AlfalfaGEDB | MsaG033330

M. sativa ssp. caerulea / MsaG033330

KEGG: K02218
GO: -
PFAM: PF00069.28

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG033330	XP_003627159.1	83.544	158	18	2	1	152	1	156	1.42e-87	273

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG033330	sp\|Q9CAI5\|CKL2_ARATH	75.949	158	30	2	1	152	1	156	1.33e-84	258

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG033330	tr\|G7LI85\|G7LI85_MEDTR	83.544	158	18	2	1	152	1	156	6.78e-88	273

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000566	MsaG033330	0.875793	4.834566e-68	7.203112e-65
MsaG000521	MsaG033330	0.803179	6.637286e-49	9.646871e-47
MsaG001120	MsaG033330	0.806317	1.478229e-49	2.311397e-47
MsaG001127	MsaG033330	0.821212	7.998786e-53	1.816569e-50
MsaG001772	MsaG033330	0.844185	1.653069e-58	7.374635e-56
MsaG001858	MsaG033330	0.813105	5.216579e-51	9.615437e-49
MsaG002290	MsaG033330	0.818777	2.867457e-52	6.106688e-50
MsaG002810	MsaG033330	0.859965	5.637416e-63	4.377187e-60
MsaG003512	MsaG033330	0.838760	4.370669e-57	1.641338e-54
MsaG003517	MsaG033330	0.814357	2.773476e-51	5.275351e-49
MsaG004478	MsaG033330	0.848441	1.158530e-59	5.953751e-57
MsaG004685	MsaG033330	0.845117	9.300263e-59	4.278051e-56
MsaG004838	MsaG033330	0.827282	3.042163e-54	8.153318e-52
MsaG005204	MsaG033330	0.810372	2.037575e-50	3.511392e-48
MsaG005257	MsaG033330	0.892199	4.391868e-74	1.453691e-70
MsaG005414	MsaG033330	0.885253	2.055179e-71	4.766577e-68
MsaG005769	MsaG033330	0.834487	5.299593e-56	1.748173e-53
MsaG005881	MsaG033330	0.811831	9.871787e-51	1.763043e-48
MsaG005892	MsaG033330	0.829727	7.862040e-55	2.257628e-52
MsaG006021	MsaG033330	0.839312	3.149813e-57	1.203288e-54
MsaG006137	MsaG033330	0.807389	8.794256e-50	1.410323e-47
MsaG006066	MsaG033330	0.833259	1.071210e-55	3.407561e-53
MsaG006231	MsaG033330	0.818724	2.946674e-52	6.266761e-50
MsaG006563	MsaG033330	0.841813	7.025458e-58	2.904137e-55
MsaG006762	MsaG033330	0.808674	4.698410e-50	7.771447e-48
MsaG008062	MsaG033330	0.824850	1.144608e-53	2.867492e-51
MsaG008814	MsaG033330	0.819029	2.514132e-52	5.389992e-50
MsaG011095	MsaG033330	0.859375	8.466658e-63	6.428853e-60
MsaG011401	MsaG033330	0.813906	3.484089e-51	6.552466e-49
MsaG011563	MsaG033330	0.811024	1.475378e-50	2.583244e-48
MsaG011717	MsaG033330	0.813819	3.640337e-51	6.831483e-49
MsaG011805	MsaG033330	0.810178	2.242778e-50	3.846596e-48
MsaG012012	MsaG033330	0.802709	8.292698e-49	1.192279e-46
MsaG012155	MsaG033330	0.856948	4.430052e-62	3.072032e-59
MsaG012310	MsaG033330	0.803176	6.646647e-49	9.659737e-47
MsaG012442	MsaG033330	0.809281	3.488885e-50	5.855260e-48
MsaG012470	MsaG033330	0.831179	3.484788e-55	1.043158e-52
MsaG012565	MsaG033330	0.859971	5.616227e-63	4.361605e-60
MsaG042748	MsaG033330	0.819894	1.600014e-52	3.509046e-50
MsaG043118	MsaG033330	0.811993	9.103890e-51	1.632380e-48
MsaG045582	MsaG033330	0.836338	1.814650e-56	6.327415e-54
MsaG045600	MsaG033330	0.825185	9.549885e-54	2.414485e-51
MsaG046019	MsaG033330	0.814876	2.130736e-51	4.106098e-49
MsaG046245	MsaG033330	0.809331	3.404496e-50	5.720470e-48
MsaG046740	MsaG033330	0.860563	3.725439e-63	2.959696e-60
MsaG046830	MsaG033330	0.832605	1.554869e-55	4.851950e-53
MsaG000780	MsaG033330	0.870099	3.831229e-66	4.458603e-63
MsaG008213	MsaG033330	0.803875	4.768003e-49	7.042334e-47
MsaG008450	MsaG033330	0.809243	3.555268e-50	5.961190e-48
MsaG014174	MsaG033330	0.804544	3.464600e-49	5.197324e-47
MsaG020185	MsaG033330	0.843570	2.411425e-58	1.054561e-55
MsaG020545	MsaG033330	0.842423	4.855282e-58	2.046675e-55
MsaG022159	MsaG033330	0.802425	9.482010e-49	1.354501e-46
MsaG028381	MsaG033330	0.838896	4.033578e-57	1.521206e-54
MsaG028048	MsaG033330	0.843681	2.252669e-58	9.886980e-56
