AlfalfaGEDB | MsaG046900

M. sativa ssp. caerulea / MsaG046900

KEGG: K09260
GO: -
PFAM: PF00319.21

Nr:

Show entries

Search:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG046900	GAU35997.1	60.938	64	25	0	1	64	1	64	2.95e-15	76.6

Showing 1 to 1 of 1 entries

Swissprot:

Show entries

Search:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
No data available in table

Showing 0 to 0 of 0 entries

Trembl:

Show entries

Search:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG046900	tr\|A0A2Z6P0N6\|A0A2Z6P0N6_TRISU	60.938	64	25	0	1	64	1	64	1.41e-15	76.6

Showing 1 to 1 of 1 entries

TFs/TRs:

Show entries

Search:

Gene ID	Type	Classification
MsaG046900	TF	MADS-M-type

Showing 1 to 1 of 1 entries

Protein Kinases:

Show entries

Search:

Gene ID	Type	Classification
No data available in table

Showing 0 to 0 of 0 entries

Network:

Co-expression Network

Show entries

Search:

Gene1	Gene2	correlation coefficient	p_value	FDR
MsaG009439	MsaG046900	0.820449	1.195860e-52	2.661662e-50
MsaG018524	MsaG046900	0.808100	6.222089e-50	1.014996e-47
MsaG020508	MsaG046900	0.816621	8.741094e-52	1.760731e-49
MsaG023630	MsaG046900	0.803799	4.943784e-49	7.289175e-47
MsaG031563	MsaG046900	0.974828	3.394942e-138	5.385780e-132
MsaG035254	MsaG046900	0.801911	1.207978e-48	1.705456e-46

Showing 1 to 6 of 6 entries

PPI

Show entries

Search:

Showing 0 to 0 of 0 entries

Show entries

Search:

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG046900	MtrunA17_Chr8g0351751	65.574	61	21	0	1	61	1	61	1.88e-18	75.5
MsaG046900	MtrunA17_Chr3g0107331	52.459	61	29	0	4	64	3	63	7.36e-16	67.0
MsaG046900	MtrunA17_Chr3g0107381	55.738	61	27	0	1	61	1	61	1.23e-15	67.4
MsaG046900	MtrunA17_Chr4g0013041	63.934	61	20	1	1	61	1	59	1.63e-15	67.0
MsaG046900	MtrunA17_Chr3g0107351	51.667	60	29	0	5	64	4	63	2.03e-14	63.2
MsaG046900	MtrunA17_Chr4g0014321	58.333	60	25	0	1	60	1	60	3.57e-14	63.9
MsaG046900	MtrunA17_Chr3g0107341	53.333	60	28	0	5	64	4	63	4.38e-14	62.4
MsaG046900	MtrunA17_Chr3g0107361	50.000	60	30	0	5	64	4	63	2.07e-13	60.5
MsaG046900	MtrunA17_Chr2g0296831	62.500	64	24	0	1	64	1	64	3.56e-13	59.3
MsaG046900	MtrunA17_Chr2g0283941	51.613	62	29	1	1	62	1	61	6.58e-12	57.8

Showing 1 to 10 of 12 entries

Previous1 2Next

Show entries

Search:

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsaG046900	AT5G27960.1	48.276	58	30	0	3	60	1	58	2.80e-11	57.0

Showing 1 to 1 of 1 entries

Find 0 sgRNAs with CRISPR-Local

Find sgRNAs with CRISPR-GE

CRISPR-Local

Show entries

Search:

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
No data available in table

Showing 0 to 0 of 0 entries

CRISPR-GE

Show entries

Search:

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
No data available in table

Showing 0 to 0 of 0 entries

Chromosome	Type	Strat	End	Strand	Name
Contig3	gene	460180	460374	460180	ID=MsaG046900
Contig3	mRNA	460180	460374	460180	ID=MsaT046900.1;Parent=MsaG046900
Contig3	exon	460180	460374	460180	ID=MsaT046900.1.exon1;Parent=MsaT046900.1
Contig3	CDS	460180	460374	460180	ID=cds.MsaT046900.1;Parent=MsaT046900.1

Gene Sequence	>MsaT046900.1 ATGAATATAAAAAAGGTAAAACTTGACTTTAATGCAAATGATGTTGCAAGAAAAGCAACATACAAGAAAAGGAAGAATGATTTATTCGATAAGGCTGATGAGCCAAGCACCCTTTATAGAAATGAAGCTTGTGCTATAGTTTATGACCGTTATGAACCACAACCTGAGATTTGTCCATCACCAGGGGAAGTCTAG
Protein sequence	>MsaT046900.1 MNIKKVKLDFNANDVARKATYKKRKNDLFDKADEPSTLYRNEACAIVYDRYEPQPEICPSPGEV*

Copyright © Liu Lab , TPR, XTBG, China.

Any comments and suggestions, pleaseE-mail us