AlfalfaGEDB | Msa1054810

M. sativa cultivar zhongmu-4 / Msa1054810

KEGG: K18213
GO: GO:0000966 GO:0001682 GO:0003674 GO:0003824 GO:0004518 GO:0004519 GO:0004521 GO:0004526 GO:0004540 GO:0004549 GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0005739 GO:0006139 GO:0006396 GO:0006399 GO:0006725 GO:0006807 GO:0008033 GO:0008150 GO:0008152 GO:0009507 GO:0009536 GO:0009987 GO:0010467 GO:0016070 GO:0016787 GO:0016788 GO:0016891 GO:0016893 GO:0034470 GO:0034471 GO:0034641 GO:0034660 GO:0043170 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044237 GO:0044238 GO:0044424 GO:0044444 GO:0044464 GO:0046483 GO:0071704 GO:0090304 GO:0090305 GO:0090501 GO:0090502 GO:0099116 GO:0140098 GO:0140101 GO:1901360
PFAM: PF16953.8

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1054810	GAU10961.1	87.273	55	7	0	1	55	336	390	1.38e-23	102

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1054810	sp\|Q66GI4\|PRRP1_ARATH	61.538	52	20	0	3	54	354	405	3.83e-17	76.3

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1054810	A0A2Z6LTV0	87.273	55	7	0	1	55	336	390	6.57e-24	102

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0002230	Msa1054810	0.805431	1.339102e-49	-8.615850e-47
Msa0006400	Msa1054810	0.809843	1.548332e-50	-8.615850e-47
Msa0009420	Msa1054810	0.802392	5.733264e-49	-8.615850e-47
Msa0068740	Msa1054810	-0.808774	2.624988e-50	-8.615850e-47
Msa0075880	Msa1054810	0.834923	2.263040e-56	-8.615850e-47
Msa0663240	Msa1054810	0.805267	1.449686e-49	-8.615850e-47
Msa0669440	Msa1054810	0.806744	7.090767e-50	-8.615850e-47
Msa0766630	Msa1054810	0.819944	8.902704e-53	-8.615850e-47
Msa0178930	Msa1054810	0.807194	5.694614e-50	-8.615850e-47
Msa0220740	Msa1054810	0.804274	2.337103e-49	-8.615850e-47
Msa0223010	Msa1054810	0.804047	2.605148e-49	-8.615850e-47
Msa0380850	Msa1054810	0.803658	3.138139e-49	-8.615850e-47
Msa0394660	Msa1054810	0.807660	4.535493e-50	-8.615850e-47
Msa0437990	Msa1054810	0.800332	1.514340e-48	-8.615850e-47
Msa0997370	Msa1054810	0.807231	5.591342e-50	-8.615850e-47
Msa1000900	Msa1054810	0.806587	7.650825e-50	-8.615850e-47
Msa1014540	Msa1054810	0.824464	7.958542e-54	-8.615850e-47
Msa1054810	Msa1152470	0.800077	1.706894e-48	-8.615850e-47
Msa1054810	Msa1156020	0.807702	4.441777e-50	-8.615850e-47
Msa1054810	Msa1185250	0.841469	4.662206e-58	-8.615850e-47
Msa1054810	Msa1261250	0.844423	7.631667e-59	-8.615850e-47
Msa1054810	Msa1281510	0.808769	2.631317e-50	-8.615850e-47
Msa1054810	Msa1291660	0.806278	8.890157e-50	-8.615850e-47
Msa1054810	Msa1335780	-0.801131	1.040532e-48	-8.615850e-47
Msa1054810	Msa1362390	0.804437	2.160849e-49	-8.615850e-47
Msa1054810	Msa1367850	0.814380	1.586788e-51	-8.615850e-47
Msa1054810	Msa1403480	0.828820	7.268313e-55	-8.615850e-47
Msa1054810	Msa1411020	0.807925	3.982617e-50	-8.615850e-47
Msa1054810	Msa1420290	0.815816	7.614974e-52	-8.615850e-47
Msa1054810	Msa1424290	0.810739	9.922225e-51	-8.615850e-47
Msa1054810	Msa1427230	0.816715	4.794660e-52	-8.615850e-47
Msa1054810	Msa1434350	0.807999	3.841048e-50	-8.615850e-47
Msa1054810	Msa1439320	0.809139	2.193721e-50	-8.615850e-47
Msa1054810	Msa1440810	0.801328	9.482895e-49	-8.615850e-47
Msa1054810	Msa1443060	0.808105	3.646067e-50	-8.615850e-47
Msa1054810	Msa1460830	0.800162	1.640471e-48	-8.615850e-47
Msa0300570	Msa1054810	0.801159	1.026925e-48	-8.615850e-47
Msa0339620	Msa1054810	0.816169	6.352993e-52	-8.615850e-47
Msa0344920	Msa1054810	0.803527	3.341622e-49	-8.615850e-47
Msa0506450	Msa1054810	0.808792	2.602607e-50	-8.615850e-47
Msa0510420	Msa1054810	0.808941	2.418137e-50	-8.615850e-47
Msa0538600	Msa1054810	0.803497	3.389575e-49	-8.615850e-47
Msa0585230	Msa1054810	0.807432	5.070628e-50	-8.615850e-47
Msa0861130	Msa1054810	0.801827	7.491784e-49	-8.615850e-47
Msa0925250	Msa1054810	0.832040	1.186178e-55	-8.615850e-47
Msa0925290	Msa1054810	0.839443	1.579794e-57	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	q. start	q. end	s. start	s. end	e-value	bit score
Msa1054810	MtrunA17_Chr2g0331251	83.636	55	9	1	55	336	390	6.48e-26	97.8
Msa1054810	MtrunA17_Chr8g0357041	53.704	54	25	1	54	280	333	1.66e-14	65.5
Msa1054810	MtrunA17_Chr8g0390401	49.057	53	27	2	54	460	512	5.33e-12	58.2