MsaG027785	MsaG033330	0.838115	6.399197e-57	2.355301e-54
MsaG033330	MsaG032681	0.815022	1.978418e-51	3.826591e-49
MsaG033330	MsaG033169	0.823450	2.431122e-53	5.862784e-51
MsaG033330	MsaG032721	0.806375	1.437437e-49	2.250674e-47
MsaG033330	MsaG031297	0.834942	4.077417e-56	1.363387e-53
MsaG033330	MsaG040323	0.837433	9.561322e-57	3.446421e-54
MsaG033330	MsaG036566	0.823563	2.287875e-53	5.534515e-51
MsaG033330	MsaG038220	0.832062	2.116906e-55	6.502770e-53
MsaG033330	MsaG043778	0.838824	4.208330e-57	1.583625e-54
MsaG012714	MsaG033330	0.806839	1.148714e-49	1.818289e-47
MsaG013952	MsaG033330	0.809047	3.913292e-50	6.531083e-48
MsaG014961	MsaG033330	0.872315	7.167776e-67	9.167808e-64
MsaG016416	MsaG033330	0.815003	1.997791e-51	3.862263e-49
MsaG016483	MsaG033330	0.807233	9.486809e-50	1.515695e-47
MsaG017498	MsaG033330	0.806088	1.651294e-49	2.567932e-47
MsaG017732	MsaG033330	0.818280	3.712218e-52	7.804242e-50
MsaG017849	MsaG033330	0.827588	2.570840e-54	6.949781e-52
MsaG017867	MsaG033330	0.828395	1.647604e-54	4.555944e-52
MsaG018098	MsaG033330	0.818264	3.741857e-52	7.863469e-50
MsaG018424	MsaG033330	0.879456	2.586530e-69	4.552695e-66
MsaG018783	MsaG033330	0.828304	1.732577e-54	4.778535e-52
MsaG018958	MsaG033330	0.805597	2.091610e-49	3.215280e-47
MsaG019041	MsaG033330	0.811150	1.385552e-50	2.433485e-48
MsaG019547	MsaG033330	0.817202	6.482710e-52	1.325586e-49
MsaG019582	MsaG033330	0.872537	6.047661e-67	7.809829e-64
MsaG020326	MsaG033330	0.800171	2.729166e-48	3.704208e-46
MsaG021157	MsaG033330	0.800112	2.805587e-48	3.802887e-46
MsaG021927	MsaG033330	0.801807	1.269006e-48	1.787351e-46
MsaG021996	MsaG033330	0.860200	4.792242e-63	3.754923e-60
MsaG022289	MsaG033330	0.821812	5.821331e-53	1.343225e-50
MsaG022767	MsaG033330	0.841172	1.034875e-57	4.191848e-55
MsaG023214	MsaG033330	0.863963	3.405135e-64	3.086645e-61
MsaG023553	MsaG033330	0.819796	1.684140e-52	3.683937e-50
MsaG023662	MsaG033330	0.800969	1.880577e-48	2.598823e-46
MsaG023957	MsaG033330	0.843510	2.501740e-58	1.091998e-55
MsaG024888	MsaG033330	0.831459	2.976040e-55	8.981849e-53
MsaG026765	MsaG033330	0.808743	4.542332e-50	7.525854e-48
MsaG027053	MsaG033330	0.835365	3.193096e-56	1.081301e-53
MsaG027127	MsaG033330	0.890999	1.308165e-73	4.061062e-70
MsaG027346	MsaG033330	0.820376	1.242328e-52	2.759721e-50
MsaG027626	MsaG033330	0.818207	3.854928e-52	8.089389e-50
MsaG027631	MsaG033330	0.802771	8.050806e-49	1.159158e-46
MsaG028188	MsaG033330	0.833802	7.855001e-56	2.538716e-53
MsaG028483	MsaG033330	0.825757	7.000168e-54	1.798060e-51
MsaG028875	MsaG033330	0.844237	1.601075e-58	7.154817e-56
MsaG028927	MsaG033330	0.806015	1.710532e-49	2.655354e-47
MsaG029074	MsaG033330	0.827922	2.139240e-54	5.837386e-52
MsaG029162	MsaG033330	0.810656	1.770743e-50	3.072637e-48
MsaG029539	MsaG033330	0.803052	7.047701e-49	1.021345e-46
MsaG029606	MsaG033330	0.803060	7.022149e-49	1.017810e-46
MsaG029986	MsaG033330	0.810814	1.636962e-50	2.851538e-48
MsaG030123	MsaG033330	0.816226	1.070421e-51	2.134597e-49
MsaG030712	MsaG033330	0.838808	4.249955e-57	1.598403e-54
MsaG032331	MsaG033330	0.833452	9.594366e-56	3.069318e-53
MsaG032401	MsaG033330	0.801564	1.422425e-48	1.992354e-46
MsaG032577	MsaG033330	0.812803	6.070381e-51	1.110538e-48
MsaG032583	MsaG033330	0.820423	1.212231e-52	2.696189e-50
MsaG036000	MsaG033330	0.855780	9.717303e-62	6.456850e-59
MsaG038145	MsaG033330	0.809542	3.069225e-50	5.183826e-48
MsaG038083	MsaG033330	0.803106	6.871029e-49	9.969926e-47
MsaG039683	MsaG033330	0.841844	6.896486e-58	2.853768e-55
MsaG040492	MsaG033330	0.851061	2.164788e-60	1.216985e-57
MsaG040452	MsaG033330	0.842195	5.574069e-58	2.332432e-55
MsaG041861	MsaG033330	0.808239	5.812555e-50	9.513821e-48

