTGTAGGA+AGG	0.453885	6:-6726979	None:intergenic
TGTAGGAAGGAAAGGGAACT+TGG	0.465307	6:-6726966	None:intergenic
TTCAACATTCCATGTAGTAC+TGG	0.497227	6:-6726788	None:intergenic
ATTCAATAAGGTGAATGTCT+TGG	0.499836	6:-6726939	None:intergenic
AGGGTTGGTGTAGGAAGGAA+AGG	0.512474	6:-6726974	None:intergenic
TGTAGTACTGGAACTGGATG+AGG	0.512918	6:-6726776	None:intergenic
AATATTGCTAAGGTTGTTGG+TGG	0.514753	6:+6726874	MsaT030345.1:CDS
CATCCAGTTCCAGTACTACA+TGG	0.515242	6:+6726779	MsaT030345.1:CDS
TATCATGTGAATGAATTAAG+TGG	0.556901	6:-6727004	None:intergenic
GGGATGTTTAGGGTTGGTGT+AGG	0.558762	6:-6726983	None:intergenic
TTAAGTGGGATGTTTAGGGT+TGG	0.568489	6:-6726989	None:intergenic
TAAGGTGAATGTCTTGGAGA+AGG	0.573238	6:-6726933	None:intergenic
GGGTTGGTGTAGGAAGGAAA+GGG	0.579312	6:-6726973	None:intergenic
ATCATGTGAATGAATTAAGT+GGG	0.592475	6:-6727003	None:intergenic
ACGTTGGTACAATATTGCTA+AGG	0.612999	6:+6726864	MsaT030345.1:CDS
ACAAAGACACACCTGAACGT+TGG	0.679810	6:+6726848	MsaT030345.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr6	gene	6726766	6727011	6726766	ID=MsaG030345
Chr6	mRNA	6726766	6727011	6726766	ID=MsaT030345.1;Parent=MsaG030345
Chr6	exon	6726766	6727011	6726766	ID=MsaT030345.1.exon1;Parent=MsaT030345.1
Chr6	CDS	6726766	6727011	6726766	ID=cds.MsaT030345.1;Parent=MsaT030345.1

Gene Sequence	>MsaT030345.1 ATGTCTTCTTCCTCATCCAGTTCCAGTACTACATGGAATGTTGAAGACAATAAAGCTTTTGAAAGAGCTCTAGCAGTTTATGACAAAGACACACCTGAACGTTGGTACAATATTGCTAAGGTTGTTGGTGGAAAAACTCCTGAACAAGTCAAGAGCCATTATCAACTCCTTCTCCAAGACATTCACCTTATTGAATCAGGCCAAGTTCCCTTTCCTTCCTACACCAACCCTAAACATCCCACTTAA
Protein sequence	>MsaT030345.1 MSSSSSSSSTTWNVEDNKAFERALAVYDKDTPERWYNIAKVVGGKTPEQVKSHYQLLLQDIHLIESGQVPFPSYTNPKHPT*