AlfalfaGEDB | MsaG038674

M. sativa ssp. caerulea / MsaG038674

KEGG: -
GO: GO:0003674 GO:0003676 GO:0003677 GO:0003723 GO:0003729 GO:0003824 GO:0004518 GO:0005488 GO:0005515 GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0005829 GO:0006139 GO:0006417 GO:0006725 GO:0006807 GO:0008150 GO:0008152 GO:0009889 GO:0009890 GO:0009892 GO:0009987 GO:0010313 GO:0010468 GO:0010556 GO:0010558 GO:0010605 GO:0010608 GO:0010629 GO:0016787 GO:0016788 GO:0017148 GO:0019222 GO:0031323 GO:0031324 GO:0031326 GO:0031327 GO:0032268 GO:0032269 GO:0034248 GO:0034249 GO:0034641 GO:0043170 GO:0044237 GO:0044238 GO:0044424 GO:0044444 GO:0044464 GO:0046483 GO:0048027 GO:0048519 GO:0048523 GO:0050789 GO:0050794 GO:0051171 GO:0051172 GO:0051246 GO:0051248 GO:0060255 GO:0065007 GO:0071704 GO:0080090 GO:0090304 GO:0090305 GO:0097159 GO:1901360 GO:1901363 GO:2000112 GO:2000113
PFAM: PF00642.27

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG038674	ACC85690.1	100.000	372	0	0	1	372	1	372	0.0	779

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG038674	sp\|Q9SWF9\|ZFNL_PEA	93.817	372	22	1	1	372	1	371	0.0	729

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG038674	tr\|B2MVK8\|B2MVK8_MEDSA	100.000	372	0	0	1	372	1	372	0.0	779

TFs/TRs:

