AlfalfaGEDB | Msa0913580

M. sativa cultivar zhongmu-4 / Msa0913580

KEGG: K06268
GO: GO:0000325 GO:0003674 GO:0005488 GO:0005509 GO:0005513 GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0005773 GO:0005774 GO:0005886 GO:0008150 GO:0009593 GO:0009705 GO:0010035 GO:0010038 GO:0016020 GO:0031090 GO:0042221 GO:0042592 GO:0043167 GO:0043169 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044422 GO:0044424 GO:0044437 GO:0044444 GO:0044446 GO:0044464 GO:0046872 GO:0048878 GO:0050801 GO:0050896 GO:0051592 GO:0051606 GO:0055065 GO:0055067 GO:0055075 GO:0055080 GO:0065007 GO:0065008 GO:0071944 GO:0098588 GO:0098771 GO:0098805
PFAM: -

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0913580	XP_024639813.1	100.000	69	0	0	1	69	1	69	1.08e-40	142

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0913580	sp\|Q75LU8\|CNBL3_ORYSJ	82.609	69	11	1	1	69	1	68	8.68e-32	112

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0027390	Msa0913580	0.817990	2.475268e-52	-8.615850e-47
Msa0039250	Msa0913580	0.805238	1.470111e-49	-8.615850e-47
Msa0074750	Msa0913580	0.805186	1.507442e-49	-8.615850e-47
Msa0092440	Msa0913580	0.803414	3.526062e-49	-8.615850e-47
Msa0108870	Msa0913580	0.805805	1.118030e-49	-8.615850e-47
Msa0640500	Msa0913580	0.816201	6.246349e-52	-8.615850e-47
Msa0664760	Msa0913580	0.800754	1.242580e-48	-8.615850e-47
Msa0679100	Msa0913580	0.820730	5.876450e-53	-8.615850e-47
Msa0687450	Msa0913580	0.800073	1.709912e-48	-8.615850e-47
Msa0716860	Msa0913580	0.805754	1.145903e-49	-8.615850e-47
Msa0742510	Msa0913580	0.805395	1.362844e-49	-8.615850e-47
Msa0743530	Msa0913580	0.805012	1.639173e-49	-8.615850e-47
Msa0744090	Msa0913580	0.805786	1.128448e-49	-8.615850e-47
Msa0756530	Msa0913580	0.803803	2.928119e-49	-8.615850e-47
Msa0756930	Msa0913580	0.802121	6.518323e-49	-8.615850e-47
Msa0757800	Msa0913580	0.811507	6.764222e-51	-8.615850e-47
Msa0779550	Msa0913580	0.804576	2.022024e-49	-8.615850e-47
Msa0780280	Msa0913580	0.804873	1.753027e-49	-8.615850e-47
Msa0821800	Msa0913580	0.813666	2.280266e-51	-8.615850e-47
Msa0825280	Msa0913580	0.810418	1.164277e-50	-8.615850e-47
Msa0133820	Msa0913580	0.804293	2.315777e-49	-8.615850e-47
Msa0143850	Msa0913580	0.801096	1.057881e-48	-8.615850e-47
Msa0165300	Msa0913580	0.812319	4.501711e-51	-8.615850e-47
Msa0392200	Msa0913580	0.815599	8.510572e-52	-8.615850e-47
Msa0410300	Msa0913580	0.807062	6.072542e-50	-8.615850e-47
