AlfalfaGEDB | MsaG045294

M. sativa ssp. caerulea / MsaG045294

KEGG: -
GO: GO:0003674 GO:0003700 GO:0006355 GO:0007275 GO:0008150 GO:0009653 GO:0009889 GO:0009965 GO:0009987 GO:0010016 GO:0010468 GO:0010556 GO:0019219 GO:0019222 GO:0030154 GO:0031323 GO:0031326 GO:0032501 GO:0032502 GO:0040034 GO:0045962 GO:0048366 GO:0048367 GO:0048731 GO:0048827 GO:0048856 GO:0048869 GO:0050789 GO:0050793 GO:0050794 GO:0051171 GO:0051252 GO:0060255 GO:0065007 GO:0080090 GO:0099402 GO:0140110 GO:1903506 GO:1905392 GO:2000112 GO:2001141
PFAM: PF03634.16

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045294	XP_024637615.1	95.752	306	10	3	1	304	12	316	0.0	581

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045294	sp\|Q9FME3\|TCP5_ARATH	80.682	88	16	1	39	125	45	132	5.37e-45	159

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045294	tr\|A0A396IG22\|A0A396IG22_MEDTR	95.752	306	10	3	1	304	2	306	0.0	581

TFs/TRs:

Gene ID	Type	Classification
MsaG045294	TF	TCP

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000083	MsaG045294	0.811484	1.173270e-50	2.077638e-48
MsaG000863	MsaG045294	0.866212	6.747536e-65	6.692407e-62
MsaG002291	MsaG045294	0.824826	1.159629e-53	2.903178e-51
MsaG003000	MsaG045294	0.831665	2.649657e-55	8.045851e-53
MsaG003690	MsaG045294	0.800641	2.191718e-48	3.006661e-46
MsaG004154	MsaG045294	0.805348	2.357747e-49	3.603516e-47
MsaG004189	MsaG045294	0.812023	8.968370e-51	1.609253e-48
MsaG004689	MsaG045294	0.837943	7.083669e-57	2.593435e-54
MsaG005847	MsaG045294	0.810328	2.082435e-50	3.584819e-48
MsaG006199	MsaG045294	0.806476	1.368976e-49	2.148647e-47
MsaG006256	MsaG045294	0.800917	1.926955e-48	2.659762e-46
MsaG006871	MsaG045294	0.828152	1.884555e-54	5.175618e-52
MsaG009185	MsaG045294	0.802502	9.141275e-49	1.308132e-46
MsaG009506	MsaG045294	0.851256	1.907990e-60	1.079861e-57
MsaG009532	MsaG045294	0.810362	2.047306e-50	3.527349e-48
MsaG009762	MsaG045294	0.831732	2.550883e-55	7.761229e-53
MsaG010331	MsaG045294	0.839703	2.496499e-57	9.655350e-55
MsaG010573	MsaG045294	0.803440	5.863016e-49	8.572992e-47
MsaG010968	MsaG045294	0.833794	7.892194e-56	2.550100e-53
MsaG011202	MsaG045294	0.804616	3.347755e-49	5.030277e-47
MsaG011413	MsaG045294	0.812285	7.866661e-51	1.420707e-48
MsaG042799	MsaG045294	0.836480	1.670170e-56	5.848599e-54
MsaG043286	MsaG045294	0.847266	2.433423e-59	1.202286e-56
MsaG044312	MsaG045294	0.800840	1.997627e-48	2.752572e-46
MsaG044313	MsaG045294	0.804533	3.484063e-49	5.225094e-47
MsaG044703	MsaG045294	0.834661	4.793829e-56	1.589650e-53
MsaG044946	MsaG045294	0.818792	2.844952e-52	6.061201e-50
MsaG045121	MsaG045294	0.841078	1.094998e-57	4.422203e-55
MsaG045122	MsaG045294	0.810675	1.754085e-50	3.045140e-48
MsaG045152	MsaG045294	0.815096	1.905596e-51	3.692559e-49
MsaG045294	MsaG045295	0.941090	2.252669e-100	2.322469e-95
MsaG045294	MsaG045314	0.927350	3.558107e-91	1.173427e-86
MsaG045294	MsaG045333	0.831541	2.841477e-55	8.596543e-53
MsaG045294	MsaG045348	0.830281	5.768187e-55	1.682856e-52
MsaG045294	MsaG045708	0.800878	1.962409e-48	2.706348e-46
MsaG045294	MsaG046128	0.803967	4.562595e-49	6.753535e-47
MsaG045294	MsaG046281	0.802695	8.346464e-49	1.199654e-46
MsaG045294	MsaG002656	0.813992	3.335790e-51	6.286957e-49
MsaG045294	MsaG003231	0.820440	1.201302e-52	2.673129e-50
MsaG045294	MsaG000658	0.808129	6.133863e-50	1.001302e-47
MsaG045294	MsaG011165	0.801155	1.723018e-48	2.391157e-46
MsaG045294	MsaG012727	0.824903	1.111901e-53	2.789681e-51
MsaG045294	MsaG016310	0.802297	1.007444e-48	1.434892e-46
MsaG045294	MsaG011618	0.807358	8.929226e-50	1.430898e-47
MsaG045294	MsaG020224	0.804489	3.557305e-49	5.329438e-47
MsaG045294	MsaG018616	0.829693	8.013179e-55	2.298772e-52
MsaG045294	MsaG020214	0.817569	5.362958e-52	1.106999e-49
MsaG045294	MsaG020276	0.875181	7.815097e-68	1.132890e-64
MsaG045294	MsaG026838	0.806295	1.493857e-49	2.334649e-47
MsaG045294	MsaG027357	0.802077	1.117093e-48	1.583097e-46
MsaG045294	MsaG033152	0.819372	2.102474e-52	4.548246e-50
MsaG045294	MsaG039944	0.819476	1.991588e-52	4.319976e-50
MsaG045294	MsaG045464	0.841705	7.501528e-58	3.090215e-55
MsaG045294	MsaG042480	0.800715	2.117771e-48	2.910019e-46
MsaG012692	MsaG045294	0.800010	2.942569e-48	3.979539e-46
