AlfalfaGEDB | MsaG045348

M. sativa ssp. caerulea / MsaG045348

KEGG: K21751
GO: GO:0003674 GO:0003700 GO:0005575 GO:0005622 GO:0005623 GO:0005634 GO:0006355 GO:0008150 GO:0009889 GO:0010468 GO:0010556 GO:0019219 GO:0019222 GO:0031323 GO:0031326 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044424 GO:0044464 GO:0050789 GO:0050794 GO:0051171 GO:0051252 GO:0060255 GO:0065007 GO:0080090 GO:0140110 GO:1903506 GO:2000112 GO:2001141
PFAM: PF00808.26

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045348	XP_003609137.1	99.346	153	1	0	1	153	1	153	8.10e-109	316

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045348	sp\|P49592\|NC2B_ARATH	85.235	149	21	1	1	149	1	148	8.42e-92	266

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045348	tr\|G7JT12\|G7JT12_MEDTR	99.346	153	1	0	1	153	1	153	3.87e-109	316

TFs/TRs:

Gene ID	Type	Classification
MsaG045348	TF	NF-YB

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG000290	MsaG045348	0.805444	2.251577e-49	3.448877e-47
MsaG000863	MsaG045348	0.827313	2.991210e-54	8.023597e-52
MsaG002146	MsaG045348	0.807391	8.787616e-50	1.409305e-47
MsaG002435	MsaG045348	0.844800	1.131804e-58	5.152341e-56
MsaG002826	MsaG045348	0.822998	3.095666e-53	7.374929e-51
MsaG002888	MsaG045348	0.806270	1.512037e-49	2.361666e-47
MsaG003335	MsaG045348	0.807083	1.020542e-49	1.624756e-47
MsaG005330	MsaG045348	0.807952	6.685531e-50	1.086747e-47
MsaG005434	MsaG045348	0.825803	6.827492e-54	1.755988e-51
MsaG006759	MsaG045348	0.820468	1.183531e-52	2.635531e-50
MsaG007372	MsaG045348	0.800413	2.438399e-48	3.327815e-46
MsaG008090	MsaG045348	0.819409	2.062337e-52	4.465662e-50
MsaG008200	MsaG045348	0.814983	2.017962e-51	3.899266e-49
MsaG008470	MsaG045348	0.811940	9.347786e-51	1.673974e-48
MsaG008892	MsaG045348	0.857449	3.156788e-62	2.230088e-59
MsaG009484	MsaG045348	0.817332	6.060468e-52	1.243400e-49
MsaG009757	MsaG045348	0.807445	8.558830e-50	1.374395e-47
MsaG009919	MsaG045348	0.815792	1.336323e-51	2.635518e-49
MsaG010331	MsaG045348	0.806641	1.264242e-49	1.991938e-47
MsaG010332	MsaG045348	0.834853	4.292657e-56	1.431597e-53
MsaG010334	MsaG045348	0.836462	1.687813e-56	5.907214e-54
MsaG010565	MsaG045348	0.817390	5.883573e-52	1.208898e-49
MsaG010573	MsaG045348	0.848937	8.454824e-60	4.419259e-57
MsaG011229	MsaG045348	0.816372	9.932085e-52	1.987979e-49
MsaG011413	MsaG045348	0.864084	3.123485e-64	2.845056e-61
MsaG011458	MsaG045348	0.814063	3.217254e-51	6.074383e-49
MsaG011852	MsaG045348	0.808298	5.648590e-50	9.258383e-48
MsaG012473	MsaG045348	0.811377	1.237446e-50	2.185523e-48
MsaG042799	MsaG045348	0.819457	2.010854e-52	4.359706e-50
MsaG043687	MsaG045348	0.800453	2.392999e-48	3.268785e-46
MsaG044568	MsaG045348	0.813129	5.154040e-51	9.505933e-49
MsaG044571	MsaG045348	0.810892	1.574916e-50	2.748663e-48
MsaG044703	MsaG045348	0.907191	1.576326e-80	1.243912e-76
MsaG045121	MsaG045348	0.804813	3.047084e-49	4.599579e-47
MsaG045122	MsaG045348	0.800347	2.514938e-48	3.427075e-46
MsaG045152	MsaG045348	0.815101	1.901089e-51	3.684228e-49
MsaG045294	MsaG045348	0.830281	5.768187e-55	1.682856e-52
MsaG045295	MsaG045348	0.823269	2.678205e-53	6.427371e-51
MsaG045314	MsaG045348	0.841725	7.411565e-58	3.055041e-55
MsaG045348	MsaG046304	0.812893	5.802542e-51	1.063905e-48
MsaG045348	MsaG046347	0.830966	3.929144e-55	1.168986e-52
MsaG045348	MsaG046348	0.836867	1.332217e-56	4.719793e-54
MsaG045348	MsaG002656	0.857171	3.810188e-62	2.663924e-59
MsaG045348	MsaG000781	0.855045	1.586723e-61	1.026704e-58
MsaG045348	MsaG013963	0.823186	2.799724e-53	6.703716e-51
MsaG045348	MsaG013435	0.815130	1.872808e-51	3.632047e-49
MsaG045348	MsaG016310	0.800421	2.429466e-48	3.316216e-46
MsaG045348	MsaG020089	0.841226	1.001698e-57	4.064325e-55
MsaG045348	MsaG019768	0.826608	4.401293e-54	1.157586e-51
MsaG045348	MsaG018616	0.916940	2.442440e-85	3.693949e-81
MsaG045348	MsaG020214	0.817493	5.578426e-52	1.149247e-49
MsaG045348	MsaG020276	0.820083	1.448752e-52	3.193465e-50
MsaG045348	MsaG026757	0.838873	4.088519e-57	1.540839e-54
MsaG045348	MsaG029709	0.827940	2.117977e-54	5.782199e-52
MsaG045348	MsaG027624	0.828301	1.735805e-54	4.786969e-52
MsaG045348	MsaG027799	0.831452	2.987565e-55	9.014831e-53
MsaG045348	MsaG029494	0.803588	5.464762e-49	8.018050e-47
MsaG045348	MsaG031630	0.803906	4.697286e-49	6.942881e-47
MsaG045348	MsaG031442	0.825073	1.014620e-53	2.557427e-51
MsaG045348	MsaG033152	0.842043	6.113621e-58	2.545940e-55
MsaG045348	MsaG045464	0.828957	1.206904e-54	3.390141e-52
MsaG012834	MsaG045348	0.803633	5.349547e-49	7.857065e-47
MsaG013123	MsaG045348	0.805338	2.368368e-49	3.618903e-47
MsaG013438	MsaG045348	0.805779	1.916555e-49	2.958758e-47
MsaG015621	MsaG045348	0.819965	1.541627e-52	3.387532e-50
MsaG015725	MsaG045348	0.857091	4.021013e-62	2.803233e-59