Gene ID	Type	Classification
MsaG038674	TF	C3H

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000083	MsaG038674	0.827415	2.827446e-54	7.606130e-52
MsaG000400	MsaG038674	0.805510	2.180759e-49	3.345508e-47
MsaG000675	MsaG038674	0.804535	3.479350e-49	5.218337e-47
MsaG001030	MsaG038674	0.800612	2.222369e-48	3.046649e-46
MsaG001680	MsaG038674	0.803320	6.207521e-49	9.051562e-47
MsaG001827	MsaG038674	0.816326	1.016878e-51	2.032963e-49
MsaG002121	MsaG038674	0.809909	2.560695e-50	4.363425e-48
MsaG002146	MsaG038674	0.815158	1.846327e-51	3.583315e-49
MsaG002291	MsaG038674	0.811754	1.025718e-50	1.828389e-48
MsaG002414	MsaG038674	0.821782	5.913987e-53	1.363519e-50
MsaG002564	MsaG038674	0.803292	6.288750e-49	9.164210e-47
MsaG002660	MsaG038674	0.812273	7.916131e-51	1.429202e-48
MsaG002681	MsaG038674	0.820590	1.109867e-52	2.479396e-50
MsaG002727	MsaG038674	0.814148	3.082316e-51	5.831948e-49
MsaG002878	MsaG038674	0.829773	7.664067e-55	2.203658e-52
MsaG002906	MsaG038674	0.800173	2.726771e-48	3.701096e-46
MsaG003332	MsaG038674	0.818928	2.650116e-52	5.666391e-50
MsaG003418	MsaG038674	0.802339	9.874446e-49	1.407791e-46
MsaG003684	MsaG038674	0.825747	7.037676e-54	1.807226e-51
MsaG003792	MsaG038674	0.814538	2.529665e-51	4.833404e-49
MsaG003810	MsaG038674	0.808594	4.886392e-50	8.066415e-48
MsaG004157	MsaG038674	0.813068	5.312557e-51	9.783728e-49
MsaG004297	MsaG038674	0.809189	3.650818e-50	6.113491e-48
MsaG004298	MsaG038674	0.800748	2.085382e-48	2.867620e-46
MsaG005063	MsaG038674	0.807099	1.012482e-49	1.612539e-47
MsaG005138	MsaG038674	0.819528	1.937657e-52	4.208667e-50
MsaG005480	MsaG038674	0.801151	1.726498e-48	2.395751e-46
MsaG005847	MsaG038674	0.806875	1.128777e-49	1.788279e-47
MsaG006145	MsaG038674	0.806723	1.214820e-49	1.917767e-47
MsaG006199	MsaG038674	0.809483	3.159898e-50	5.329468e-48
MsaG006254	MsaG038674	0.812671	6.485430e-51	1.182555e-48
MsaG006256	MsaG038674	0.822680	3.669725e-53	8.667276e-51
MsaG006517	MsaG038674	0.815990	1.207694e-51	2.393847e-49
MsaG006633	MsaG038674	0.805378	2.323194e-49	3.553200e-47
MsaG006788	MsaG038674	0.817883	4.559264e-52	9.487552e-50
MsaG006871	MsaG038674	0.827639	2.500018e-54	6.767811e-52
MsaG006980	MsaG038674	0.803692	5.201759e-49	7.650613e-47
MsaG007700	MsaG038674	0.800935	1.909960e-48	2.637470e-46
MsaG008033	MsaG038674	0.835565	2.843434e-56	9.687104e-54
MsaG008113	MsaG038674	0.810021	2.424110e-50	4.141711e-48
MsaG008682	MsaG038674	0.804578	3.408689e-49	5.117393e-47
MsaG008815	MsaG038674	0.831047	3.754194e-55	1.119567e-52
MsaG008888	MsaG038674	0.816191	1.089785e-51	2.171219e-49
MsaG008877	MsaG038674	0.813250	4.849638e-51	8.971494e-49
MsaG009193	MsaG038674	0.803337	6.158157e-49	8.982993e-47
MsaG009532	MsaG038674	0.812672	6.481080e-51	1.181804e-48
MsaG009765	MsaG038674	0.807161	9.823743e-50	1.566899e-47
MsaG009926	MsaG038674	0.801288	1.618902e-48	2.253441e-46
MsaG010255	MsaG038674	0.802391	9.635149e-49	1.375309e-46
MsaG010331	MsaG038674	0.818232	3.804274e-52	7.988256e-50
MsaG010382	MsaG038674	0.814374	2.748778e-51	5.230664e-49
MsaG010594	MsaG038674	0.805526	2.163885e-49	3.320847e-47
MsaG011335	MsaG038674	0.803673	5.249744e-49	7.717704e-47
MsaG011336	MsaG038674	0.801126	1.747297e-48	2.423231e-46
MsaG011459	MsaG038674	0.810362	2.047851e-50	3.528253e-48
MsaG011580	MsaG038674	0.807136	9.942452e-50	1.584896e-47
MsaG011825	MsaG038674	0.802241	1.034001e-48	1.470801e-46
MsaG011854	MsaG038674	0.801926	1.199524e-48	1.694075e-46
MsaG011881	MsaG038674	0.806152	1.600571e-49	2.492869e-47
MsaG012130	MsaG038674	0.827128	3.310056e-54	8.833316e-52
MsaG013088	MsaG038674	0.803182	6.628245e-49	9.634351e-47
MsaG013182	MsaG038674	0.804400	3.711257e-49	5.548828e-47
MsaG013324	MsaG038674	0.803201	6.568528e-49	9.551800e-47
MsaG013327	MsaG038674	0.828552	1.510616e-54	4.195622e-52
MsaG013390	MsaG038674	0.806210	1.556360e-49	2.427463e-47
MsaG014072	MsaG038674	0.824657	1.270594e-53	3.166276e-51
MsaG014149	MsaG038674	0.804377	3.752177e-49	5.607020e-47
MsaG014208	MsaG038674	0.807769	7.312067e-50	1.183343e-47
MsaG014534	MsaG038674	0.807590	7.977319e-50	1.285438e-47
MsaG015063	MsaG038674	0.808500	5.117187e-50	8.428280e-48
MsaG015447	MsaG038674	0.841651	7.748537e-58	3.186546e-55
MsaG015782	MsaG038674	0.812990	5.525715e-51	1.015626e-48
MsaG015904	MsaG038674	0.810819	1.632885e-50	2.844774e-48
MsaG015930	MsaG038674	0.812065	8.783055e-51	1.577575e-48
MsaG016250	MsaG038674	0.823573	2.275552e-53	5.506154e-51
MsaG016366	MsaG038674	0.800571	2.264842e-48	3.102027e-46
MsaG016584	MsaG038674	0.823544	2.311433e-53	5.588564e-51
MsaG016721	MsaG038674	0.810067	2.369557e-50	4.053087e-48
MsaG017203	MsaG038674	0.800738	2.095191e-48	2.880457e-46
MsaG017281	MsaG038674	0.821553	6.678949e-53	1.530562e-50
MsaG017348	MsaG038674	0.804302	3.889596e-49	5.802342e-47
MsaG017573	MsaG038674	0.819798	1.682128e-52	3.679766e-50
MsaG017682	MsaG038674	0.822473	4.096853e-53	9.622318e-51
MsaG017731	MsaG038674	0.800074	2.855837e-48	3.867755e-46
MsaG017931	MsaG038674	0.804218	4.047942e-49	6.026856e-47
MsaG018355	MsaG038674	0.868459	1.299599e-65	1.412815e-62
MsaG018446	MsaG038674	0.822602	3.825780e-53	9.016973e-51
MsaG018466	MsaG038674	0.803401	5.973238e-49	8.726355e-47
MsaG018406	MsaG038674	0.813662	3.939143e-51	7.362906e-49
MsaG018624	MsaG038674	0.801844	1.246686e-48	1.757407e-46
MsaG018780	MsaG038674	0.807179	9.741164e-50	1.554382e-47
MsaG018876	MsaG038674	0.820297	1.294734e-52	2.870192e-50
MsaG018972	MsaG038674	0.802347	9.838078e-49	1.402872e-46
MsaG019455	MsaG038674	0.808979	4.047231e-50	6.743418e-48
MsaG019783	MsaG038674	0.805260	2.459096e-49	3.750668e-47
MsaG020004	MsaG038674	0.801368	1.559714e-48	2.174975e-46
MsaG020221	MsaG038674	0.815086	1.915508e-51	3.710813e-49
MsaG020396	MsaG038674	0.807925	6.776571e-50	1.100847e-47