MsaG012951	MsaG045294	0.802751	8.126177e-49	1.169487e-46
MsaG013182	MsaG045294	0.817236	6.367365e-52	1.303180e-49
MsaG013327	MsaG045294	0.803214	6.525863e-49	9.492695e-47
MsaG014295	MsaG045294	0.816585	8.901361e-52	1.791422e-49
MsaG015799	MsaG045294	0.814581	2.475642e-51	4.735123e-49
MsaG015757	MsaG045294	0.824946	1.086326e-53	2.728673e-51
MsaG015769	MsaG045294	0.837845	7.503078e-57	2.738716e-54
MsaG015930	MsaG045294	0.804328	3.842016e-49	5.734732e-47
MsaG016239	MsaG045294	0.810026	2.417452e-50	4.130885e-48
MsaG016250	MsaG045294	0.801282	1.623452e-48	2.259447e-46
MsaG016504	MsaG045294	0.813652	3.959647e-51	7.399294e-49
MsaG017281	MsaG045294	0.833648	8.580870e-56	2.760870e-53
MsaG017573	MsaG045294	0.810463	1.948262e-50	3.364902e-48
MsaG018355	MsaG045294	0.840637	1.427035e-57	5.683332e-55
MsaG018446	MsaG045294	0.811382	1.234364e-50	2.180363e-48
MsaG018624	MsaG045294	0.843834	2.050591e-58	9.043436e-56
MsaG020221	MsaG045294	0.834158	6.404429e-56	2.091817e-53
MsaG020641	MsaG045294	0.801692	1.339473e-48	1.881653e-46
MsaG021312	MsaG045294	0.801362	1.564218e-48	2.180939e-46
MsaG021484	MsaG045294	0.801092	1.774888e-48	2.459582e-46
MsaG021781	MsaG045294	0.809670	2.881592e-50	4.881824e-48
MsaG021836	MsaG045294	0.813424	4.442690e-51	8.254847e-49
MsaG022048	MsaG045294	0.808183	5.973789e-50	9.764424e-48
MsaG022074	MsaG045294	0.828375	1.666352e-54	4.605284e-52
MsaG022388	MsaG045294	0.838753	4.388942e-57	1.647857e-54
MsaG022454	MsaG045294	0.813317	4.686924e-51	8.685155e-49
MsaG022609	MsaG045294	0.819947	1.555736e-52	3.416871e-50
MsaG022673	MsaG045294	0.802375	9.709765e-49	1.385440e-46
MsaG022981	MsaG045294	0.813055	5.347624e-51	9.845151e-49
MsaG023246	MsaG045294	0.801184	1.699850e-48	2.360558e-46
MsaG023230	MsaG045294	0.807263	9.348619e-50	1.494692e-47
MsaG023351	MsaG045294	0.800197	2.697154e-48	3.662853e-46
MsaG023728	MsaG045294	0.805356	2.348080e-49	3.589413e-47
MsaG023849	MsaG045294	0.800652	2.181117e-48	2.992821e-46
MsaG025367	MsaG045294	0.815424	1.612601e-51	3.150928e-49
MsaG025776	MsaG045294	0.811260	1.312049e-50	2.310635e-48
MsaG026252	MsaG045294	0.803318	6.212814e-49	9.058940e-47
MsaG027208	MsaG045294	0.800374	2.482835e-48	3.385411e-46
MsaG027982	MsaG045294	0.805918	1.791665e-49	2.775057e-47
MsaG028019	MsaG045294	0.814019	3.290013e-51	6.204825e-49
MsaG028740	MsaG045294	0.824444	1.424590e-53	3.529668e-51
MsaG028970	MsaG045294	0.808491	5.140643e-50	8.465066e-48
MsaG029524	MsaG045294	0.811539	1.141798e-50	2.024597e-48
MsaG029894	MsaG045294	0.803313	6.226687e-49	9.078128e-47
MsaG030833	MsaG045294	0.847125	2.657960e-59	1.307025e-56
MsaG032196	MsaG045294	0.810076	2.358578e-50	4.035242e-48
MsaG032531	MsaG045294	0.810511	1.902332e-50	3.289380e-48
MsaG032726	MsaG045294	0.816086	1.149531e-51	2.284146e-49
MsaG033732	MsaG045294	0.851630	1.497471e-60	8.585579e-58
MsaG034005	MsaG045294	0.817087	6.877974e-52	1.402260e-49
MsaG034180	MsaG045294	0.845201	8.827365e-59	4.071518e-56
MsaG034161	MsaG045294	0.801367	1.560065e-48	2.175448e-46
MsaG034651	MsaG045294	0.837065	1.186579e-56	4.229206e-54
MsaG035181	MsaG045294	0.805920	1.790693e-49	2.773626e-47
MsaG037253	MsaG045294	0.818378	3.527552e-52	7.435040e-50
MsaG037276	MsaG045294	0.841294	9.614323e-58	3.909340e-55
MsaG037333	MsaG045294	0.837742	7.974269e-57	2.901470e-54
MsaG037650	MsaG045294	0.807018	1.052945e-49	1.673800e-47
MsaG038452	MsaG045294	0.860263	4.585812e-63	3.602090e-60
MsaG038952	MsaG045294	0.824226	1.602964e-53	3.947823e-51
MsaG038991	MsaG045294	0.851586	1.541179e-60	8.822150e-58
MsaG039098	MsaG045294	0.835327	3.262834e-56	1.103678e-53
MsaG039848	MsaG045294	0.808706	4.625122e-50	7.656131e-48
MsaG040039	MsaG045294	0.829197	1.056336e-54	2.987326e-52
MsaG040336	MsaG045294	0.802581	8.807012e-49	1.262585e-46
MsaG040435	MsaG045294	0.800824	2.012333e-48	2.771864e-46
MsaG040499	MsaG045294	0.814258	2.915741e-51	5.532087e-49
MsaG040525	MsaG045294	0.805079	2.681624e-49	4.073016e-47
MsaG040545	MsaG045294	0.804865	2.972381e-49	4.492190e-47
MsaG040955	MsaG045294	0.814212	2.983518e-51	5.654267e-49
MsaG041623	MsaG045294	0.800430	2.419283e-48	3.302943e-46
MsaG041615	MsaG045294	0.811078	1.435916e-50	2.517550e-48
MsaG041801	MsaG045294	0.809941	2.521548e-50	4.299870e-48