MsaG015733	MsaG045348	0.864113	3.059182e-64	2.789827e-61
MsaG015757	MsaG045348	0.818968	2.595433e-52	5.555384e-50
MsaG015769	MsaG045348	0.843518	2.489078e-58	1.086770e-55
MsaG016112	MsaG045348	0.805000	2.785369e-49	4.222890e-47
MsaG018355	MsaG045348	0.806752	1.197687e-49	1.892047e-47
MsaG019455	MsaG045348	0.827071	3.415783e-54	9.100509e-52
MsaG020193	MsaG045348	0.828586	1.482707e-54	4.121922e-52
MsaG020221	MsaG045348	0.823558	2.294635e-53	5.550054e-51
MsaG021799	MsaG045348	0.878292	6.625443e-69	1.105116e-65
MsaG022074	MsaG045348	0.854081	3.007827e-61	1.880469e-58
MsaG022388	MsaG045348	0.825788	6.881685e-54	1.769203e-51
MsaG022609	MsaG045348	0.801886	1.222388e-48	1.724834e-46
MsaG022748	MsaG045348	0.811037	1.465924e-50	2.567524e-48
MsaG023728	MsaG045348	0.806194	1.568439e-49	2.445316e-47
MsaG023849	MsaG045348	0.803407	5.956529e-49	8.703006e-47
MsaG024762	MsaG045348	0.821372	7.350362e-53	1.676337e-50
MsaG025438	MsaG045348	0.810281	2.131375e-50	3.664821e-48
MsaG025770	MsaG045348	0.806502	1.352021e-49	2.123295e-47
MsaG026470	MsaG045348	0.821004	8.926127e-53	2.016087e-50
MsaG027754	MsaG045348	0.802173	1.068081e-48	1.516904e-46
MsaG028557	MsaG045348	0.846360	4.292067e-59	2.057311e-56
MsaG028740	MsaG045348	0.821559	6.656594e-53	1.525704e-50
MsaG028807	MsaG045348	0.823252	2.703719e-53	6.485364e-51
MsaG028970	MsaG045348	0.803302	6.260487e-49	9.124985e-47
MsaG030657	MsaG045348	0.836188	1.979395e-56	6.870858e-54
MsaG030833	MsaG045348	0.835089	3.745416e-56	1.257922e-53
MsaG031347	MsaG045348	0.833216	1.098387e-55	3.489645e-53
MsaG031414	MsaG045348	0.819120	2.397633e-52	5.152613e-50
MsaG032531	MsaG045348	0.877358	1.399404e-68	2.236620e-65
MsaG033732	MsaG045348	0.812131	8.499439e-51	1.529096e-48
MsaG033736	MsaG045348	0.807991	6.562140e-50	1.067684e-47
MsaG033878	MsaG045348	0.869949	4.289585e-66	4.960692e-63
MsaG034180	MsaG045348	0.816136	1.120727e-51	2.229799e-49
MsaG034188	MsaG045348	0.810123	2.304172e-50	3.946685e-48
MsaG034661	MsaG045348	0.824052	1.759772e-53	4.313788e-51
MsaG034933	MsaG045348	0.893503	1.320725e-74	4.690043e-71
MsaG035391	MsaG045348	0.816865	7.707273e-52	1.562320e-49
MsaG036271	MsaG045348	0.853988	3.198952e-61	1.993394e-58
MsaG036272	MsaG045348	0.872838	4.801716e-67	6.281462e-64
MsaG036689	MsaG045348	0.809073	3.864140e-50	6.452972e-48
MsaG037276	MsaG045348	0.841850	6.872495e-58	2.844381e-55
MsaG037332	MsaG045348	0.878710	4.731347e-69	8.045554e-66
MsaG037333	MsaG045348	0.857863	2.381739e-62	1.708769e-59
MsaG037736	MsaG045348	0.813250	4.850029e-51	8.972193e-49
MsaG038166	MsaG045348	0.825190	9.519289e-54	2.407142e-51
MsaG038298	MsaG045348	0.842047	6.099345e-58	2.540320e-55
MsaG038776	MsaG045348	0.800740	2.093048e-48	2.877664e-46
MsaG039182	MsaG045348	0.826442	4.820255e-54	1.262019e-51
MsaG040039	MsaG045348	0.850651	2.821005e-60	1.563642e-57
MsaG040048	MsaG045348	0.807321	9.090695e-50	1.455470e-47
MsaG040266	MsaG045348	0.841693	7.556984e-58	3.111878e-55
MsaG040742	MsaG045348	0.852242	1.005743e-60	5.892217e-58
MsaG040955	MsaG045348	0.801537	1.440803e-48	2.016858e-46
MsaG041114	MsaG045348	0.811925	9.417758e-51	1.685901e-48
MsaG041557	MsaG045348	0.853749	3.743984e-61	2.313140e-58
MsaG041550	MsaG045348	0.850897	2.406153e-60	1.345123e-57
MsaG041563	MsaG045348	0.824704	1.238388e-53	3.090011e-51
MsaG041623	MsaG045348	0.814970	2.031627e-51	3.924416e-49
MsaG041624	MsaG045348	0.840743	1.339273e-57	5.351450e-55
MsaG041862	MsaG045348	0.806341	1.461075e-49	2.285851e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045348	MtrunA17_Chr4g0062271	99.346	153	1	0	1	153	1	153	7.45e-113	316
MsaG045348	MtrunA17_Chr2g0307551	86.275	153	21	0	1	153	1	153	5.32e-99	281
MsaG045348	MtrunA17_Chr1g0185911	41.176	85	48	1	12	94	30	114	1.54e-17	75.1
MsaG045348	MtrunA17_Chr7g0263601	37.500	80	50	0	12	91	27	106	5.73e-16	70.9
MsaG045348	MtrunA17_Chr3g0102351	36.250	80	51	0	12	91	28	107	6.02e-16	71.2
MsaG045348	MtrunA17_Chr4g0076381	37.037	81	51	0	11	91	58	138	1.08e-15	71.6
MsaG045348	MtrunA17_Chr5g0446491	36.250	80	51	0	12	91	24	103	1.09e-15	70.5
MsaG045348	MtrunA17_Chr1g0165041	28.723	94	67	0	6	99	1	94	4.87e-15	68.9
MsaG045348	MtrunA17_Chr2g0296321	30.909	110	70	1	8	111	63	172	1.22e-14	68.9
MsaG045348	MtrunA17_Chr2g0290491	32.530	83	56	0	7	89	13	95	2.40e-14	66.6
MsaG045348	MtrunA17_Chr1g0191981	31.646	79	54	0	13	91	6	84	3.52e-14	65.1
MsaG045348	MtrunA17_Chr4g0067091	34.615	78	51	0	12	89	23	100	3.97e-14	67.0
MsaG045348	MtrunA17_Chr8g0384451	29.545	88	62	0	12	99	41	128	5.81e-14	66.2
MsaG045348	MtrunA17_Chr8g0382931	32.143	84	57	0	5	88	22	105	1.05e-13	65.5
MsaG045348	MtrunA17_Chr1g0195851	32.051	78	53	0	12	89	37	114	2.14e-13	64.7
MsaG045348	MtrunA17_Chr4g0076321	35.135	74	48	0	16	89	24	97	4.53e-13	62.4