MsaG020648	MsaG038674	0.807901	6.854813e-50	1.112913e-47
MsaG020771	MsaG038674	0.807788	7.243022e-50	1.172738e-47
MsaG020772	MsaG038674	0.801291	1.616912e-48	2.250802e-46
MsaG020775	MsaG038674	0.808643	4.770974e-50	7.885228e-48
MsaG021273	MsaG038674	0.800757	2.076370e-48	2.855830e-46
MsaG021220	MsaG038674	0.800955	1.892520e-48	2.614522e-46
MsaG021483	MsaG038674	0.815101	1.900831e-51	3.683744e-49
MsaG021484	MsaG038674	0.808777	4.467713e-50	7.407967e-48
MsaG021783	MsaG038674	0.812053	8.835931e-51	1.586621e-48
MsaG021835	MsaG038674	0.802099	1.105815e-48	1.567842e-46
MsaG022048	MsaG038674	0.806872	1.130517e-49	1.790896e-47
MsaG022074	MsaG038674	0.805376	2.325417e-49	3.556427e-47
MsaG022095	MsaG038674	0.819050	2.486393e-52	5.333496e-50
MsaG022456	MsaG038674	0.817201	6.483242e-52	1.325690e-49
MsaG022609	MsaG038674	0.856261	7.034207e-62	4.757798e-59
MsaG022759	MsaG038674	0.810558	1.858799e-50	3.217750e-48
MsaG022954	MsaG038674	0.801689	1.340959e-48	1.883638e-46
MsaG022981	MsaG038674	0.807372	8.866514e-50	1.421326e-47
MsaG023249	MsaG038674	0.807776	7.286387e-50	1.179395e-47
MsaG023246	MsaG038674	0.837625	8.540643e-57	3.096529e-54
MsaG023225	MsaG038674	0.808519	5.070457e-50	8.355147e-48
MsaG023230	MsaG038674	0.842220	5.490290e-58	2.299141e-55
MsaG023235	MsaG038674	0.807381	8.830657e-50	1.415874e-47
MsaG023301	MsaG038674	0.804052	4.383157e-49	6.500889e-47
MsaG023415	MsaG038674	0.807841	7.058920e-50	1.144361e-47
MsaG023476	MsaG038674	0.802403	9.579364e-49	1.367747e-46
MsaG023664	MsaG038674	0.814303	2.850376e-51	5.414220e-49
MsaG023849	MsaG038674	0.849296	6.726054e-60	3.558917e-57
MsaG023896	MsaG038674	0.800216	2.673483e-48	3.632236e-46
MsaG024116	MsaG038674	0.809899	2.573502e-50	4.384175e-48
MsaG024535	MsaG038674	0.804192	4.100115e-49	6.100644e-47
MsaG024612	MsaG038674	0.803860	4.802668e-49	7.091089e-47
MsaG024707	MsaG038674	0.809311	3.437874e-50	5.773750e-48
MsaG024829	MsaG038674	0.801931	1.196628e-48	1.690166e-46
MsaG024912	MsaG038674	0.823214	2.758058e-53	6.608913e-51
MsaG025276	MsaG038674	0.837817	7.630225e-57	2.782702e-54
MsaG025566	MsaG038674	0.824640	1.281889e-53	3.192970e-51
MsaG025776	MsaG038674	0.809870	2.611438e-50	4.445523e-48
MsaG025908	MsaG038674	0.805997	1.725144e-49	2.676909e-47
MsaG026252	MsaG038674	0.837256	1.060924e-56	3.803136e-54
MsaG026465	MsaG038674	0.802687	8.376482e-49	1.203754e-46
MsaG026614	MsaG038674	0.804955	2.846332e-49	4.310698e-47
MsaG026937	MsaG038674	0.812078	8.728193e-51	1.568199e-48
MsaG027208	MsaG038674	0.800570	2.265721e-48	3.103169e-46
MsaG027323	MsaG038674	0.804060	4.364454e-49	6.474454e-47
MsaG027528	MsaG038674	0.813555	4.159019e-51	7.753139e-49
MsaG027573	MsaG038674	0.822167	4.822365e-53	1.123322e-50
MsaG027690	MsaG038674	0.801687	1.342485e-48	1.885682e-46
MsaG027991	MsaG038674	0.824782	1.187560e-53	2.969565e-51
MsaG028254	MsaG038674	0.804594	3.383707e-49	5.081644e-47
MsaG028303	MsaG038674	0.805393	2.306829e-49	3.529344e-47
MsaG028306	MsaG038674	0.812915	5.737937e-51	1.052656e-48
MsaG028370	MsaG038674	0.824451	1.419466e-53	3.517630e-51
MsaG028328	MsaG038674	0.813644	3.975194e-51	7.427006e-49
MsaG028766	MsaG038674	0.827190	3.200093e-54	8.554372e-52
MsaG028741	MsaG038674	0.823204	2.772826e-53	6.642584e-51
MsaG028743	MsaG038674	0.845420	7.708079e-59	3.581227e-56
MsaG028970	MsaG038674	0.816032	1.182093e-51	2.345594e-49
MsaG029083	MsaG038674	0.811420	1.211535e-50	2.141991e-48
MsaG029311	MsaG038674	0.800306	2.563001e-48	3.489298e-46
MsaG029341	MsaG038674	0.811026	1.473669e-50	2.580408e-48
MsaG029894	MsaG038674	0.823026	3.049630e-53	7.270734e-51
MsaG030237	MsaG038674	0.813751	3.766220e-51	7.055589e-49
MsaG030578	MsaG038674	0.815240	1.771170e-51	3.444705e-49
MsaG030605	MsaG038674	0.823088	2.950259e-53	7.045564e-51
MsaG030781	MsaG038674	0.809934	2.530456e-50	4.314295e-48
MsaG030803	MsaG038674	0.803970	4.556893e-49	6.745528e-47
MsaG031132	MsaG038674	0.813087	5.263721e-51	9.698152e-49
MsaG031267	MsaG038674	0.817587	5.314274e-52	1.097436e-49
MsaG031414	MsaG038674	0.824286	1.551810e-53	3.828227e-51
MsaG031665	MsaG038674	0.811023	1.475628e-50	2.583664e-48
MsaG031693	MsaG038674	0.803169	6.668130e-49	9.689505e-47
MsaG032196	MsaG038674	0.814629	2.415421e-51	4.625666e-49
MsaG032726	MsaG038674	0.823269	2.678787e-53	6.428646e-51
MsaG032764	MsaG038674	0.807857	7.003912e-50	1.135910e-47
MsaG033732	MsaG038674	0.840286	1.761574e-57	6.938839e-55
MsaG034005	MsaG038674	0.823597	2.247189e-53	5.441107e-51
MsaG034066	MsaG038674	0.820604	1.101943e-52	2.462548e-50
MsaG034167	MsaG038674	0.808238	5.815049e-50	9.517651e-48
MsaG034231	MsaG038674	0.810473	1.938650e-50	3.349150e-48
MsaG034651	MsaG038674	0.803871	4.776296e-49	7.053988e-47
MsaG034737	MsaG038674	0.808059	6.347771e-50	1.034478e-47
MsaG034839	MsaG038674	0.814850	2.159459e-51	4.158656e-49
MsaG035181	MsaG038674	0.834582	5.017341e-56	1.659789e-53
MsaG035165	MsaG038674	0.804182	4.118537e-49	6.126674e-47
MsaG035409	MsaG038674	0.804234	4.017053e-49	5.983059e-47
MsaG035496	MsaG038674	0.804335	3.829208e-49	5.716593e-47
MsaG035456	MsaG038674	0.803460	5.806708e-49	8.494587e-47
MsaG035683	MsaG038674	0.807073	1.025178e-49	1.631773e-47
MsaG037144	MsaG038674	0.803648	5.311052e-49	7.803351e-47
MsaG037276	MsaG038674	0.828549	1.513357e-54	4.202815e-52
MsaG037297	MsaG038674	0.806610	1.282908e-49	2.019947e-47
MsaG037333	MsaG038674	0.809384	3.317700e-50	5.581867e-48
MsaG037407	MsaG038674	0.804036	4.416420e-49	6.547818e-47
MsaG037804	MsaG038674	0.826021	6.064150e-54	1.569159e-51
MsaG038168	MsaG038674	0.804497	3.543672e-49	5.310106e-47
MsaG038170	MsaG038674	0.807807	7.177909e-50	1.162703e-47
MsaG038674	MsaG038991	0.819950	1.553657e-52	3.412558e-50
MsaG038674	MsaG039098	0.833349	1.017974e-55	3.246557e-53