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG033330	MtrunA17_Chr8g0342821	83.544	158	18	2	1	152	1	156	1.31e-91	273
MsaG033330	MtrunA17_Chr2g0329981	79.114	158	25	2	1	152	1	156	1.38e-86	261
MsaG033330	MtrunA17_Chr4g0071031	78.481	158	26	2	1	152	1	156	4.33e-85	256
MsaG033330	MtrunA17_Chr2g0299661	71.519	158	37	2	1	152	1	156	5.23e-76	233
MsaG033330	MtrunA17_Chr1g0166821	68.182	154	41	2	5	152	6	157	1.27e-73	227
MsaG033330	MtrunA17_Chr1g0183631	66.456	158	45	2	1	152	1	156	6.33e-72	223
MsaG033330	MtrunA17_Chr7g0261501	64.557	158	48	2	1	152	1	156	8.54e-72	222
MsaG033330	MtrunA17_Chr1g0187571	65.823	158	46	2	1	152	2	157	3.55e-71	221
MsaG033330	MtrunA17_Chr6g0486611	62.658	158	51	2	1	152	1	156	3.02e-65	204
MsaG033330	MtrunA17_Chr1g0167261	58.228	158	58	2	1	152	2	157	3.31e-64	199
MsaG033330	MtrunA17_Chr8g0390211	60.759	158	54	2	1	152	1	156	3.66e-62	196
MsaG033330	MtrunA17_Chr3g0140071	56.962	158	60	2	1	152	1	156	1.25e-58	187
MsaG033330	MtrunA17_Chr1g0146151	54.430	158	64	2	1	152	1	156	1.77e-56	182
MsaG033330	MtrunA17_Chr1g0213321	31.646	158	92	4	9	152	119	274	2.00e-23	95.1
MsaG033330	MtrunA17_Chr7g0253211	33.333	168	92	5	4	152	317	483	4.30e-23	94.4
MsaG033330	MtrunA17_Chr7g0214531	31.288	163	91	5	9	152	37	197	3.54e-22	91.7
MsaG033330	MtrunA17_Chr1g0146301	31.210	157	93	5	9	152	124	278	4.34e-21	88.6
MsaG033330	MtrunA17_Chr3g0140431	32.484	157	91	5	9	152	38	192	5.49e-21	88.2
MsaG033330	MtrunA17_Chr8g0340491	31.098	164	91	5	9	152	128	289	7.73e-19	82.0
MsaG033330	MtrunA17_Chr4g0072831	31.126	151	84	5	1	149	2	134	3.76e-13	65.5
MsaG033330	MtrunA17_Chr4g0059951	33.121	157	92	5	4	149	68	222	1.72e-12	63.9