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG045348	AT5G23090.5	85.235	149	21	1	1	149	1	148	8.56e-93	266
MsaG045348	AT5G23090.2	85.235	149	21	1	1	149	1	148	8.56e-93	266
MsaG045348	AT5G23090.1	85.235	149	21	1	1	149	1	148	8.56e-93	266
MsaG045348	AT5G23090.4	82.468	154	24	2	1	152	1	153	2.86e-90	259
MsaG045348	AT5G08190.1	88.652	141	16	0	1	141	1	141	3.21e-84	244
MsaG045348	AT5G08190.2	87.943	141	16	1	1	141	1	140	1.45e-81	238
MsaG045348	AT5G23090.3	77.181	149	20	2	1	149	1	135	5.14e-80	233
MsaG045348	AT2G38880.7	31.068	103	71	0	12	114	22	124	4.48e-17	73.2
MsaG045348	AT2G38880.3	31.429	105	71	1	12	116	22	125	1.67e-16	72.0
MsaG045348	AT2G38880.11	34.409	93	59	1	12	102	22	114	1.98e-16	72.4
MsaG045348	AT2G38880.8	34.409	93	59	1	12	102	22	114	1.98e-16	72.4
MsaG045348	AT2G38880.2	32.381	105	69	1	12	114	22	126	2.01e-16	71.6
MsaG045348	AT2G38880.1	32.381	105	69	1	12	114	22	126	2.01e-16	71.6
MsaG045348	AT2G38880.5	32.381	105	69	1	12	114	22	126	2.01e-16	71.6
MsaG045348	AT4G14540.1	31.000	100	69	0	12	111	22	121	2.50e-16	72.0
MsaG045348	AT3G53340.5	35.000	100	64	1	12	111	30	128	5.67e-16	71.2
MsaG045348	AT3G53340.1	35.000	100	64	1	12	111	30	128	5.67e-16	71.2
MsaG045348	AT2G37060.2	36.250	80	51	0	12	91	31	110	6.66e-16	71.2
MsaG045348	AT2G37060.3	36.250	80	51	0	12	91	31	110	6.66e-16	71.2
MsaG045348	AT2G37060.1	36.250	80	51	0	12	91	31	110	6.66e-16	71.2
MsaG045348	AT2G38880.4	35.294	85	53	1	12	94	22	106	8.17e-16	69.3
MsaG045348	AT5G47640.1	30.631	111	76	1	12	122	28	137	9.53e-16	71.2
MsaG045348	AT5G47670.2	37.037	81	51	0	11	91	29	109	1.70e-15	70.9
MsaG045348	AT5G47670.1	37.037	81	51	0	11	91	58	138	2.43e-15	70.9
MsaG045348	AT5G47670.3	37.037	81	51	0	11	91	58	138	2.43e-15	70.9
MsaG045348	AT3G53340.4	36.250	80	51	0	12	91	30	109	7.90e-15	67.0
MsaG045348	AT2G38880.9	31.250	96	66	0	12	107	22	117	1.76e-14	67.0
MsaG045348	AT2G38880.10	31.250	96	66	0	12	107	22	117	1.76e-14	67.0
MsaG045348	AT2G38880.6	31.250	96	66	0	12	107	22	117	1.76e-14	67.0
MsaG045348	AT3G53340.3	32.955	88	59	0	12	99	30	117	2.45e-14	66.6
MsaG045348	AT3G53340.2	32.955	88	59	0	12	99	30	117	2.45e-14	66.6
MsaG045348	AT1G21970.1	32.099	81	55	0	11	91	59	139	4.84e-14	67.4
MsaG045348	AT1G09030.1	31.250	80	55	0	12	91	4	83	1.56e-13	63.9
MsaG045348	AT2G13570.1	32.468	77	52	0	12	88	37	113	6.61e-13	63.9
MsaG045348	AT2G47810.1	30.263	76	53	0	12	87	52	127	1.06e-11	59.7