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045294	MtrunA17_Chr4g0061561	95.752	306	10	3	1	304	2	306	0.0	581
MsaG045294	MtrunA17_Chr3g0086961	44.022	368	126	16	4	297	3	364	5.94e-59	193
MsaG045294	MtrunA17_Chr7g0219461	61.017	118	45	1	1	117	1	118	1.93e-43	152
MsaG045294	MtrunA17_Chr6g0454781	71.429	84	24	0	38	121	31	114	1.63e-37	136
MsaG045294	MtrunA17_Chr8g0376571	69.863	73	22	0	46	118	51	123	2.89e-28	114
MsaG045294	MtrunA17_Chr8g0360441	52.809	89	42	0	29	117	27	115	2.78e-22	96.3
MsaG045294	MtrunA17_Chr4g0040921	54.321	81	37	0	49	129	15	95	4.22e-22	94.7
MsaG045294	MtrunA17_Chr2g0325171	61.765	68	26	0	50	117	18	85	2.34e-21	92.4
MsaG045294	MtrunA17_Chr2g0316391	58.824	68	28	0	50	117	14	81	2.39e-20	89.0
MsaG045294	MtrunA17_Chr1g0205131	50.000	60	30	0	55	114	108	167	1.35e-12	67.8
MsaG045294	MtrunA17_Chr7g0220931	49.123	57	29	0	58	114	122	178	2.85e-12	66.6
MsaG045294	MtrunA17_Chr6g0456881	48.276	58	30	0	57	114	127	184	4.43e-12	66.2
MsaG045294	MtrunA17_Chr4g0062691	48.276	58	30	0	57	114	133	190	6.20e-12	65.9

