AlfalfaGEDB | MsaG037023

M. sativa ssp. caerulea / MsaG037023

KEGG: -
GO: -
PFAM: PF00320.30

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG037023	XP_013448359.1	82.653	196	24	1	1	186	1	196	3.12e-113	330

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG037023	sp\|Q8L4M6\|GATA3_ARATH	32.317	164	106	1	20	183	83	241	9.87e-22	92.4

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG037023	tr\|A0A072TZ11\|A0A072TZ11_MEDTR	82.653	196	24	1	1	186	1	196	1.49e-113	330

TFs/TRs:

Gene ID	Type	Classification
MsaG037023	TF	C2C2-GATA

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG001179	MsaG037023	0.822527	3.980049e-53	9.361780e-51
MsaG001171	MsaG037023	0.804670	3.263052e-49	4.909141e-47
MsaG001258	MsaG037023	0.825754	7.009932e-54	1.800450e-51
MsaG001414	MsaG037023	0.853605	4.118351e-61	2.531272e-58
MsaG002016	MsaG037023	0.805142	2.602528e-49	3.958696e-47
MsaG004040	MsaG037023	0.814621	2.425705e-51	4.644369e-49
MsaG004319	MsaG037023	0.822532	3.969357e-53	9.337902e-51
MsaG004555	MsaG037023	0.871449	1.384987e-66	1.706696e-63
MsaG005149	MsaG037023	0.806326	1.472018e-49	2.302141e-47
MsaG005205	MsaG037023	0.886027	1.056128e-71	2.544405e-68
MsaG005991	MsaG037023	0.801247	1.650199e-48	2.294844e-46
MsaG006269	MsaG037023	0.804396	3.719285e-49	5.560231e-47
MsaG006533	MsaG037023	0.801970	1.175268e-48	1.661440e-46
MsaG007423	MsaG037023	0.814365	2.761307e-51	5.253359e-49
MsaG007428	MsaG037023	0.818644	3.072542e-52	6.520845e-50
MsaG008047	MsaG037023	0.875622	5.532201e-68	8.178515e-65
MsaG008208	MsaG037023	0.858897	1.176283e-62	8.771058e-60
MsaG008426	MsaG037023	0.828502	1.553103e-54	4.307562e-52
MsaG008433	MsaG037023	0.813749	3.769993e-51	7.062328e-49
MsaG008542	MsaG037023	0.808150	6.071661e-50	9.916461e-48
MsaG008550	MsaG037023	0.864936	1.695827e-64	1.598064e-61
MsaG009100	MsaG037023	0.819294	2.189987e-52	4.727883e-50
MsaG011505	MsaG037023	0.802520	9.066923e-49	1.298015e-46
MsaG012273	MsaG037023	0.830435	5.292371e-55	1.550815e-52
MsaG041888	MsaG037023	0.809215	3.604413e-50	6.039559e-48
MsaG042406	MsaG037023	0.879337	2.847399e-69	4.984466e-66
MsaG043369	MsaG037023	0.818232	3.805353e-52	7.990356e-50
MsaG044131	MsaG037023	0.811899	9.542602e-51	1.707092e-48
MsaG044380	MsaG037023	0.825114	9.922568e-54	2.503862e-51
MsaG044794	MsaG037023	0.816369	9.946768e-52	1.990773e-49
MsaG046120	MsaG037023	0.812995	5.511337e-51	1.013115e-48
MsaG046311	MsaG037023	0.806435	1.396212e-49	2.189303e-47
MsaG013262	MsaG037023	0.856315	6.787159e-62	4.599572e-59
MsaG021538	MsaG037023	0.875249	7.410341e-68	1.077351e-64
MsaG024399	MsaG037023	0.845065	9.605982e-59	4.411475e-56
MsaG033509	MsaG037023	0.860933	2.880943e-63	2.320740e-60
MsaG031902	MsaG037023	0.900672	1.337373e-77	7.119492e-74
MsaG031903	MsaG037023	0.883260	1.115223e-70	2.348009e-67
MsaG030477	MsaG037023	0.827370	2.898608e-54	7.787821e-52
MsaG038716	MsaG037023	0.813721	3.824001e-51	7.158232e-49
MsaG036053	MsaG037023	0.820953	9.168389e-53	2.068039e-50
MsaG038131	MsaG037023	0.854567	2.179768e-61	1.386667e-58
MsaG037023	MsaG035340	0.870458	2.926256e-66	3.456399e-63
MsaG014541	MsaG037023	0.844525	1.340556e-58	6.047258e-56
MsaG015023	MsaG037023	0.834213	6.203540e-56	2.029580e-53