MsaG038674	MsaG039106	0.803074	6.974464e-49	1.011249e-46
MsaG038674	MsaG039920	0.810987	1.502186e-50	2.627820e-48
MsaG038674	MsaG039824	0.809182	3.662292e-50	6.131854e-48
MsaG038674	MsaG040019	0.812174	8.316656e-51	1.497838e-48
MsaG038674	MsaG040162	0.817587	5.314105e-52	1.097403e-49
MsaG038674	MsaG040310	0.814484	2.599551e-51	4.960294e-49
MsaG038674	MsaG040336	0.818327	3.621736e-52	7.623437e-50
MsaG038674	MsaG040343	0.802995	7.241842e-49	1.048096e-46
MsaG038674	MsaG040499	0.809358	3.359478e-50	5.648550e-48
MsaG038674	MsaG040545	0.818026	4.234870e-52	8.845121e-50
MsaG038674	MsaG040673	0.812541	6.921321e-51	1.258019e-48
MsaG038674	MsaG040683	0.810261	2.152765e-50	3.699776e-48
MsaG038674	MsaG040763	0.802234	1.037587e-48	1.475663e-46
MsaG038674	MsaG041010	0.800448	2.399166e-48	3.276829e-46
MsaG038674	MsaG040907	0.839716	2.476413e-57	9.581465e-55
MsaG038674	MsaG041066	0.822397	4.265290e-53	9.997702e-51
MsaG038674	MsaG041135	0.804646	3.299776e-49	4.961713e-47
MsaG038674	MsaG041358	0.806094	1.646674e-49	2.561117e-47
MsaG038674	MsaG041370	0.810584	1.834952e-50	3.178466e-48
MsaG038674	MsaG041434	0.804208	4.068896e-49	6.056502e-47
MsaG038674	MsaG041534	0.840334	1.712242e-57	6.754747e-55
MsaG038674	MsaG041495	0.802361	9.774292e-49	1.394196e-46
MsaG038674	MsaG042574	0.805303	2.409379e-49	3.678475e-47
MsaG038674	MsaG042575	0.827770	2.326323e-54	6.320740e-52
MsaG038674	MsaG042799	0.828871	1.265814e-54	3.547170e-52
MsaG038674	MsaG042749	0.808273	5.718071e-50	9.366673e-48
MsaG038674	MsaG043634	0.801025	1.831851e-48	2.534696e-46
MsaG038674	MsaG043815	0.825504	8.030116e-54	2.048192e-51
MsaG038674	MsaG044133	0.816659	8.570504e-52	1.728057e-49
MsaG038674	MsaG044189	0.823238	2.723149e-53	6.529545e-51
MsaG038674	MsaG044307	0.821469	6.979776e-53	1.595935e-50
MsaG038674	MsaG044311	0.807481	8.410783e-50	1.351786e-47
MsaG038674	MsaG044313	0.821063	8.653370e-53	1.957510e-50
MsaG038674	MsaG044532	0.805743	1.949648e-49	3.007351e-47
MsaG038674	MsaG044566	0.813626	4.012924e-51	7.494029e-49
MsaG038674	MsaG044627	0.819897	1.597670e-52	3.504220e-50
MsaG038674	MsaG044874	0.809785	2.722710e-50	4.625589e-48
MsaG038674	MsaG044886	0.803062	7.013676e-49	1.016644e-46
MsaG038674	MsaG044960	0.801789	1.279793e-48	1.801773e-46
MsaG038674	MsaG045121	0.812902	5.776496e-51	1.059369e-48
MsaG038674	MsaG045122	0.821915	5.510263e-53	1.274973e-50
MsaG038674	MsaG045303	0.807039	1.042561e-49	1.658076e-47
MsaG038674	MsaG045295	0.801983	1.167748e-48	1.651326e-46
MsaG038674	MsaG045314	0.841548	8.247394e-58	3.380650e-55
MsaG038674	MsaG045333	0.802591	8.767475e-49	1.257197e-46
MsaG038674	MsaG045517	0.811837	9.840094e-51	1.757654e-48
MsaG038674	MsaG046281	0.819322	2.157897e-52	4.662050e-50
MsaG038674	MsaG046289	0.822947	3.181386e-53	7.568580e-51
MsaG038674	MsaG046598	0.807987	6.574021e-50	1.069521e-47
MsaG038674	MsaG046662	0.802489	9.201131e-49	1.316281e-46
MsaG038674	MsaG047166	0.800628	2.205457e-48	3.024571e-46
MsaG038674	MsaG001943	0.812904	5.770799e-51	1.058375e-48
MsaG038674	MsaG004516	0.805176	2.559774e-49	3.896797e-47
MsaG038674	MsaG002237	0.820901	9.424465e-53	2.122787e-50
MsaG038674	MsaG002656	0.803029	7.126351e-49	1.032169e-46
MsaG038674	MsaG003231	0.865817	8.984467e-65	8.770126e-62
MsaG038674	MsaG000658	0.850065	4.112311e-60	2.233468e-57
MsaG038674	MsaG009147	0.810664	1.763420e-50	3.060510e-48
MsaG038674	MsaG008139	0.806035	1.693543e-49	2.630351e-47
MsaG038674	MsaG009150	0.814080	3.190395e-51	6.026217e-49
MsaG038674	MsaG013588	0.818503	3.306526e-52	6.991649e-50
MsaG038674	MsaG016986	0.802516	9.083190e-49	1.300230e-46
MsaG038674	MsaG013105	0.834297	5.911438e-56	1.938967e-53
MsaG038674	MsaG013410	0.804328	3.841456e-49	5.733967e-47
MsaG038674	MsaG014187	0.813026	5.426277e-51	9.982678e-49
MsaG038674	MsaG013316	0.805914	1.795305e-49	2.780438e-47
MsaG038674	MsaG013067	0.839856	2.278215e-57	8.853830e-55
MsaG038674	MsaG012158	0.809653	2.905614e-50	4.920610e-48
MsaG038674	MsaG018691	0.810221	2.195429e-50	3.769380e-48
MsaG038674	MsaG018328	0.805562	2.126791e-49	3.266669e-47
MsaG038674	MsaG019768	0.812528	6.966410e-51	1.265806e-48
MsaG038674	MsaG020224	0.823946	1.863242e-53	4.554138e-51
MsaG038674	MsaG018951	0.821195	8.068759e-53	1.831656e-50
MsaG038674	MsaG020214	0.824449	1.421234e-53	3.521777e-51
MsaG038674	MsaG024064	0.818516	3.283215e-52	6.944856e-50
MsaG038674	MsaG026612	0.809529	3.088890e-50	5.215443e-48
MsaG038674	MsaG024920	0.800084	2.842535e-48	3.850559e-46
MsaG038674	MsaG027357	0.801944	1.189723e-48	1.680888e-46
MsaG038674	MsaG026813	0.802546	8.955298e-49	1.282808e-46
MsaG038674	MsaG025429	0.815494	1.555697e-51	3.045044e-49
MsaG038674	MsaG030882	0.807829	7.099040e-50	1.150545e-47
MsaG038674	MsaG033142	0.804965	2.832808e-49	4.291237e-47
MsaG038674	MsaG033838	0.818473	3.357650e-52	7.094243e-50
MsaG038674	MsaG034192	0.821058	8.673882e-53	1.961928e-50
MsaG038674	MsaG031467	0.804992	2.795920e-49	4.238039e-47
MsaG038674	MsaG033413	0.819524	1.942273e-52	4.218204e-50
MsaG038674	MsaG030783	0.820931	9.276300e-53	2.091091e-50
MsaG038674	MsaG033036	0.803336	6.160597e-49	8.986450e-47
MsaG038674	MsaG031525	0.802136	1.086895e-48	1.542297e-46
MsaG038674	MsaG032996	0.813182	5.017719e-51	9.266893e-49
MsaG038674	MsaG032585	0.811097	1.422518e-50	2.495196e-48
MsaG038674	MsaG036708	0.813510	4.254017e-51	7.921346e-49
MsaG038674	MsaG036640	0.803970	4.557357e-49	6.746185e-47
MsaG038674	MsaG036499	0.816290	1.035882e-51	2.069065e-49
MsaG038674	MsaG037759	0.801192	1.693992e-48	2.352799e-46
MsaG038674	MsaG042682	0.816162	1.105623e-51	2.201221e-49
MsaG038674	MsaG044301	0.801035	1.823234e-48	2.523336e-46
MsaG038674	MsaG041441	0.806942	1.092683e-49	1.733808e-47
MsaG038674	MsaG047199	0.823444	2.438606e-53	5.879962e-51