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045294	AT5G60970.1	80.682	88	16	1	39	125	45	132	5.46e-46	159
MsaG045294	AT3G02150.1	43.062	209	101	7	10	200	28	236	3.59e-42	147
MsaG045294	AT3G02150.2	43.062	209	101	7	10	200	28	236	1.42e-41	147
MsaG045294	AT5G08070.2	50.676	148	64	4	21	168	2	140	1.68e-40	142
MsaG045294	AT5G08070.1	50.676	148	64	4	21	168	2	140	1.68e-40	142
MsaG045294	AT1G30210.2	55.752	113	44	3	8	118	4	112	3.84e-30	116
MsaG045294	AT1G30210.1	55.752	113	44	3	8	118	4	112	3.84e-30	116
MsaG045294	AT4G18390.1	68.493	73	23	0	46	118	32	104	3.33e-28	112
MsaG045294	AT4G18390.2	68.493	73	23	0	46	118	32	104	3.33e-28	112
MsaG045294	AT1G53230.1	57.500	80	31	1	50	126	43	122	2.54e-23	99.4
MsaG045294	AT1G53230.2	57.500	80	31	1	50	126	43	122	2.54e-23	99.4
MsaG045294	AT3G15030.2	61.765	68	26	0	50	117	39	106	3.85e-22	96.3
MsaG045294	AT3G15030.4	61.765	68	26	0	50	117	39	106	3.85e-22	96.3
MsaG045294	AT3G15030.3	61.765	68	26	0	50	117	39	106	3.85e-22	96.3
MsaG045294	AT3G15030.1	61.765	68	26	0	50	117	39	106	3.85e-22	96.3
MsaG045294	AT2G31070.1	60.606	66	26	0	49	114	22	87	2.39e-20	90.5
MsaG045294	AT1G68800.1	46.269	67	36	0	48	114	104	170	1.12e-14	73.9
MsaG045294	AT1G68800.2	46.269	67	36	0	48	114	104	170	1.27e-14	73.9
MsaG045294	AT1G67260.2	41.429	70	41	0	45	114	76	145	6.24e-14	72.0
MsaG045294	AT1G67260.3	41.429	70	41	0	45	114	76	145	6.24e-14	72.0
MsaG045294	AT1G67260.1	41.429	70	41	0	45	114	76	145	7.73e-14	71.6
MsaG045294	AT3G18550.1	39.024	82	49	1	33	114	126	206	2.21e-12	67.8
MsaG045294	AT3G18550.4	39.024	82	49	1	33	114	126	206	2.21e-12	67.8
MsaG045294	AT3G18550.2	39.024	82	49	1	33	114	126	206	2.25e-12	67.8
MsaG045294	AT3G18550.3	39.024	82	49	1	33	114	126	206	2.89e-12	67.4