MsaG015152	MsaG037023	0.810458	1.952807e-50	3.372384e-48
MsaG015178	MsaG037023	0.809151	3.719956e-50	6.223812e-48
MsaG017050	MsaG037023	0.809786	2.721271e-50	4.623307e-48
MsaG017521	MsaG037023	0.858026	2.132353e-62	1.539110e-59
MsaG018183	MsaG037023	0.816031	1.182605e-51	2.346536e-49
MsaG018341	MsaG037023	0.824992	1.059624e-53	2.664965e-51
MsaG018343	MsaG037023	0.827270	3.063237e-54	8.206978e-52
MsaG018536	MsaG037023	0.811500	1.164352e-50	2.062637e-48
MsaG019140	MsaG037023	0.833662	8.509992e-56	2.739307e-53
MsaG019451	MsaG037023	0.813125	5.163278e-51	9.522063e-49
MsaG019663	MsaG037023	0.859768	6.457755e-63	4.976852e-60
MsaG020143	MsaG037023	0.821813	5.819292e-53	1.342770e-50
MsaG021076	MsaG037023	0.821502	6.858746e-53	1.569665e-50
MsaG021278	MsaG037023	0.859436	8.122760e-63	6.181433e-60
MsaG021279	MsaG037023	0.850953	2.321208e-60	1.300123e-57
MsaG021281	MsaG037023	0.857537	2.972678e-62	2.106936e-59
MsaG022058	MsaG037023	0.806902	1.114218e-49	1.766314e-47
MsaG022683	MsaG037023	0.829398	9.446863e-55	2.687147e-52
MsaG023089	MsaG037023	0.844329	1.513096e-58	6.781796e-56
MsaG023619	MsaG037023	0.819329	2.150322e-52	4.646578e-50
MsaG023917	MsaG037023	0.873856	2.190976e-67	2.996969e-64
MsaG023835	MsaG037023	0.836900	1.306807e-56	4.634442e-54
MsaG023837	MsaG037023	0.829855	7.321047e-55	2.110026e-52
MsaG023838	MsaG037023	0.837159	1.122710e-56	4.013000e-54
MsaG023856	MsaG037023	0.842332	5.131208e-58	2.156620e-55
MsaG024025	MsaG037023	0.822623	3.782930e-53	8.921040e-51
MsaG024026	MsaG037023	0.807659	7.711863e-50	1.244746e-47
MsaG028715	MsaG037023	0.806553	1.319129e-49	2.074109e-47
MsaG029086	MsaG037023	0.828394	1.648833e-54	4.559234e-52
MsaG029184	MsaG037023	0.865267	1.336060e-64	1.275931e-61
MsaG029281	MsaG037023	0.812551	6.886932e-51	1.252079e-48
MsaG029385	MsaG037023	0.843119	3.177004e-58	1.369421e-55
MsaG029324	MsaG037023	0.821628	6.416667e-53	1.473422e-50
MsaG029340	MsaG037023	0.807418	8.670754e-50	1.391502e-47
MsaG031277	MsaG037023	0.806770	1.187609e-49	1.876909e-47
MsaG031436	MsaG037023	0.806556	1.317367e-49	2.071474e-47
MsaG032479	MsaG037023	0.803744	5.073736e-49	7.471507e-47
MsaG032477	MsaG037023	0.824267	1.567685e-53	3.865383e-51
MsaG033437	MsaG037023	0.810404	2.005740e-50	3.459241e-48
MsaG033814	MsaG037023	0.837519	9.089311e-57	3.284941e-54
MsaG034658	MsaG037023	0.815921	1.251233e-51	2.475821e-49
MsaG035373	MsaG037023	0.818058	4.164746e-52	8.705790e-50
MsaG035378	MsaG037023	0.809080	3.851658e-50	6.433147e-48
MsaG036217	MsaG037023	0.818670	3.030308e-52	6.435630e-50
MsaG037863	MsaG037023	0.859224	9.394898e-63	7.092786e-60
MsaG037865	MsaG037023	0.801580	1.411483e-48	1.977766e-46
MsaG037867	MsaG037023	0.804264	3.961033e-49	5.903657e-47
MsaG038395	MsaG037023	0.835567	2.840374e-56	9.677154e-54
MsaG038533	MsaG037023	0.871317	1.530932e-66	1.875979e-63
MsaG040071	MsaG037023	0.869101	8.072757e-66	9.009666e-63
MsaG040072	MsaG037023	0.853098	5.746687e-61	3.469514e-58
MsaG040820	MsaG037023	0.829735	7.828268e-55	2.248416e-52
MsaG040823	MsaG037023	0.831546	2.832657e-55	8.571235e-53
MsaG041049	MsaG037023	0.863865	3.650071e-64	3.295961e-61
MsaG041561	MsaG037023	0.843118	3.178358e-58	1.369981e-55