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1054810	AT2G32230.2	61.538	52	20	0	3	54	354	405	3.89e-18	76.3
Msa1054810	AT2G32230.1	61.538	52	20	0	3	54	354	405	3.89e-18	76.3

Find 14 sgRNAs with CRISPR-Local

Find 25 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
CGCGGCATCATTGTCTAAAT+TGG	0.142427	7_2:+27137604	Msa1054810:CDS
ATGTATGATGTTGTTGTTTA+TGG	0.198942	7_2:+27137889	Msa1054810:CDS
CAGCTGTAAACAGGTGATTA+TGG	0.287348	7_2:+27137943	Msa1054810:three_prime_UTR
CGCGACACGCCTATTCTTAG+AGG	0.354213	7_2:-27138007	None:intergenic
AGCTGATTTCAGCTGTAAAC+AGG	0.418900	7_2:+27137934	Msa1054810:exon
CAGAAGTGGCTTGAGAAGAA+TGG	0.454597	7_2:+27137865	Msa1054810:intron
CCATGGACACCTCTAAGAAT+AGG	0.459016	7_2:+27137998	Msa1054810:three_prime_UTR
AAATGATCGAAGTTTGCCTT+AGG	0.492571	7_2:-27137641	None:intergenic
GTTGTTTATGGAGCAAATGT+AGG	0.518443	7_2:+27137901	Msa1054810:CDS
CCTATTCTTAGAGGTGTCCA+TGG	0.527953	7_2:-27137998	None:intergenic
TGTTTACAGCTGAAATCAGC+TGG	0.533665	7_2:-27137932	None:intergenic
AAAAGAGACTGAAAACTTCG+CGG	0.550959	7_2:+27137586	Msa1054810:CDS
CTCTAAGAATAGGCGTGTCG+CGG	0.611181	7_2:+27138008	Msa1054810:three_prime_UTR
TCATAACAGTCTATAAACCA+TGG	0.635600	7_2:+27137981	Msa1054810:three_prime_UTR