Find 55 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
CGTCTAAACGGCGAATTTAT+TGG	0.202116	8:-70944545	None:intergenic
GAAATAAATTACCATGATTA+TGG	0.231308	8:-70944277	None:intergenic
ACTCTATCTTTATCACAATT+TGG	0.233467	8:+70944251	MsaT045294.1:CDS
CGTGACACTCTCACTATTCT+TGG	0.252002	8:-70943834	None:intergenic
CTTGAAGGATCCAATTTATA+TGG	0.254937	8:-70944227	None:intergenic
TACTACCTGGTTGCTGAAAT+AGG	0.258592	8:-70944085	None:intergenic
CTACCATAACTACCCATTTC+TGG	0.267833	8:-70944618	None:intergenic
AGCAAAGTTTGCACAATTAG+AGG	0.305586	8:+70943882	MsaT045294.1:CDS
TGATGTAGCTATTGCTTTGT+TGG	0.307657	8:-70943787	None:intergenic
GTGAGAGTGTCACGTTCTTT+AGG	0.317533	8:+70943843	MsaT045294.1:CDS
GATGATAATAACACCAGAAA+TGG	0.330153	8:+70944605	MsaT045294.1:CDS
AATTCACTACTTTCCATTGA+TGG	0.341892	8:-70944449	None:intergenic
GATTAAGAGACCGTAGGATT+AGG	0.348209	8:+70943904	MsaT045294.1:CDS
TGTGAATTACCAGATGAATT+AGG	0.362279	8:-70944365	None:intergenic
ACTACCTGGTTGCTGAAATA+GGG	0.363637	8:-70944084	None:intergenic
AATACTAATTATTCATCAAA+TGG	0.403938	8:+70944194	MsaT045294.1:CDS
CTAGTACTTATTTGATAAGA+AGG	0.404054	8:-70944299	None:intergenic
TTTATTGGAAGATGAATAGT+TGG	0.406511	8:-70944530	None:intergenic
AGAAGCTGAAAGTTCAGAAA+AGG	0.433467	8:+70944160	MsaT045294.1:CDS
TACTCTGAATGCTCCATCAA+TGG	0.441615	8:+70944436	MsaT045294.1:CDS
GTTCAAGATTTGAACATGGT+TGG	0.449373	8:-70944483	None:intergenic
TATGGTATGAATCAAACTAA+AGG	0.451228	8:+70944134	MsaT045294.1:CDS
TTGACAGTACCTAATTCATC+TGG	0.458238	8:+70944356	MsaT045294.1:CDS
AACCTAGCAAAGTTGTTGAA+TGG	0.462940	8:+70943985	MsaT045294.1:CDS
AGTGTTGGATGGCGTCTAAA+CGG	0.463809	8:-70944557	None:intergenic
ATCATCTGAATCAAGAAGCT+TGG	0.472188	8:-70944588	None:intergenic
TGAACATGGTTGGATTGTCT+TGG	0.473682	8:-70944473	None:intergenic
GGATCCAATTTATATGGAAA+AGG	0.478861	8:-70944221	None:intergenic
ATGATAATAACACCAGAAAT+GGG	0.506853	8:+70944606	MsaT045294.1:CDS
ATGAAAGAACCATTACTTGA+GGG	0.508573	8:-70944506	None:intergenic
AGAAGGTGAACATGGAAGAA+TGG	0.508923	8:+70943749	MsaT045294.1:CDS
TGTTGTTGAGTGAAACTTTG+AGG	0.510713	8:-70944059	None:intergenic
GATAAAGATAGAGTACTTGA+AGG	0.512410	8:-70944242	None:intergenic
AACCATTCAACAACTTTGCT+AGG	0.525009	8:-70943987	None:intergenic
GAAGCTGAAAGTTCAGAAAA+GGG	0.530447	8:+70944161	MsaT045294.1:CDS
AGCTTGGAACTAAACAGTGT+TGG	0.544286	8:-70944572	None:intergenic
TATGATCTTCAAGACAGACT+TGG	0.562288	8:+70943954	MsaT045294.1:CDS
ATCTTGAACCCCTCAAGTAA+TGG	0.568276	8:+70944497	MsaT045294.1:CDS
AGAGTGTCACGTTCTTTAGG+AGG	0.573587	8:+70943846	MsaT045294.1:CDS
CAATTTGGAAGCCATAATCA+TGG	0.577888	8:+70944266	MsaT045294.1:CDS
TCATATAGCTGAATTGCTGT+TGG	0.578184	8:-70943936	None:intergenic
AATGAAAGAACCATTACTTG+AGG	0.584582	8:-70944507	None:intergenic
ACAAAACAAGAAGGTGAACA+TGG	0.590894	8:+70943741	MsaT045294.1:CDS
AAAGAAGCAACAAAACAAGA+AGG	0.599775	8:+70943732	MsaT045294.1:CDS
GTACAGACAACCTAATCCTA+CGG	0.604529	8:-70943914	None:intergenic
TCTTATCAAATAAGTACTAG+TGG	0.608228	8:+70944302	MsaT045294.1:CDS
TGAAAGAACCATTACTTGAG+GGG	0.615132	8:-70944505	None:intergenic
GATGGCAATGGCATAACAGA+AGG	0.624451	8:-70944401	None:intergenic
TGGAACTAAACAGTGTTGGA+TGG	0.631286	8:-70944568	None:intergenic
AAACTTTGAGGAATATCAAG+TGG	0.636206	8:-70944047	None:intergenic
CAATAGCTACATCAAGACAA+TGG	0.639730	8:+70943796	MsaT045294.1:CDS
CTTTGAGGAATATCAAGTGG+TGG	0.640320	8:-70944044	None:intergenic
CAAACCCTATTTCAGCAACC+AGG	0.642234	8:+70944080	MsaT045294.1:CDS
TTAGAGGATTAAGAGACCGT+AGG	0.643012	8:+70943898	MsaT045294.1:CDS
AGGGGTTCAAGATTTGAACA+TGG	0.658690	8:-70944487	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr8	gene	70943702	70944631	70943702	ID=MsaG045294
Chr8	mRNA	70943702	70944631	70943702	ID=MsaT045294.1;Parent=MsaG045294
Chr8	exon	70943702	70944631	70943702	ID=MsaT045294.1.exon1;Parent=MsaT045294.1
Chr8	CDS	70943702	70944631	70943702	ID=cds.MsaT045294.1;Parent=MsaT045294.1