Msa0431770	Msa0913580	0.804532	2.065007e-49	-8.615850e-47
Msa0461590	Msa0913580	0.813941	1.983894e-51	-8.615850e-47
Msa0259270	Msa0913580	0.802987	4.322637e-49	-8.615850e-47
Msa0269520	Msa0913580	0.803158	3.984808e-49	-8.615850e-47
Msa0333160	Msa0913580	0.801676	8.048224e-49	-8.615850e-47
Msa0343190	Msa0913580	0.800955	1.130372e-48	-8.615850e-47
Msa0346990	Msa0913580	0.817264	3.607892e-52	-8.615850e-47
Msa0487780	Msa0913580	0.826157	3.165306e-54	-8.615850e-47
Msa0510290	Msa0913580	0.820563	6.421221e-53	-8.615850e-47
Msa0578090	Msa0913580	0.817587	3.052157e-52	-8.615850e-47
Msa0584550	Msa0913580	0.821246	4.470266e-53	-8.615850e-47
Msa0851470	Msa0913580	0.805622	1.221550e-49	-8.615850e-47
Msa0861830	Msa0913580	0.810013	1.423784e-50	-8.615850e-47
Msa0913580	Msa0975940	0.802280	6.046218e-49	-8.615850e-47
Msa0913580	Msa0996020	0.814674	1.365762e-51	-8.615850e-47
Msa0913580	Msa1098890	0.812377	4.372426e-51	-8.615850e-47
Msa0913580	Msa1113590	0.821936	3.097879e-53	-8.615850e-47
Msa0913580	Msa1211340	0.811354	7.301090e-51	-8.615850e-47
Msa0913580	Msa1259640	0.808483	3.029001e-50	-8.615850e-47
Msa0913580	Msa1296300	0.807965	3.906875e-50	-8.615850e-47
Msa0913580	Msa1299330	0.807726	4.390425e-50	-8.615850e-47
Msa0913580	Msa1329450	0.805716	1.167019e-49	-8.615850e-47
Msa0913580	Msa1329790	0.809442	1.888497e-50	-8.615850e-47
Msa0913580	Msa1338250	0.815103	1.097464e-51	-8.615850e-47
Msa0913580	Msa1393800	0.811014	8.654243e-51	-8.615850e-47
Msa0913580	Msa1420250	0.800822	1.203271e-48	-8.615850e-47
Msa0913580	Msa1422840	0.808505	2.997143e-50	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0913580	MtrunA17_Chr5g0446931	100.000	69	0	0	1	69	1	69	9.96e-45	142
Msa0913580	MtrunA17_Chr3g0102821	81.159	69	13	0	1	69	1	69	8.74e-35	117
Msa0913580	MtrunA17_Chr4g0076551	74.286	70	17	1	1	69	1	70	2.72e-30	106
Msa0913580	MtrunA17_Chr2g0290751	54.167	72	30	1	1	69	1	72	6.59e-20	79.0
Msa0913580	MtrunA17_Chr2g0290761	54.167	72	30	1	1	69	1	72	9.76e-19	75.9
Msa0913580	MtrunA17_Chr2g0290781	45.946	74	35	1	1	69	1	74	8.51e-15	65.9
Msa0913580	MtrunA17_Chr4g0055421	57.407	54	23	0	16	69	1	54	9.71e-15	65.5
Msa0913580	MtrunA17_Chr3g0126811	58.824	51	21	0	19	69	5	55	2.71e-14	62.4
Msa0913580	MtrunA17_Chr8g0388321	66.667	39	13	0	31	69	58	96	4.84e-12	57.8
Msa0913580	MtrunA17_Chr5g0399921	69.231	39	12	0	31	69	15	53	7.86e-12	56.2
Msa0913580	MtrunA17_Chr1g0151621	75.676	37	9	0	36	72	60	96	2.67e-11	56.6