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	CAATATATAAATATTACTAT+AGG	+	chr7_2:27137811-27137830	Msa1054810:intron	10.0%
!!	ATAAATATTACTATAGGCAT+AGG	+	chr7_2:27137817-27137836	Msa1054810:intron	20.0%
!	TTTAATAACACAGTGAAGAT+TGG	-	chr7_2:27137676-27137695	None:intergenic	25.0%
!!	TTAAAAGCTGAATTTTGTGA+TGG	+	chr7_2:27137713-27137732	Msa1054810:intron	25.0%
!	AAAGCATAGCTATTATACAA+AGG	-	chr7_2:27137763-27137782	None:intergenic	25.0%
!!!	ATGTATGATGTTGTTGTTTA+TGG	+	chr7_2:27137889-27137908	Msa1054810:CDS	25.0%
	TTCAAGAAATTGTCTTCAGT+TGG	+	chr7_2:27137781-27137800	Msa1054810:intron	30.0%
!!	ATGTTTAACTTTTGCAGAAG+TGG	+	chr7_2:27137851-27137870	Msa1054810:intron	30.0%
	TCATAACAGTCTATAAACCA+TGG	+	chr7_2:27137981-27138000	Msa1054810:three_prime_UTR	30.0%
	AAAAGAGACTGAAAACTTCG+CGG	+	chr7_2:27137586-27137605	Msa1054810:CDS	35.0%
!	AGTTTGCCTTAGGATGTTTT+TGG	-	chr7_2:27137634-27137653	None:intergenic	35.0%
	AAATGATCGAAGTTTGCCTT+AGG	-	chr7_2:27137644-27137663	None:intergenic	35.0%
	GTTGTTTATGGAGCAAATGT+AGG	+	chr7_2:27137901-27137920	Msa1054810:CDS	35.0%
!	GCGAAGTTTTCAGTCTCTTT+TGG	-	chr7_2:27137587-27137606	None:intergenic	40.0%
!	GGCAAACTTCGATCATTTTC+AGG	+	chr7_2:27137646-27137665	Msa1054810:CDS	40.0%
	TGTTTACAGCTGAAATCAGC+TGG	-	chr7_2:27137935-27137954	None:intergenic	40.0%
!	AGCTGATTTCAGCTGTAAAC+AGG	+	chr7_2:27137934-27137953	Msa1054810:exon	40.0%
	CAGCTGTAAACAGGTGATTA+TGG	+	chr7_2:27137943-27137962	Msa1054810:three_prime_UTR	40.0%
	CGCGGCATCATTGTCTAAAT+TGG	+	chr7_2:27137604-27137623	Msa1054810:CDS	45.0%
	GGCTTGCCAAAAACATCCTA+AGG	+	chr7_2:27137625-27137644	Msa1054810:CDS	45.0%
	CAGAAGTGGCTTGAGAAGAA+TGG	+	chr7_2:27137865-27137884	Msa1054810:intron	45.0%
!!	CCTATTCTTAGAGGTGTCCA+TGG	-	chr7_2:27138001-27138020	None:intergenic	45.0%
!	CCATGGACACCTCTAAGAAT+AGG	+	chr7_2:27137998-27138017	Msa1054810:three_prime_UTR	45.0%
!	CTCTAAGAATAGGCGTGTCG+CGG	+	chr7_2:27138008-27138027	Msa1054810:three_prime_UTR	50.0%
	CGCGACACGCCTATTCTTAG+AGG	-	chr7_2:27138010-27138029	None:intergenic	55.0%

Chromosome	Type	Strat	End	Strand	Name
chr7_2	gene	27137562	27138040	27137562	ID=Msa1054810;Name=Msa1054810
chr7_2	mRNA	27137562	27138040	27137562	ID=Msa1054810-mRNA-1;Parent=Msa1054810;Name=Msa1054810-mRNA-1;_AED=0.00;_eAED=0.00;_QI=4\|1\|1\|1\|1\|1\|2\|101\|57
chr7_2	exon	27137562	27137667	27137562	ID=Msa1054810-mRNA-1:exon:5768;Parent=Msa1054810-mRNA-1
chr7_2	exon	27137868	27138040	27137868	ID=Msa1054810-mRNA-1:exon:5769;Parent=Msa1054810-mRNA-1
chr7_2	five_prime_UTR	27137562	27137565	27137562	ID=Msa1054810-mRNA-1:five_prime_utr;Parent=Msa1054810-mRNA-1
chr7_2	CDS	27137566	27137667	27137566	ID=Msa1054810-mRNA-1:cds;Parent=Msa1054810-mRNA-1
chr7_2	CDS	27137868	27137939	27137868	ID=Msa1054810-mRNA-1:cds;Parent=Msa1054810-mRNA-1
chr7_2	three_prime_UTR	27137940	27138040	27137940	ID=Msa1054810-mRNA-1:three_prime_utr;Parent=Msa1054810-mRNA-1

Gene Sequence	>Msa1054810 ATGAGCATTGATATTGATCCAAAAGAGACTGAAAACTTCGCGGCATCATTGTCTAAATTGGCTTGCCAAAAACATCCTAAGGCAAACTTCGATCATTTTCAGAAGTGGCTTGAGAAGAATGGCATGTATGATGTTGTTGTTTATGGAGCAAATGTAGGACTTGCAACCAGCTGA
Protein sequence	>Msa1054810 MSIDIDPKETENFAASLSKLACQKHPKANFDHFQKWLEKNGMYDVVVYGANVGLATS*