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG038674	MtrunA17_Chr7g0249221	99.731	372	1	0	1	372	1	372	0.0	776
MsaG038674	MtrunA17_Chr4g0066941	45.722	374	146	12	27	352	43	407	5.90e-95	296
MsaG038674	MtrunA17_Chr4g0066941	45.161	93	51	0	275	367	88	180	1.21e-19	91.7
MsaG038674	MtrunA17_Chr1g0195891	48.297	323	152	7	9	325	30	343	3.90e-91	281
MsaG038674	MtrunA17_Chr1g0195891	47.727	88	46	0	275	362	91	178	1.60e-18	86.7
MsaG038674	MtrunA17_Chr1g0195891	58.182	55	21	1	72	126	295	347	3.39e-13	70.9
MsaG038674	MtrunA17_Chr5g0438891	43.732	343	153	11	23	357	32	342	1.98e-88	276
MsaG038674	MtrunA17_Chr2g0286151	42.632	380	184	10	8	365	26	393	6.77e-88	277
MsaG038674	MtrunA17_Chr3g0116431	38.527	353	190	8	4	353	150	478	4.91e-73	239
MsaG038674	MtrunA17_Chr3g0116431	41.758	91	38	2	275	357	171	254	1.43e-13	72.8
MsaG038674	MtrunA17_Chr4g0058011	40.000	330	165	10	27	350	231	533	6.57e-67	224
MsaG038674	MtrunA17_Chr4g0058011	40.541	111	65	1	72	181	458	568	2.26e-21	97.1
MsaG038674	MtrunA17_Chr4g0058011	26.068	234	94	6	32	206	329	542	3.19e-15	78.2
MsaG038674	MtrunA17_Chr4g0058011	40.909	88	48	2	275	359	231	317	1.55e-12	69.7
MsaG038674	MtrunA17_Chr8g0356241	32.741	394	188	13	5	350	110	474	2.79e-49	176
MsaG038674	MtrunA17_Chr8g0356241	35.088	171	66	3	28	153	310	480	1.98e-25	108
MsaG038674	MtrunA17_Chr8g0356241	49.367	79	35	2	275	353	190	263	5.79e-17	83.6