Gene Sequence

>MsaT045294.1

ATGATAGAAAGTTCAAGTAAAGATTATAACAAAGAAGCAACAAAACAAGAAGGTGAACATGGAAGAATGGAATCAGAGAAATTCTCCAACAAAGCAATAGCTACATCAAGACAATGGACATCATTAAGAAATCCAAGAATAGTGAGAGTGTCACGTTCTTTAGGAGGAAAAGACAGACACAGCAAAGTTTGCACAATTAGAGGATTAAGAGACCGTAGGATTAGGTTGTCTGTACCAACAGCAATTCAGCTATATGATCTTCAAGACAGACTTGGTTTAAGTCAACCTAGCAAAGTTGTTGAATGGTTAATTGAAGCAACTCAATCTGATATTGATAAATTACCACCACTTGATATTCCTCAAAGTTTCACTCAACAACAAACCCTATTTCAGCAACCAGGTAGTACTTGTTTTTCTCTTGGAGGTGGTTTTTATGGTATGAATCAAACTAAAGGTAAAGAAGCTGAAAGTTCAGAAAAGGGTAATTATTATAATACTAATTATTCATCAAATGGTTTTCCTTTTCCATATAAATTGGATCCTTCAAGTACTCTATCTTTATCACAATTTGGAAGCCATAATCATGGTAATTTATTTCCTTCTTATCAAATAAGTACTAGTGGCAGTGATATGCAATTTTCATCATCTTCAAATTTGACAGTACCTAATTCATCTGGTAATTCACAGTTACTTTTGTGTCCTTCTGTTATGCCATTGCCATCACTTTTTACTAGTACTCTGAATGCTCCATCAATGGAAAGTAGTGAATTTCCAAGACAATCCAACCATGTTCAAATCTTGAACCCCTCAAGTAATGGTTCTTTCATTCCAACTATTCATCTTCCAATAAATTCGCCGTTTAGACGCCATCCAACACTGTTTAGTTCCAAGCTTCTTGATTCAGATGATAATAACACCAGAAATGGGTAG

Protein sequence

>MsaT045294.1

MIESSSKDYNKEATKQEGEHGRMESEKFSNKAIATSRQWTSLRNPRIVRVSRSLGGKDRHSKVCTIRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVVEWLIEATQSDIDKLPPLDIPQSFTQQQTLFQQPGSTCFSLGGGFYGMNQTKGKEAESSEKGNYYNTNYSSNGFPFPYKLDPSSTLSLSQFGSHNHGNLFPSYQISTSGSDMQFSSSSNLTVPNSSGNSQLLLCPSVMPLPSLFTSTLNAPSMESSEFPRQSNHVQILNPSSNGSFIPTIHLPINSPFRRHPTLFSSKLLDSDDNNTRNG*