Find 37 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
CTTCCTAGCTAATCTAATTT+TGG	0.141370	8:-71598672	None:intergenic
ATACTTTAAAAGCTGGTAAA+TGG	0.274950	8:+71598533	MsaT045348.1:CDS
TTTCCCCAGGTGCTTGGATT+TGG	0.324476	8:+71597691	MsaT045348.1:intron
CAGCAAGATACTTTAAAAGC+TGG	0.415421	8:+71598526	MsaT045348.1:intron
TGCGCCTGAGCACGTATTGA+AGG	0.421286	8:+71596919	MsaT045348.1:CDS
AGCACTCGATCAATAGATCT+TGG	0.421579	8:-71596145	None:intergenic
CTCTCTGCTACATACTTCAT+TGG	0.429101	8:-71596882	None:intergenic
TATGTAGCAGAGAGGACAAA+AGG	0.468267	8:+71596891	MsaT045348.1:CDS
GCACGTATTGAAGGCTCTAC+AGG	0.479345	8:+71596928	MsaT045348.1:CDS
CGATTTGCCAACGATATCCA+TGG	0.490386	8:-71595297	None:intergenic
GAGGCCCGCGCTAGGATGAA+TGG	0.491671	8:+71598616	MsaT045348.1:CDS
CCCGCGCTAGGATGAATGGT+GGG	0.499784	8:+71598620	MsaT045348.1:CDS
CTCGCCACGCGGACATCTTG+CGG	0.511342	8:-71596116	None:intergenic
GCACTCGATCAATAGATCTT+GGG	0.526789	8:-71596144	None:intergenic
AGGTTAAATTATGGATCCCA+TGG	0.527047	8:+71595280	None:intergenic
CCCACCATTCATCCTAGCGC+GGG	0.529331	8:-71598620	None:intergenic
AGAGCCTTCAATACGTGCTC+AGG	0.530619	8:-71596923	None:intergenic
TGTTTGCAGAGGCCCGCGCT+AGG	0.547845	8:+71598608	MsaT045348.1:CDS
CTATTGATCGAGTGCTGTGT+AGG	0.564923	8:+71596152	MsaT045348.1:CDS
CCCCACCATTCATCCTAGCG+CGG	0.565574	8:-71598621	None:intergenic
AAAGCTGGTAAATGGAGCAA+TGG	0.581041	8:+71598541	MsaT045348.1:CDS
AGCATACGAACAACACAAGC+TGG	0.587192	8:+71597738	MsaT045348.1:CDS
GTTTATAAATCTCATCTCAT+CGG	0.592523	8:+71596856	MsaT045348.1:CDS
ATGGATCCCATGGATATCGT+TGG	0.592534	8:+71595290	MsaT045348.1:CDS
GGATATCGTTGGCAAATCGA+AGG	0.607995	8:+71595301	MsaT045348.1:CDS
GATTTGCCAACGATATCCAT+GGG	0.608748	8:-71595296	None:intergenic
AAGCATTAGCAGAACAACAA+AGG	0.632993	8:+71598584	MsaT045348.1:CDS
GCCCGCGCTAGGATGAATGG+TGG	0.635837	8:+71598619	MsaT045348.1:CDS
ACAACACAAGCTGGAGACCA+TGG	0.639569	8:+71597747	MsaT045348.1:CDS
GAAGATGCTTCGCTTCCCAA+AGG	0.654221	8:+71595323	MsaT045348.1:CDS
ATTGCTTCAAAACAGCCAGA+TGG	0.664023	8:+71598646	MsaT045348.1:CDS
CCGCGCTAGGATGAATGGTG+GGG	0.672298	8:+71598621	MsaT045348.1:CDS
ACAACAAAGGATGTTTGCAG+AGG	0.686768	8:+71598597	MsaT045348.1:CDS
CTTGGGTGTCTCTCGCCACG+CGG	0.690389	8:-71596127	None:intergenic
CAATGAAGTATGTAGCAGAG+AGG	0.698906	8:+71596883	MsaT045348.1:CDS
CAATGGAGCTGAGATGACTG+AGG	0.705174	8:+71598558	MsaT045348.1:CDS
GTTACCGCAAGATGTCCGCG+TGG	0.763213	8:+71596112	MsaT045348.1:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content