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG037023	MtrunA17_Chr7g0232681	82.653	196	24	1	1	186	1	196	2.87e-117	330
MsaG037023	MtrunA17_Chr7g0232701	75.168	149	15	2	48	186	1	137	1.60e-73	218
MsaG037023	MtrunA17_Chr7g0232671	43.162	234	53	6	29	187	24	252	1.80e-49	160
MsaG037023	MtrunA17_Chr3g0140331	54.762	84	37	1	98	180	228	311	3.53e-22	92.0
MsaG037023	MtrunA17_Chr2g0326771	35.461	141	75	3	55	187	149	281	1.38e-19	84.3
MsaG037023	MtrunA17_Chr4g0028961	55.385	65	29	0	119	183	229	293	1.62e-19	84.0
MsaG037023	MtrunA17_Chr4g0035891	32.911	158	100	3	30	183	117	272	2.04e-19	83.6
MsaG037023	MtrunA17_Chr7g0253101	55.385	65	29	0	119	183	185	249	1.06e-18	80.9
MsaG037023	MtrunA17_Chr3g0145121	53.731	67	29	1	121	185	214	280	1.19e-18	81.6
MsaG037023	MtrunA17_Chr1g0199671	56.452	62	27	0	122	183	242	303	1.85e-18	81.3
MsaG037023	MtrunA17_Chr1g0146231	56.452	62	27	0	122	183	234	295	2.60e-18	80.9
MsaG037023	MtrunA17_Chr1g0213161	39.286	112	66	2	74	183	102	213	5.55e-18	78.6
MsaG037023	MtrunA17_Chr6g0461591	54.839	62	28	0	122	183	192	253	6.27e-18	79.0
MsaG037023	MtrunA17_Chr8g0340401	54.839	62	28	0	122	183	226	287	1.23e-17	79.0
MsaG037023	MtrunA17_Chr5g0404981	53.226	62	29	0	122	183	300	361	4.17e-17	78.2
MsaG037023	MtrunA17_Chr8g0372291	53.226	62	29	0	122	183	218	279	4.76e-17	77.0
MsaG037023	MtrunA17_Chr1g0169431	53.731	67	29	1	122	186	172	238	1.87e-16	74.7
MsaG037023	MtrunA17_Chr5g0395391	33.858	127	80	1	61	183	205	331	9.26e-16	73.9
MsaG037023	MtrunA17_Chr5g0395391	50.000	62	31	0	122	183	168	229	7.13e-14	68.6