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0913580	AT5G55990.1	78.261	69	15	0	1	69	1	69	2.24e-32	111
Msa0913580	AT5G55990.2	78.261	69	15	0	1	69	1	69	2.24e-32	111
Msa0913580	AT4G26570.2	76.812	69	16	0	1	69	1	69	2.26e-32	112
Msa0913580	AT4G26570.1	76.812	69	16	0	1	69	1	69	2.34e-32	111
Msa0913580	AT4G16350.2	53.623	69	25	2	1	69	2	63	3.42e-15	67.4
Msa0913580	AT4G16350.1	53.623	69	25	2	1	69	2	63	3.42e-15	67.4
Msa0913580	AT4G17615.4	71.111	45	13	0	25	69	10	54	1.14e-14	65.9
Msa0913580	AT4G17615.1	71.111	45	13	0	25	69	10	54	1.14e-14	65.9
Msa0913580	AT4G17615.5	71.111	45	13	0	25	69	10	54	1.14e-14	65.9
Msa0913580	AT4G17615.3	71.111	45	13	0	25	69	10	54	1.56e-14	65.9
Msa0913580	AT1G64480.4	50.909	55	27	0	15	69	4	58	2.54e-14	64.7
Msa0913580	AT1G64480.2	50.909	55	27	0	15	69	4	58	3.92e-14	64.3
Msa0913580	AT1G64480.3	50.909	55	27	0	15	69	4	58	3.92e-14	64.3
Msa0913580	AT1G64480.1	50.909	55	27	0	15	69	4	58	3.92e-14	64.3
Msa0913580	AT5G47100.2	76.923	39	9	0	31	69	16	54	7.85e-14	62.8
Msa0913580	AT5G24270.4	65.909	44	15	0	26	69	15	58	1.32e-13	63.2
Msa0913580	AT5G24270.1	65.909	44	15	0	26	69	15	58	1.32e-13	63.2
Msa0913580	AT5G24270.2	65.909	44	15	0	26	69	15	58	1.32e-13	63.2
Msa0913580	AT5G47100.1	76.923	39	9	0	31	69	16	54	1.79e-13	62.4
Msa0913580	AT4G33000.3	71.053	38	11	0	32	69	53	90	2.22e-11	55.8
Msa0913580	AT4G33000.4	71.053	38	11	0	32	69	53	90	3.57e-11	56.2
Msa0913580	AT4G33000.6	71.053	38	11	0	32	69	53	90	3.57e-11	56.2
Msa0913580	AT4G33000.5	71.053	38	11	0	32	69	53	90	3.74e-11	56.2
Msa0913580	AT4G33000.2	71.053	38	11	0	32	69	53	90	7.13e-11	55.8
Msa0913580	AT4G33000.1	71.053	38	11	0	32	69	63	100	7.90e-11	55.8