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG033330	AT1G72710.1	75.949	158	30	2	1	152	1	156	1.35e-85	258
MsaG033330	AT4G26100.1	75.949	158	30	2	1	152	1	156	5.46e-83	251
MsaG033330	AT5G57015.1	74.051	158	33	2	1	152	1	156	1.71e-81	247
MsaG033330	AT2G19470.1	72.785	158	35	2	1	152	1	156	1.26e-79	242
MsaG033330	AT1G03930.1	68.354	158	42	2	1	152	1	156	1.52e-75	233
MsaG033330	AT5G44100.1	66.456	158	45	2	1	152	1	156	4.36e-74	229
MsaG033330	AT5G44100.2	66.456	158	45	2	1	152	1	156	4.36e-74	229
MsaG033330	AT1G04440.1	63.924	158	49	2	1	152	1	156	1.03e-69	218
MsaG033330	AT5G43320.1	63.291	158	50	2	1	152	1	156	1.24e-69	218
MsaG033330	AT5G43320.2	63.291	158	50	2	1	152	1	156	2.89e-68	211
MsaG033330	AT5G43320.3	63.291	158	50	2	1	152	1	156	2.89e-68	211
MsaG033330	AT4G14340.2	63.924	158	49	2	1	152	7	162	4.60e-68	210
MsaG033330	AT3G23340.1	62.658	158	51	2	1	152	1	156	7.14e-68	212
MsaG033330	AT4G14340.1	63.924	158	49	2	1	152	7	162	1.06e-67	212
MsaG033330	AT4G28540.1	60.759	158	54	2	1	152	5	160	2.69e-66	209
MsaG033330	AT4G28860.2	60.127	158	55	2	1	152	1	156	1.46e-61	194
MsaG033330	AT4G28880.3	60.759	158	54	2	1	152	1	156	2.56e-61	194
MsaG033330	AT4G28880.2	60.759	158	54	2	1	152	1	156	2.56e-61	194
MsaG033330	AT4G28880.1	60.759	158	54	2	1	152	1	156	2.56e-61	194
MsaG033330	AT4G28880.4	60.759	158	54	2	1	152	1	156	2.56e-61	194
MsaG033330	AT4G28860.1	60.127	158	55	2	1	152	1	156	5.19e-61	194
MsaG033330	AT3G23340.2	60.145	138	47	2	21	152	7	142	2.87e-55	179
MsaG033330	AT4G08800.1	51.899	158	36	4	1	152	1	124	1.22e-42	143
MsaG033330	AT3G03940.1	34.320	169	89	6	4	152	133	299	5.48e-23	94.4
MsaG033330	AT5G18190.2	33.136	169	91	6	4	152	123	289	4.96e-22	91.7
MsaG033330	AT5G18190.1	33.136	169	91	6	4	152	123	289	4.96e-22	91.7
MsaG033330	AT2G25760.1	30.814	172	93	6	4	152	100	268	1.24e-21	90.5
MsaG033330	AT2G25760.2	30.814	172	93	6	4	152	100	268	1.24e-21	90.5
MsaG033330	AT3G13670.1	29.814	161	96	4	9	152	137	297	1.37e-21	90.5
MsaG033330	AT2G25090.1	30.323	155	90	6	7	149	13	161	4.19e-11	60.1