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG038674	AT3G02830.1	64.491	383	101	8	8	384	18	371	5.12e-173	492
MsaG038674	AT3G02830.2	64.474	380	100	8	11	384	1	351	4.56e-171	486
MsaG038674	AT5G16540.1	57.407	378	95	9	1	362	1	328	7.48e-148	427
MsaG038674	AT5G16540.1	47.368	95	47	1	275	366	84	178	2.25e-20	93.2
MsaG038674	AT5G16540.1	41.053	95	49	2	275	363	39	132	1.49e-15	78.6
MsaG038674	AT5G16540.3	56.417	374	109	7	11	380	1	324	4.55e-146	422
MsaG038674	AT5G16540.2	55.820	378	94	10	1	362	1	321	2.80e-140	407
MsaG038674	AT5G16540.2	47.368	95	47	1	275	366	84	178	1.82e-20	93.2
MsaG038674	AT5G16540.2	41.053	95	49	2	275	363	39	132	1.19e-15	79.0
MsaG038674	AT5G16540.4	56.113	319	86	7	11	325	1	269	9.22e-120	352
MsaG038674	AT5G16540.4	47.368	95	47	1	275	366	63	157	1.09e-20	92.0
MsaG038674	AT5G16540.4	39.796	98	52	2	272	363	15	111	8.31e-16	77.8
MsaG038674	AT2G47850.1	50.134	373	160	9	2	366	23	377	1.24e-118	356
MsaG038674	AT2G47850.3	50.134	373	160	9	2	366	23	377	1.24e-118	356
MsaG038674	AT2G47850.2	45.013	371	156	10	2	366	23	351	1.00e-95	296
MsaG038674	AT5G18550.3	45.401	337	156	9	27	349	16	338	1.49e-95	295
MsaG038674	AT5G18550.3	33.548	155	66	5	72	192	265	416	4.41e-17	84.0
MsaG038674	AT5G18550.1	45.401	337	156	9	27	349	48	370	2.75e-95	296
MsaG038674	AT5G18550.1	33.548	155	66	5	72	192	297	448	4.73e-17	84.0
MsaG038674	AT5G18550.4	45.401	337	156	9	27	349	48	370	2.77e-95	295
MsaG038674	AT5G18550.4	33.548	155	66	5	72	192	297	448	5.18e-17	83.6
MsaG038674	AT3G06410.1	43.956	364	167	11	8	349	30	378	1.79e-88	278
MsaG038674	AT5G18550.2	43.027	337	151	9	27	349	48	357	8.61e-88	276
MsaG038674	AT5G18550.2	30.968	155	57	5	72	192	297	435	7.83e-13	70.9
MsaG038674	AT1G04990.1	41.618	346	164	7	8	351	25	334	1.09e-84	266
MsaG038674	AT1G04990.6	41.618	346	164	7	8	351	25	334	1.09e-84	266
MsaG038674	AT1G04990.2	41.618	346	164	7	8	351	25	334	1.09e-84	266
MsaG038674	AT3G48440.1	42.816	348	157	11	19	351	99	419	3.44e-81	259
MsaG038674	AT3G48440.1	34.328	134	40	2	265	350	97	230	4.07e-16	80.9
MsaG038674	AT1G04990.5	39.595	346	151	8	8	351	25	314	3.62e-76	244
MsaG038674	AT2G32930.2	37.921	356	182	9	8	357	22	344	8.25e-74	240
MsaG038674	AT2G32930.3	38.571	350	176	9	14	357	1	317	1.86e-73	238
MsaG038674	AT2G47850.4	48.864	264	115	8	111	366	4	255	1.86e-72	233
MsaG038674	AT2G47850.4	57.895	76	32	0	72	147	164	239	4.30e-25	106
MsaG038674	AT2G47850.4	46.053	76	40	1	27	101	164	239	2.37e-16	80.9
MsaG038674	AT5G63260.1	39.481	347	180	8	27	366	98	421	1.08e-70	231
MsaG038674	AT5G63260.1	35.484	124	33	2	274	350	97	220	2.93e-15	78.2
MsaG038674	AT2G32930.1	37.079	356	181	10	8	357	22	340	7.88e-69	227
MsaG038674	AT5G63260.2	37.741	363	180	9	27	366	98	437	1.09e-66	221
MsaG038674	AT1G04990.3	40.809	272	125	6	82	351	16	253	7.15e-59	197
MsaG038674	AT1G04990.3	37.931	87	53	1	61	147	167	252	6.07e-13	70.1
MsaG038674	AT3G12680.1	33.428	353	182	10	27	350	171	499	1.01e-53	189
MsaG038674	AT3G12680.1	33.796	216	86	5	13	186	323	523	1.37e-29	122
MsaG038674	AT3G12680.1	51.899	79	35	1	275	353	222	297	3.86e-19	90.5
MsaG038674	AT3G12680.1	40.000	110	46	2	6	101	396	499	6.17e-19	90.1
MsaG038674	AT3G12680.1	45.238	84	37	3	274	350	170	251	4.82e-12	68.6
MsaG038674	AT1G04990.4	38.235	272	112	7	82	351	16	233	3.19e-50	173
MsaG038674	AT1G48195.1	53.846	78	36	0	272	349	3	80	2.04e-25	99.8
MsaG038674	AT1G48195.1	48.684	76	39	0	71	146	5	80	9.24e-19	81.3
MsaG038674	AT1G48195.1	40.000	80	47	1	22	100	1	80	3.32e-13	65.5
MsaG038674	AT1G29600.2	38.095	84	39	3	24	106	125	196	7.07e-11	63.9
MsaG038674	AT1G29600.1	38.095	84	39	3	24	106	119	190	8.18e-11	63.5