Find 10 sgRNAs with CRISPR-Local

Find 19 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
GTCTCCCTCGCAAGAATTTC+AGG	0.186318	6_2:-24509405	None:intergenic
GACTTGTATAAGCAGACAAC+AGG	0.448268	6_2:+24509372	Msa0913580:CDS
ATGTCACAACATTGCAATAG+AGG	0.481052	6_2:-24509348	None:intergenic
AGCAGTGCGGTGATTGATGA+TGG	0.501327	6_2:+24509735	Msa0913580:CDS
ATCATGTTGCAGTGCATAGA+GGG	0.537202	6_2:+24509306	Msa0913580:exon
TATCATGTTGCAGTGCATAG+AGG	0.591820	6_2:+24509305	Msa0913580:exon
AGATCCTGAAATTCTTGCGA+GGG	0.602213	6_2:+24509401	Msa0913580:CDS
AAGATCCTGAAATTCTTGCG+AGG	0.611135	6_2:+24509400	Msa0913580:CDS
GCAGTGCGGTGATTGATGAT+GGG	0.644066	6_2:+24509736	Msa0913580:CDS
TGATGATGGGCTGATCAACA+AGG	0.685091	6_2:+24509749	Msa0913580:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	TGCATTATATTCATAAAGTT+AGG	-	chr6_2:24509447-24509466	None:intergenic	20.0%
!!	TGAAATAAATACACATAGAT+AGG	+	chr6_2:24509629-24509648	Msa0913580:intron	20.0%
!!	GAAATAAATACACATAGATA+GGG	+	chr6_2:24509630-24509649	Msa0913580:intron	20.0%
!!!	GCTCTTTTTTTTTTTAGTTG+TGG	+	chr6_2:24509580-24509599	Msa0913580:intron	25.0%
!	ATTTCAAATAGTAGTATGAG+AGG	-	chr6_2:24509615-24509634	None:intergenic	25.0%
!!!	TATGGAGGATTTTGATTTTG+AGG	+	chr6_2:24509273-24509292	Msa0913580:five_prime_UTR	30.0%
	CACATGCTTTCAAAATCAAA+AGG	-	chr6_2:24509549-24509568	None:intergenic	30.0%
!!!	CTTTTGATTTTGAAAGCATG+TGG	+	chr6_2:24509547-24509566	Msa0913580:intron	30.0%
	ATGTCACAACATTGCAATAG+AGG	-	chr6_2:24509351-24509370	None:intergenic	35.0%
!	CTTTAAAAAGATCAGCAGTG+CGG	+	chr6_2:24509722-24509741	Msa0913580:CDS	35.0%
	TATCATGTTGCAGTGCATAG+AGG	+	chr6_2:24509305-24509324	Msa0913580:exon	40.0%
	ATCATGTTGCAGTGCATAGA+GGG	+	chr6_2:24509306-24509325	Msa0913580:exon	40.0%
	GACTTGTATAAGCAGACAAC+AGG	+	chr6_2:24509372-24509391	Msa0913580:CDS	40.0%
	AAGATCCTGAAATTCTTGCG+AGG	+	chr6_2:24509400-24509419	Msa0913580:CDS	40.0%
	AGATCCTGAAATTCTTGCGA+GGG	+	chr6_2:24509401-24509420	Msa0913580:CDS	40.0%
!!	TGATGATGGGCTGATCAACA+AGG	+	chr6_2:24509749-24509768	Msa0913580:CDS	45.0%
	GTCTCCCTCGCAAGAATTTC+AGG	-	chr6_2:24509408-24509427	None:intergenic	50.0%
	AGCAGTGCGGTGATTGATGA+TGG	+	chr6_2:24509735-24509754	Msa0913580:CDS	50.0%
!	GCAGTGCGGTGATTGATGAT+GGG	+	chr6_2:24509736-24509755	Msa0913580:CDS	50.0%

Chromosome	Type	Strat	End	Strand	Name
chr6_2	gene	24509267	24509791	24509267	ID=Msa0913580;Name=Msa0913580
chr6_2	mRNA	24509267	24509791	24509267	ID=Msa0913580-mRNA-1;Parent=Msa0913580;Name=Msa0913580-mRNA-1;_AED=0.09;_eAED=0.09;_QI=42\|0\|0\|1\|1\|1\|2\|0\|75
chr6_2	exon	24509267	24509432	24509267	ID=Msa0913580-mRNA-1:exon:4843;Parent=Msa0913580-mRNA-1
chr6_2	exon	24509688	24509791	24509688	ID=Msa0913580-mRNA-1:exon:4844;Parent=Msa0913580-mRNA-1
chr6_2	five_prime_UTR	24509267	24509308	24509267	ID=Msa0913580-mRNA-1:five_prime_utr;Parent=Msa0913580-mRNA-1
chr6_2	CDS	24509309	24509432	24509309	ID=Msa0913580-mRNA-1:cds;Parent=Msa0913580-mRNA-1
chr6_2	CDS	24509688	24509791	24509688	ID=Msa0913580-mRNA-1:cds;Parent=Msa0913580-mRNA-1

Gene Sequence	>Msa0913580 ATGTTGCAGTGCATAGAGGGAATTAAGCATTTGTTTGCTCCTCTATTGCAATGTTGTGACATTGACTTGTATAAGCAGACAACAGGACTCGAAGATCCTGAAATTCTTGCGAGGGAGACAGTGTTTAGTGTAAGTGAAATTGAAGCTCTTTATGAGCTCTTTAAAAAGATCAGCAGTGCGGTGATTGATGATGGGCTGATCAACAAGGTTTGTCTGCTTCGTCACTGA
Protein sequence	>Msa0913580 MLQCIEGIKHLFAPLLQCCDIDLYKQTTGLEDPEILARETVFSVSEIEALYELFKKISSAVIDDGLINKVCLLRH*