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG037023	AT4G34680.1	32.317	164	106	1	20	183	83	241	1.00e-22	92.4
MsaG037023	AT4G34680.2	32.317	164	106	1	20	183	83	241	1.00e-22	92.4
MsaG037023	AT3G60530.1	56.250	64	28	0	120	183	156	219	3.63e-21	87.4
MsaG037023	AT5G25830.1	58.730	63	26	0	121	183	218	280	2.10e-20	87.0
MsaG037023	AT2G45050.1	54.688	64	29	0	120	183	177	240	3.21e-20	85.5
MsaG037023	AT3G45170.1	31.544	149	97	2	37	183	31	176	5.81e-20	83.6
MsaG037023	AT4G32890.1	42.574	101	46	2	95	183	158	258	7.33e-20	85.1
MsaG037023	AT3G54810.1	60.000	65	24	1	122	184	229	293	4.69e-19	83.2
MsaG037023	AT3G54810.2	60.000	65	24	1	122	184	229	293	4.69e-19	83.2
MsaG037023	AT2G28340.1	58.333	60	25	0	124	183	193	252	1.83e-18	81.3
MsaG037023	AT4G36240.1	53.226	62	29	0	122	183	164	225	2.21e-18	80.1
MsaG037023	AT5G66320.2	43.956	91	44	1	100	183	220	310	3.21e-18	81.3
MsaG037023	AT5G66320.1	43.956	91	44	1	100	183	220	310	3.21e-18	81.3
MsaG037023	AT3G24050.1	51.351	74	34	1	115	186	187	260	9.21e-18	79.0
MsaG037023	AT1G08000.2	55.224	67	28	1	122	186	218	284	2.30e-17	78.6
MsaG037023	AT1G08000.1	55.224	67	28	1	122	186	218	284	2.30e-17	78.6
MsaG037023	AT1G08010.2	55.932	59	26	0	122	180	220	278	2.35e-17	78.2
MsaG037023	AT1G08010.1	55.932	59	26	0	122	180	220	278	2.35e-17	78.2
MsaG037023	AT1G08010.3	55.932	59	26	0	122	180	220	278	2.35e-17	78.2
MsaG037023	AT3G51080.1	53.226	62	29	0	122	183	221	282	4.57e-17	77.8

Find 37 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ACATGAGGCACTAGAAAATT+TGG	0.257280	7:+50318162	MsaT037023.1:CDS
AAGCTAAATGGATTGGTTAA+AGG	0.267058	7:+50318529	MsaT037023.1:CDS
TCAATGGAGGTTGGGTCCTT+TGG	0.284044	7:+50318468	MsaT037023.1:CDS
GTACTGGCAATCCTCATCTT+TGG	0.297320	7:+50317693	MsaT037023.1:CDS
CCTCCATTGAGTAGTTTCTT+TGG	0.310305	7:-50318455	None:intergenic
GGATTACGATACAAGCTAAA+TGG	0.317668	7:+50318517	MsaT037023.1:CDS
AGCTAAATGGATTGGTTAAA+GGG	0.347180	7:+50318530	MsaT037023.1:CDS
TACTGGCAATCCTCATCTTT+GGG	0.354229	7:+50317694	MsaT037023.1:CDS
CAATGGAGGTTGGGTCCTTT+GGG	0.359077	7:+50318469	MsaT037023.1:CDS
CAAATTCTCTGATGATGATT+AGG	0.374222	7:-50318337	None:intergenic
ACTAGAGCCAAGACATTCAT+AGG	0.414135	7:+50318406	MsaT037023.1:CDS
CCGCCTTGTGTAAATTTGAA+TGG	0.415356	7:-50318591	None:intergenic
TCAAAAGCTGGACTTGCCTT+AGG	0.449589	7:-50318559	None:intergenic
AAATGTTCAAAATAATCAAC+AGG	0.466273	7:+50318294	MsaT037023.1:CDS
ACATTTGACACATTGAAAGA+TGG	0.475716	7:-50318277	None:intergenic
TCTCTCTCCTATGAATGTCT+TGG	0.487683	7:-50318413	None:intergenic
GAAACTACTCAATGGAGGTT+GGG	0.488791	7:+50318460	MsaT037023.1:CDS
AACATGTAGTGGGTCAGTAC+TGG	0.492576	7:+50317677	MsaT037023.1:CDS
ACGATACAAGCTAAATGGAT+TGG	0.515501	7:+50318522	MsaT037023.1:CDS
AGAAACTACTCAATGGAGGT+TGG	0.521850	7:+50318459	MsaT037023.1:CDS
ACACAAGGCGGCGATGAGAA+AGG	0.533727	7:+50318603	MsaT037023.1:CDS
GGTTAAAGGGTATAGACCTA+AGG	0.562082	7:+50318543	MsaT037023.1:CDS
TGGTTTCTGATATCAAAAGC+TGG	0.565390	7:-50318571	None:intergenic
AGACCAAAGAAACTACTCAA+TGG	0.572896	7:+50318452	MsaT037023.1:CDS
AGATTTGAGTAAACATGTAG+TGG	0.573609	7:+50317666	MsaT037023.1:CDS
CATCAAATTGGATCAATCGA+TGG	0.580669	7:+50318231	MsaT037023.1:CDS
TAGTTTCTTTGGTCTCACAA+TGG	0.599313	7:-50318444	None:intergenic
AATACTTTGTGCAATGCATG+TGG	0.610080	7:+50318496	MsaT037023.1:CDS
AAGGCGGCGATGAGAAAGGA+AGG	0.631884	7:+50318607	MsaT037023.1:CDS
ATAATACTAACCCAAAGATG+AGG	0.642509	7:-50317704	None:intergenic
GATTTGAGTAAACATGTAGT+GGG	0.645437	7:+50317667	MsaT037023.1:CDS
CCAAAGAAACTACTCAATGG+AGG	0.662722	7:+50318455	MsaT037023.1:CDS
CCATTCAAATTTACACAAGG+CGG	0.663290	7:+50318591	MsaT037023.1:CDS
TTGGCTCTAGTCCTTCGTAG+AGG	0.667318	7:-50318394	None:intergenic
CTACTCAAAAGCCTCTACGA+AGG	0.678918	7:+50318383	MsaT037023.1:CDS
ACTTGATTATATCCCACATG+AGG	0.689620	7:+50318147	MsaT037023.1:CDS
AAACCATTCAAATTTACACA+AGG	0.692002	7:+50318588	MsaT037023.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr7	gene	50317643	50318633	50317643	ID=MsaG037023
Chr7	mRNA	50317643	50318633	50317643	ID=MsaT037023.1;Parent=MsaG037023
Chr7	exon	50317643	50317715	50317643	ID=MsaT037023.1.exon1;Parent=MsaT037023.1
Chr7	CDS	50317643	50317715	50317643	ID=cds.MsaT037023.1;Parent=MsaT037023.1
Chr7	exon	50318143	50318633	50318143	ID=MsaT037023.1.exon2;Parent=MsaT037023.1
Chr7	CDS	50318143	50318633	50318143	ID=cds.MsaT037023.1;Parent=MsaT037023.1