Find 35 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
GACAATTTCCTCATGGGTTT+AGG	0.228856	6:+83768954	MsaT033330.1:CDS
ATTTATTCAATTTCTGTAAT+AGG	0.238085	6:+83768751	MsaT033330.1:CDS
TCTTTCGGAGAGATCTATTT+AGG	0.249141	6:+83768057	MsaT033330.1:CDS
TTCCGTCTTGGGAGGAAAAT+TGG	0.260322	6:+83768027	MsaT033330.1:CDS
AAAGAGTTGTATAGGCAATA+TGG	0.265577	6:+83768387	MsaT033330.1:intron
TTCTTCATTAGTTTGAATAT+TGG	0.282133	6:-83768168	None:intergenic
ACAATTTCCTCATGGGTTTA+GGG	0.340991	6:+83768955	MsaT033330.1:CDS
GGTTTAATGGAACCTCGAAT+TGG	0.394217	6:+83767997	None:intergenic
AAAATTGGTAGCGGATCTTT+CGG	0.404618	6:+83768042	MsaT033330.1:CDS
TTGGGAATAAGTTCCGTCTT+GGG	0.445582	6:+83768016	MsaT033330.1:CDS
GTTTAATGGAACCTCGAATT+GGG	0.447782	6:+83767998	None:intergenic
TCTTATGCTTGCTGATCAAA+TGG	0.460267	6:+83768794	MsaT033330.1:CDS
AAGAGTTGTATAGGCAATAT+GGG	0.470906	6:+83768388	MsaT033330.1:intron
ACACCGGACCATTTCACATT+CGG	0.480710	6:-83768675	None:intergenic
CTGGGATACCGAATGTGAAA+TGG	0.480856	6:+83768667	MsaT033330.1:CDS
TATGGGATATTGAATTTCGT+TGG	0.482599	6:+83768405	MsaT033330.1:CDS
ATTGGGAATAAGTTCCGTCT+TGG	0.488327	6:+83768015	MsaT033330.1:CDS
ATCCTAGTGATGGATTTACT+TGG	0.499759	6:+83768714	MsaT033330.1:CDS
TTTACTTGGCCCTAGTCTTG+AGG	0.502228	6:+83768728	MsaT033330.1:CDS
CGGAACTTATTCCCAATTCG+AGG	0.514181	6:-83768009	None:intergenic
AAGCCAGACAATTTCCTCAT+GGG	0.517628	6:+83768948	MsaT033330.1:CDS
TAGGTGTACATCATTGACTT+TGG	0.518918	6:+83769088	MsaT033330.1:intron
TTGAATAAATCCTCAAGACT+AGG	0.522442	6:-83768738	None:intergenic
AAACCCATGAGGAAATTGTC+TGG	0.531680	6:-83768951	None:intergenic
GTGAAATGGTCCGGTGTCGA+AGG	0.536640	6:+83768681	MsaT033330.1:CDS
AAAGCCAGACAATTTCCTCA+TGG	0.544831	6:+83768947	MsaT033330.1:CDS
TGAATAAATCCTCAAGACTA+GGG	0.545896	6:-83768737	None:intergenic
ATTGTACTCTCCTTCGACAC+CGG	0.548807	6:-83768691	None:intergenic
AGAGTACAATATCCTAGTGA+TGG	0.570391	6:+83768704	MsaT033330.1:CDS
ATACCGAATGTGAAATGGTC+CGG	0.578759	6:+83768672	MsaT033330.1:CDS
GGAATAAGTTCCGTCTTGGG+AGG	0.606788	6:+83768019	MsaT033330.1:CDS
ATTTCCTCATGGGTTTAGGG+AGG	0.628140	6:+83768958	MsaT033330.1:CDS
CTTGGGAGGAAAATTGGTAG+CGG	0.633001	6:+83768033	MsaT033330.1:CDS
GGCCAAGTAAATCCATCACT+AGG	0.640405	6:-83768716	None:intergenic
CACGCCTCCCTAAACCCATG+AGG	0.734143	6:-83768962	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr6	gene	83768003	83769129	83768003	ID=MsaG033330
Chr6	mRNA	83768003	83769129	83768003	ID=MsaT033330.1;Parent=MsaG033330
Chr6	exon	83768003	83768078	83768003	ID=MsaT033330.1.exon1;Parent=MsaT033330.1
Chr6	CDS	83768003	83768078	83768003	ID=cds.MsaT033330.1;Parent=MsaT033330.1
Chr6	exon	83768165	83768205	83768165	ID=MsaT033330.1.exon2;Parent=MsaT033330.1
Chr6	CDS	83768165	83768205	83768165	ID=cds.MsaT033330.1;Parent=MsaT033330.1
Chr6	exon	83768401	83768458	83768401	ID=MsaT033330.1.exon3;Parent=MsaT033330.1
Chr6	CDS	83768401	83768458	83768401	ID=cds.MsaT033330.1;Parent=MsaT033330.1
Chr6	exon	83768667	83768815	83768667	ID=MsaT033330.1.exon4;Parent=MsaT033330.1
Chr6	CDS	83768667	83768815	83768667	ID=cds.MsaT033330.1;Parent=MsaT033330.1
Chr6	exon	83768897	83768992	83768897	ID=MsaT033330.1.exon5;Parent=MsaT033330.1
Chr6	CDS	83768897	83768992	83768897	ID=cds.MsaT033330.1;Parent=MsaT033330.1
Chr6	exon	83769091	83769129	83769091	ID=MsaT033330.1.exon6;Parent=MsaT033330.1
Chr6	CDS	83769091	83769129	83769091	ID=cds.MsaT033330.1;Parent=MsaT033330.1