Chromosome	Type	Strat	End	Strand	Name
Chr8	gene	71595290	71598681	71595290	ID=MsaG045348
Chr8	mRNA	71595290	71598681	71595290	ID=MsaT045348.1;Parent=MsaG045348
Chr8	exon	71595290	71595344	71595290	ID=MsaT045348.1.exon1;Parent=MsaT045348.1
Chr8	CDS	71595290	71595344	71595290	ID=cds.MsaT045348.1;Parent=MsaT045348.1
Chr8	exon	71596084	71596173	71596084	ID=MsaT045348.1.exon2;Parent=MsaT045348.1
Chr8	CDS	71596084	71596173	71596084	ID=cds.MsaT045348.1;Parent=MsaT045348.1
Chr8	exon	71596855	71596949	71596855	ID=MsaT045348.1.exon3;Parent=MsaT045348.1
Chr8	CDS	71596855	71596949	71596855	ID=cds.MsaT045348.1;Parent=MsaT045348.1
Chr8	exon	71597700	71597768	71597700	ID=MsaT045348.1.exon4;Parent=MsaT045348.1
Chr8	CDS	71597700	71597768	71597700	ID=cds.MsaT045348.1;Parent=MsaT045348.1
Chr8	exon	71598529	71598681	71598529	ID=MsaT045348.1.exon5;Parent=MsaT045348.1
Chr8	CDS	71598529	71598681	71598529	ID=cds.MsaT045348.1;Parent=MsaT045348.1