Gene Sequence

>MsaT037023.1

ATGGCTAATCTGAGAGAAGAACAAGATTTGAGTAAACATGTAGTGGGTCAGTACTGGCAATCCTCATCTTTGGGGAAACTTGATTATATCCCACATGAGGCACTAGAAAATTTGGAATGCTACACTACTTTTTGGGATGACATGAAGAAATTAGAAAAAGTCATCAAATTGGATCAATCGATGGATGAGAGAAAAACACAAGAAAATCCATCTTTCAATGTGTCAAATGTTCAAAATAATCAACAGGAGAATATTGATACAAGTGTGCCTAATCATCATCAGAGAATTTGCAGCGATAGTGAGACCAAAGCAACTACTCAAAAGCCTCTACGAAGGACTAGAGCCAAGACATTCATAGGAGAGAGAAGTTGCAGCCATTGTGAGACCAAAGAAACTACTCAATGGAGGTTGGGTCCTTTGGGAAAAAATACTTTGTGCAATGCATGTGGATTACGATACAAGCTAAATGGATTGGTTAAAGGGTATAGACCTAAGGCAAGTCCAGCTTTTGATATCAGAAACCATTCAAATTTACACAAGGCGGCGATGAGAAAGGAAGGATAA

Protein sequence

>MsaT037023.1

MANLREEQDLSKHVVGQYWQSSSLGKLDYIPHEALENLECYTTFWDDMKKLEKVIKLDQSMDERKTQENPSFNVSNVQNNQQENIDTSVPNHHQRICSDSETKATTQKPLRRTRAKTFIGERSCSHCETKETTQWRLGPLGKNTLCNACGLRYKLNGLVKGYRPKASPAFDIRNHSNLHKAAMRKEG*