Gene Sequence

>MsaT033330.1

ATGGAACCTCGAATTGGGAATAAGTTCCGTCTTGGGAGGAAAATTGGTAGCGGATCTTTCGGAGAGATCTATTTAGGTACCAATATTCAAACTAATGAAGAAGTCGCGATTAAGCTTGCAATATGGGATATTGAATTTCGTTGGTGTGTTTTAGTTTTCGATACTGAACTTGTTGCTGGGATACCGAATGTGAAATGGTCCGGTGTCGAAGGAGAGTACAATATCCTAGTGATGGATTTACTTGGCCCTAGTCTTGAGGATTTATTCAATTTCTGTAATAGGAAATTGTCTCTCAAAACTGTTCTTATGCTTGCTGATCAAATGATAAATCGAGTTGAATTTATTCATACCAAGTCATTTTTACATCGGGACATAAAGCCAGACAATTTCCTCATGGGTTTAGGGAGGCGTGTAAATCAAGTGTACATCATTGACTTTGGTCTTGCTAAGAAATTTTGA

Protein sequence

>MsaT033330.1

MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLAIWDIEFRWCVLVFDTELVAGIPNVKWSGVEGEYNILVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFIHTKSFLHRDIKPDNFLMGLGRRVNQVYIIDFGLAKKF*