Find 148 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
AGAACTGGTCAATGCAAATT+TGG	0.130342	7:-79407212	MsaT038674.1:CDS
TCTGGCTGCCCTAACCTTTC+TGG	0.134070	7:+79409370	None:intergenic
AAAACAGGAACTTGCAAATT+TGG	0.136623	7:-79407638	MsaT038674.1:CDS
TAAAAGGTGGTAGTCCTTTC+TGG	0.208043	7:-79403898	MsaT038674.1:CDS
CGGTATGGCATATGCAAATT+TGG	0.215054	7:-79404868	MsaT038674.1:CDS
GCAACCCCAGCCTTGTCTTT+AGG	0.238635	7:+79407593	None:intergenic
CAACTGCATGTTCCAATAAA+AGG	0.261960	7:-79403914	MsaT038674.1:CDS
AAAGACAAGGCTGGGGTTGC+TGG	0.272337	7:-79407590	MsaT038674.1:CDS
GTCCTTTCTGGCCTGGAGTA+TGG	0.280972	7:-79403886	MsaT038674.1:CDS
GGGGCCTTGCCACCTTGGAC+TGG	0.285983	7:+79407037	None:intergenic
ACTCCTTGAGGTAGAATTAA+AGG	0.289469	7:+79407002	None:intergenic
CAAGTACATGCCTGACATTC+TGG	0.292463	7:+79409352	None:intergenic
AGAACCGGCCTTTGTAGATT+TGG	0.298865	7:-79409960	MsaT038674.1:CDS
CAAGGAGTGGTTTCAGTGCC+TGG	0.319809	7:-79406987	MsaT038674.1:CDS
CCTGATTCCATTGTTTCACT+TGG	0.338494	7:+79410029	None:intergenic
CTGGCTGCCCTAACCTTTCT+GGG	0.342700	7:+79409371	None:intergenic
TTCATGTAGAATTGGCATTC+AGG	0.344518	7:+79406119	None:intergenic
TTCATTATTCTAGGGTCAAA+TGG	0.349387	7:-79406318	MsaT038674.1:intron
CCATCCTCAACCAAGTAATA+TGG	0.367721	7:-79407171	MsaT038674.1:CDS
CCCCAGTCTTCATGTAGAAT+TGG	0.370124	7:+79406111	None:intergenic
GATGGTCAAACTTGCAGCTT+GGG	0.376214	7:+79404845	None:intergenic
GGGCCTTGCCACCTTGGACT+GGG	0.379660	7:+79407038	None:intergenic
AGGTGATGCAGATACATTAT+AGG	0.382033	7:+79404807	None:intergenic
GAACTGGTCAATGCAAATTT+GGG	0.387377	7:-79407211	MsaT038674.1:CDS
TGTGCTTATTATTTAAGAAC+TGG	0.391344	7:-79407227	MsaT038674.1:CDS
GTATATTCTCAATACCGTTC+TGG	0.396199	7:-79406206	MsaT038674.1:CDS
GACTGGACAGTAGGATAAAC+AGG	0.398708	7:+79407128	None:intergenic
GGTTTAATCATCCTCCTAAC+AGG	0.403742	7:-79409926	MsaT038674.1:CDS
GTTCGTACCAGCTTCCTGTT+AGG	0.404770	7:+79409912	None:intergenic
AGGGGACTCAAAACACAATC+AGG	0.404981	7:+79406029	None:intergenic
AAGACTGGGGATTGCAAGTT+CGG	0.406993	7:-79406098	MsaT038674.1:CDS
TTACAGTACTATCTGAAAAC+AGG	0.407139	7:-79407653	MsaT038674.1:intron
AATTGGCATTCAGGCTGATC+AGG	0.416142	7:+79406128	None:intergenic
CACTTTGTGTATTCTATTCG+CGG	0.422525	7:-79404888	MsaT038674.1:CDS
TCAGGCTGATCAGGTCTCTC+TGG	0.434727	7:+79406137	None:intergenic
ATCATCCTAAAGACAAGGCT+GGG	0.436765	7:-79407598	MsaT038674.1:CDS
ATGCGGCAGGAATTACAAAT+TGG	0.438347	7:-79407079	MsaT038674.1:CDS
CTTGAGGGGCCTTGCCACCT+TGG	0.438502	7:+79407032	None:intergenic
GCCGCAGGACGGCGTCTGCT+AGG	0.441580	7:-79404775	MsaT038674.1:intron
AAAGTCAAGACTGTGAATTT+CGG	0.442701	7:-79403988	MsaT038674.1:CDS
AATGGAATCAGGACCGTATC+CGG	0.442898	7:-79410018	MsaT038674.1:CDS
CGTCCTGCGGCTTCAGCTAA+AGG	0.445120	7:+79404787	None:intergenic
TGTGTATTCTATTCGCGGTA+TGG	0.447990	7:-79404883	MsaT038674.1:CDS
GTTAGGGCAGCCAGAATGTC+AGG	0.459032	7:-79409362	MsaT038674.1:intron
TGCAAAGCATAGAATCCTAC+TGG	0.461939	7:+79406176	None:intergenic
GGCGAGTTCCCAGAAAGGTT+AGG	0.462182	7:-79409379	MsaT038674.1:CDS
ATTGGAAGTACCATATTACT+TGG	0.463756	7:+79407161	None:intergenic
TGCCAATTCTACATGAAGAC+TGG	0.464264	7:-79406113	MsaT038674.1:CDS
CCAAGTGAAACAATGGAATC+AGG	0.466799	7:-79410029	MsaT038674.1:CDS
TGTTCATATTACATAAGAAC+CGG	0.466818	7:-79409975	MsaT038674.1:CDS
CTTATGTAATATGAACAATC+TGG	0.467160	7:+79409981	None:intergenic
TCATTTCTCATTGTTTGTTG+TGG	0.469765	7:+79406284	None:intergenic
TCATTATTCTAGGGTCAAAT+GGG	0.471117	7:-79406317	MsaT038674.1:intron
GCGAGTTCCCAGAAAGGTTA+GGG	0.476077	7:-79409378	MsaT038674.1:CDS
TATGAACAATCTGGTTCTCC+AGG	0.476295	7:+79409990	None:intergenic
TCTCCAGGATGCTCCGGATA+CGG	0.476462	7:+79410005	None:intergenic
CTGGCCTGGAGTATGGTTAA+CGG	0.482183	7:-79403879	MsaT038674.1:intron
CCAGAAAATGCAGGACTCCC+AGG	0.485002	7:-79406230	MsaT038674.1:CDS
GGTGGTAGTCCTTTCTGGCC+TGG	0.486907	7:-79403893	MsaT038674.1:CDS
ATTAAAGGTGCATAACTTGA+GGG	0.486909	7:+79407017	None:intergenic
CATCATCCTAAAGACAAGGC+TGG	0.496258	7:-79407599	MsaT038674.1:CDS
AAGGAGTGGTTTCAGTGCCT+GGG	0.496753	7:-79406986	MsaT038674.1:CDS
GCAAATTTGGAGCCACATGC+AGG	0.499420	7:-79407625	MsaT038674.1:CDS
ATGAGAAATGATCAAACCTA+TGG	0.501705	7:-79406272	MsaT038674.1:CDS
GGATGGTCAAACTTGCAGCT+TGG	0.504043	7:+79404844	None:intergenic
CGGTATTGAGAATATACCCC+TGG	0.505547	7:+79406212	None:intergenic
GACTGCTGACCTGCTGTAGT+TGG	0.505631	7:+79407104	None:intergenic
TAAACAGGAGAACCTCTCAT+TGG	0.506558	7:+79407143	None:intergenic
TCTGGTTCTCCAGGATGCTC+CGG	0.509312	7:+79409999	None:intergenic
TGGATAGCCTAAAATATTCA+AGG	0.511388	7:+79407559	None:intergenic
ACTAAGTACCTGAGCTGTCA+AGG	0.516629	7:+79399274	None:intergenic
GGACCGTATCCGGAGCATCC+TGG	0.519002	7:-79410008	MsaT038674.1:CDS
GTTCATTGTGCAGAAGTTGA+AGG	0.519835	7:-79404014	MsaT038674.1:CDS
AGGATTCTATGCTTTGCAAA+GGG	0.522548	7:-79406171	MsaT038674.1:CDS
TGCTCCAAATCTACAAAGGC+CGG	0.524252	7:+79409956	None:intergenic
AGTACCATATTACTTGGTTG+AGG	0.526229	7:+79407167	None:intergenic
AAAAGAGAAGAAAACCTTGA+GGG	0.534377	7:+79410886	None:intergenic
ATTGCCACTGCACGGATGAA+AGG	0.537603	7:-79409400	MsaT038674.1:CDS
CAGGACGCAAAGGAAGGCCA+AGG	0.538208	7:+79406009	None:intergenic
CCATATTACTTGGTTGAGGA+TGG	0.539028	7:+79407171	None:intergenic
TTCATTGTGCAGAAGTTGAA+GGG	0.539179	7:-79404013	MsaT038674.1:CDS
GCTATTGAGATACCAGCAAA+AGG	0.541085	7:-79399357	MsaT038674.1:CDS
GCCAATTCTACATGAAGACT+GGG	0.541639	7:-79406112	MsaT038674.1:CDS
TGCAAGTTTGACCATCCAAT+GGG	0.542643	7:-79404838	MsaT038674.1:CDS
CGTACCAGCTTCCTGTTAGG+AGG	0.546788	7:+79409915	None:intergenic
AGGTGAAGATTCCCATTGGA+TGG	0.548300	7:+79404827	None:intergenic
GACCTGCTGTAGTTGGAGAC+TGG	0.551761	7:+79407111	None:intergenic
CGTTCTGGCTCTGTTCCAGT+AGG	0.552611	7:-79406191	MsaT038674.1:CDS
GGTCAGCAGTCATATGCGGC+AGG	0.561665	7:-79407092	MsaT038674.1:CDS
CAGAAAATGCAGGACTCCCA+GGG	0.561675	7:-79406229	MsaT038674.1:CDS
TCATCCTCCTAACAGGAAGC+TGG	0.561961	7:-79409919	MsaT038674.1:intron
TAGGATTCTATGCTTTGCAA+AGG	0.563647	7:-79406172	MsaT038674.1:CDS
TTTATTGGAACATGCAGTTG+AGG	0.566416	7:+79403917	None:intergenic
CTTGAGGCCAAGTGAAACAA+TGG	0.571072	7:-79410036	MsaT038674.1:CDS
CTCAAAACACAATCAGGGGC+AGG	0.571149	7:+79406035	None:intergenic
TTTAATTCTACCTCAAGGAG+TGG	0.571343	7:-79407000	MsaT038674.1:CDS
CGCGAATAGAATACACAAAG+TGG	0.573840	7:+79404889	None:intergenic
GCACCTTTAATTCTACCTCA+AGG	0.574609	7:-79407005	MsaT038674.1:CDS
CTGCAAGTTTGACCATCCAA+TGG	0.575545	7:-79404839	MsaT038674.1:CDS
GTCCAGTCTCCAACTACAGC+AGG	0.575929	7:-79407113	MsaT038674.1:CDS
GAATCGTCCTCTCACGTGGA+TGG	0.576252	7:+79406057	None:intergenic
AATTAAAGGTGCATAACTTG+AGG	0.578502	7:+79407016	None:intergenic
TCACCTTTAGCTGAAGCCGC+AGG	0.584776	7:-79404790	MsaT038674.1:CDS
GGGGACTCAAAACACAATCA+GGG	0.586867	7:+79406030	None:intergenic
TTATAGGTGAAGATTCCCAT+TGG	0.587312	7:+79404823	None:intergenic
ATTCCCAGTCCAAGGTGGCA+AGG	0.587489	7:-79407041	MsaT038674.1:CDS
CAAGGTGATCCAGAAAATGC+AGG	0.595566	7:-79406239	MsaT038674.1:CDS
CTAAGTACCTGAGCTGTCAA+GGG	0.595696	7:+79399275	None:intergenic
GTCAGGCTATTGCCACTGCA+CGG	0.597527	7:-79409408	MsaT038674.1:intron
AGGACGCAAAGGAAGGCCAA+GGG	0.598969	7:+79406010	None:intergenic
GTAGTTGGAGACTGGACAGT+AGG	0.599936	7:+79407119	None:intergenic
GAGAAGAAAACCTTGAGGGA+TGG	0.601696	7:+79410890	None:intergenic
CATCATATATTCCCAGTCCA+AGG	0.605376	7:-79407049	MsaT038674.1:CDS
AACTCACAGGACGCAAAGGA+AGG	0.607839	7:+79406003	None:intergenic
AACCATACTCCAGGCCAGAA+AGG	0.607867	7:+79403884	None:intergenic
CTCGCCTTTCATCCGTGCAG+TGG	0.608806	7:+79409396	None:intergenic
CAATGTGGCAAATGAGCTTG+AGG	0.610902	7:-79410052	MsaT038674.1:CDS
TGTACCGTTAACCATACTCC+AGG	0.613608	7:+79403875	None:intergenic
GAATACGATGCCATCCCTCA+AGG	0.613701	7:-79410900	MsaT038674.1:intron
TGAAAGGCGAGTTCCCAGAA+AGG	0.615643	7:-79409384	MsaT038674.1:CDS
GCAGGAATCGTCCTCTCACG+TGG	0.617223	7:+79406053	None:intergenic
ACCTTGGTGAGAAGTTCCAT+AGG	0.618037	7:+79406256	None:intergenic
TATCAACTCACAGGACGCAA+AGG	0.625938	7:+79405999	None:intergenic
ACCTAGCAGACGCCGTCCTG+CGG	0.633483	7:+79404774	None:intergenic
GAGTGGTTTCAGTGCCTGGG+TGG	0.634998	7:-79406983	MsaT038674.1:CDS
CTGCATGTTCCAATAAAAGG+TGG	0.635608	7:-79403911	MsaT038674.1:CDS
ATACATGAATGACATAGTGA+AGG	0.636300	7:-79399379	MsaT038674.1:CDS
CTACTGGAACAGAGCCAGAA+CGG	0.644056	7:+79406192	None:intergenic
TTGGTATTTCAGAGGCAATG+TGG	0.648210	7:-79410067	MsaT038674.1:intron
AGCAGGTCAGCAGTCATATG+CGG	0.648949	7:-79407096	MsaT038674.1:CDS
CTTTAGCTGAAGCCGCAGGA+CGG	0.650765	7:-79404786	MsaT038674.1:CDS
GGCACTGAAACCACTCCTTG+AGG	0.654184	7:+79406990	None:intergenic
GTAGATTTGGAGCAACATGT+CGG	0.656899	7:-79409947	MsaT038674.1:CDS
TCATCCTAAAGACAAGGCTG+GGG	0.657086	7:-79407597	MsaT038674.1:CDS
AATATGGTACTTCCAATGAG+AGG	0.663744	7:-79407155	MsaT038674.1:CDS
TTAAAGGTGCATAACTTGAG+GGG	0.664735	7:+79407018	None:intergenic
GGGACTCAAAACACAATCAG+GGG	0.668670	7:+79406031	None:intergenic
TGAATACTAACTGGGCGGAG+TGG	0.668928	7:+79407539	None:intergenic
GGTATTGAGAATATACCCCT+GGG	0.672817	7:+79406213	None:intergenic
GGACGCAAAGGAAGGCCAAG+GGG	0.673705	7:+79406011	None:intergenic
CATATATTCCCAGTCCAAGG+TGG	0.674314	7:-79407046	MsaT038674.1:CDS
ACCTATGGAACTTCTCACCA+AGG	0.676965	7:-79406257	MsaT038674.1:CDS
ATGTTGCTCCAAATCTACAA+AGG	0.680968	7:+79409952	None:intergenic
GTTTCATCATCCTAAAGACA+AGG	0.693217	7:-79407603	MsaT038674.1:CDS
ACATTGTATGTACTCCACCC+AGG	0.709130	7:+79406969	None:intergenic
CCAATTCTACATGAAGACTG+GGG	0.719635	7:-79406111	MsaT038674.1:CDS
AGGATGATGAAACCTGCATG+TGG	0.722276	7:+79407613	None:intergenic
AGAAAATGCAGGACTCCCAG+GGG	0.722646	7:-79406228	MsaT038674.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr7	gene	79399091	79410925	79399091	ID=MsaG038674
Chr7	mRNA	79399091	79410925	79399091	ID=MsaT038674.1;Parent=MsaG038674
Chr7	exon	79399091	79399104	79399091	ID=MsaT038674.1.exon10;Parent=MsaT038674.1
Chr7	CDS	79399091	79399104	79399091	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79399283	79399424	79399283	ID=MsaT038674.1.exon9;Parent=MsaT038674.1
Chr7	CDS	79399283	79399424	79399283	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79403880	79404037	79403880	ID=MsaT038674.1.exon8;Parent=MsaT038674.1
Chr7	CDS	79403880	79404037	79403880	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79404776	79404917	79404776	ID=MsaT038674.1.exon7;Parent=MsaT038674.1
Chr7	CDS	79404776	79404917	79404776	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79406010	79406327	79406010	ID=MsaT038674.1.exon6;Parent=MsaT038674.1
Chr7	CDS	79406010	79406327	79406010	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79406971	79407261	79406971	ID=MsaT038674.1.exon5;Parent=MsaT038674.1
Chr7	CDS	79406971	79407261	79406971	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79407550	79407669	79407550	ID=MsaT038674.1.exon4;Parent=MsaT038674.1
Chr7	CDS	79407550	79407669	79407550	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79409363	79409425	79409363	ID=MsaT038674.1.exon3;Parent=MsaT038674.1
Chr7	CDS	79409363	79409425	79409363	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79409920	79410077	79409920	ID=MsaT038674.1.exon2;Parent=MsaT038674.1
Chr7	CDS	79409920	79410077	79409920	ID=cds.MsaT038674.1;Parent=MsaT038674.1
Chr7	exon	79410901	79410925	79410901	ID=MsaT038674.1.exon1;Parent=MsaT038674.1
Chr7	CDS	79410901	79410925	79410901	ID=cds.MsaT038674.1;Parent=MsaT038674.1