Gene Sequence

>MsaT045348.1

ATGGATCCCATGGATATCGTTGGCAAATCGAAGGAAGATGCTTCGCTTCCCAAAGCAACAATGACAAAAATAATTAAGGAGATGTTACCGCAAGATGTCCGCGTGGCGAGAGACACCCAAGATCTATTGATCGAGTGCTGTGTAGAGTTTATAAATCTCATCTCATCGGAGTCCAATGAAGTATGTAGCAGAGAGGACAAAAGGACTATTGCGCCTGAGCACGTATTGAAGGCTCTACAGGTGCTTGGATTTGGCGAGTACATTGAAGAAGTTTATGCAGCATACGAACAACACAAGCTGGAGACCATGCAAGATACTTTAAAAGCTGGTAAATGGAGCAATGGAGCTGAGATGACTGAGGAACAAGCATTAGCAGAACAACAAAGGATGTTTGCAGAGGCCCGCGCTAGGATGAATGGTGGGGCCATTGCTTCAAAACAGCCAGATGGTGACCAAAATTAG

Protein sequence

>MsaT045348.1

MDPMDIVGKSKEDASLPKATMTKIIKEMLPQDVRVARDTQDLLIECCVEFINLISSESNEVCSREDKRTIAPEHVLKALQVLGFGEYIEEVYAAYEQHKLETMQDTLKAGKWSNGAEMTEEQALAEQQRMFAEARARMNGGAIASKQPDGDQN*