Gene Sequence

>MsaT038674.1

ATGGAATACGATGCCATCCCTCAAGAGGCAATGTGGCAAATGAGCTTGAGGCCAAGTGAAACAATGGAATCAGGACCGTATCCGGAGCATCCTGGAGAACCAGATTGTTCATATTACATAAGAACCGGCCTTTGTAGATTTGGAGCAACATGTCGGTTTAATCATCCTCCTAACAGGAAGCTGGCTATTGCCACTGCACGGATGAAAGGCGAGTTCCCAGAAAGGTTAGGGCAGCCAGAATGTCAGTACTATCTGAAAACAGGAACTTGCAAATTTGGAGCCACATGCAGGTTTCATCATCCTAAAGACAAGGCTGGGGTTGCTGGAAGAGTTGCCTTGAATATTTTAGGCTATCCACTCCGCCCAAATGAGTCTGAATGTGCTTATTATTTAAGAACTGGTCAATGCAAATTTGGGAACACTTGTAAATTTCACCATCCTCAACCAAGTAATATGGTACTTCCAATGAGAGGTTCTCCTGTTTATCCTACTGTCCAGTCTCCAACTACAGCAGGTCAGCAGTCATATGCGGCAGGAATTACAAATTGGTCTACTTCATCATATATTCCCAGTCCAAGGTGGCAAGGCCCCTCAAGTTATGCACCTTTAATTCTACCTCAAGGAGTGGTTTCAGTGCCTGGGTGGAGTACATACAATGGTCAAATGGGATCAGACAGTCCACAACAAACAATGAGAAATGATCAAACCTATGGAACTTCTCACCAAGGTGATCCAGAAAATGCAGGACTCCCAGGGGTATATTCTCAATACCGTTCTGGCTCTGTTCCAGTAGGATTCTATGCTTTGCAAAGGGAGAACATTTTTCCAGAGAGACCTGATCAGCCTGAATGCCAATTCTACATGAAGACTGGGGATTGCAAGTTCGGTGCTGTCTGTCGTTTTCACCATCCACGTGAGAGGACGATTCCTGCCCCTGATTGTGTTTTGAGTCCCCTTGGCCTTCCTTTGCGTCCTGGAGAACCACTTTGTGTATTCTATTCGCGGTATGGCATATGCAAATTTGGCCCAAGCTGCAAGTTTGACCATCCAATGGGAATCTTCACCTATAATGTATCTGCATCACCTTTAGCTGAAGCCGCAGGACGGCGTCTGCTAGAGTTCATTGTGCAGAAGTTGAAGGGCAAAAGTCAAGACTGTGAATTTCGGCGACATCAAAAGCACACATTAATTATATGCTGTTTTGCAGATATCAAGCCTCAACTGCATGTTCCAATAAAAGGTGGTAGTCCTTTCTGGCCTGGAGTATGGTTAACGTTGTTGAATTTTTTCTGGTTTATATACATGAATGACATAGTGAAGGCTATTGAGATACCAGCAAAAGGATTTAAAAGTTTTTCAGCATTTAATGAAGAATTATTCAAAGAAATTACGCATCTTTTAACCCTTGACAGCTCAGATAATGATGTTTAA

Protein sequence

>MsaT038674.1

MEYDAIPQEAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYLRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQQSYAAGITNWSTSSYIPSPRWQGPSSYAPLILPQGVVSVPGWSTYNGQMGSDSPQQTMRNDQTYGTSHQGDPENAGLPGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEAAGRRLLEFIVQKLKGKSQDCEFRRHQKHTLIICCFADIKPQLHVPIKGGSPFWPGVWLTLLNFFWFIYMNDIVKAIEIPAKGFKSFSAFNEELFKEITHLLTLDSSDNDV*