AlfalfaGEDB | Msa0665520

M. sativa cultivar zhongmu-4 / Msa0665520

KEGG: -
GO: -
PFAM: PF05553.14

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0665520	XP_013454667.1	97.674	86	2	0	1	86	1	86	9.76e-53	169

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0665520	A0A072UHU7	97.674	86	2	0	1	86	1	86	4.66e-53	169

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0058310	Msa0665520	0.801710	7.919185e-49	-8.615850e-47
Msa0081940	Msa0665520	0.800461	1.425670e-48	-8.615850e-47
Msa0082050	Msa0665520	0.801448	8.960625e-49	-8.615850e-47
Msa0111080	Msa0665520	0.813596	2.362951e-51	-8.615850e-47
Msa0665520	Msa0705990	0.807201	5.674901e-50	-8.615850e-47
Msa0665520	Msa0709120	0.804823	1.795620e-49	-8.615850e-47
Msa0665520	Msa0732600	0.803454	3.459850e-49	-8.615850e-47
Msa0665520	Msa0811040	0.820389	7.037694e-53	-8.615850e-47
Msa0665520	Msa0844610	0.809704	1.658958e-50	-8.615850e-47
Msa0665520	Msa1063420	0.817804	2.727493e-52	-8.615850e-47
Msa0665520	Msa1130530	0.800089	1.697454e-48	-8.615850e-47
Msa0665520	Msa1143020	0.807647	4.564001e-50	-8.615850e-47
Msa0665520	Msa1209190	0.818956	1.495378e-52	-8.615850e-47
Msa0665520	Msa1209860	0.818393	2.006977e-52	-8.615850e-47
Msa0665520	Msa1234620	0.809061	2.278788e-50	-8.615850e-47
Msa0665520	Msa1250110	0.800585	1.345221e-48	-8.615850e-47
Msa0665520	Msa1270660	0.825228	5.256138e-54	-8.615850e-47
Msa0665520	Msa1332050	0.811411	7.097479e-51	-8.615850e-47
Msa0665520	Msa1335230	0.813703	2.237682e-51	-8.615850e-47
Msa0665520	Msa1370590	0.823179	1.591942e-53	-8.615850e-47
Msa0665520	Msa1384100	0.822772	1.980999e-53	-8.615850e-47
Msa0665520	Msa1442790	0.809097	2.238751e-50	-8.615850e-47
Msa0665520	Msa1444120	0.831184	1.927474e-55	-8.615850e-47
Msa0128430	Msa0665520	0.801225	9.953962e-49	-8.615850e-47
Msa0136630	Msa0665520	0.820038	8.470183e-53	-8.615850e-47
Msa0139670	Msa0665520	0.805342	1.398270e-49	-8.615850e-47
Msa0142500	Msa0665520	0.804636	1.964218e-49	-8.615850e-47
Msa0154920	Msa0665520	0.812953	3.270098e-51	-8.615850e-47
Msa0380600	Msa0665520	0.810124	1.347301e-50	-8.615850e-47
Msa0403490	Msa0665520	0.822088	2.855528e-53	-8.615850e-47
Msa0422180	Msa0665520	0.807421	5.097722e-50	-8.615850e-47
Msa0430240	Msa0665520	0.806969	6.354717e-50	-8.615850e-47
Msa0472770	Msa0665520	0.801663	8.096369e-49	-8.615850e-47
Msa0240270	Msa0665520	0.800049	1.729281e-48	-8.615850e-47
Msa0482940	Msa0665520	0.824965	6.063731e-54	-8.615850e-47
Msa0514610	Msa0665520	0.802448	5.584231e-49	-8.615850e-47
Msa0518170	Msa0665520	0.805910	1.062395e-49	-8.615850e-47
Msa0530710	Msa0665520	0.834783	2.454496e-56	-8.615850e-47
Msa0566350	Msa0665520	0.803020	4.255483e-49	-8.615850e-47
Msa0583670	Msa0665520	0.801329	9.478546e-49	-8.615850e-47
Msa0587540	Msa0665520	0.848503	5.881204e-60	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0665520	MtrunA17_Chr4g0003591	97.674	86	2	0	1	86	1	86	8.98e-57	169
Msa0665520	MtrunA17_Chr2g0332831	56.250	96	30	3	1	85	1	95	6.93e-27	94.4

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Find 14 sgRNAs with CRISPR-Local

Find 15 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
CCTTGCTGATTGTGGCTTGA+TGG	0.224833	4_4:+5109026	None:intergenic
CTTCCTTTCCTTGCTGATTG+TGG	0.393281	4_4:+5109018	None:intergenic
ATTATGAGAAAATGCTTGCT+AGG	0.453535	4_4:-5108818	Msa0665520:CDS
TTATGAGAAAATGCTTGCTA+GGG	0.510063	4_4:-5108817	Msa0665520:CDS
CTGCCTAAAATTCTTAATGA+AGG	0.513078	4_4:+5108875	None:intergenic
GCATTGATATCTTCTTCACT+TGG	0.515090	4_4:+5108909	None:intergenic
GGCAGCAGCTTATGCTTCAG+AGG	0.527016	4_4:-5108857	Msa0665520:CDS
TTGCAAATAGCTCTTTCTCA+TGG	0.538159	4_4:+5109049	None:intergenic
GGAAGAGATCAAACATTCAT+CGG	0.553665	4_4:-5109000	Msa0665520:CDS
AGAAAATGCTTGCTAGGGGA+CGG	0.603069	4_4:-5108812	Msa0665520:CDS
GTCGTCGTCGTCATCGCATG+AGG	0.611605	4_4:-5108976	Msa0665520:CDS
AAGCCACAATCAGCAAGGAA+AGG	0.618413	4_4:-5109021	Msa0665520:CDS
CCATCAAGCCACAATCAGCA+AGG	0.651776	4_4:-5109026	Msa0665520:CDS
TATGAGAAAATGCTTGCTAG+GGG	0.668349	4_4:-5108816	Msa0665520:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	ATGCCTTCATTAAGAATTTT+AGG	-	chr4_4:5108978-5108997	Msa0665520:CDS	25.0%
!!	CATTTTCTCATAATTCTCAA+TGG	+	chr4_4:5109032-5109051	None:intergenic	25.0%
	CTGCCTAAAATTCTTAATGA+AGG	+	chr4_4:5108984-5109003	None:intergenic	30.0%
	ATTATGAGAAAATGCTTGCT+AGG	-	chr4_4:5109038-5109057	Msa0665520:CDS	30.0%
!	TTATGAGAAAATGCTTGCTA+GGG	-	chr4_4:5109039-5109058	Msa0665520:CDS	30.0%
	GGAAGAGATCAAACATTCAT+CGG	-	chr4_4:5108856-5108875	Msa0665520:CDS	35.0%
!	GCATTGATATCTTCTTCACT+TGG	+	chr4_4:5108950-5108969	None:intergenic	35.0%
!	TATGAGAAAATGCTTGCTAG+GGG	-	chr4_4:5109040-5109059	Msa0665520:CDS	35.0%
	AAGCCACAATCAGCAAGGAA+AGG	-	chr4_4:5108835-5108854	Msa0665520:CDS	45.0%
!	CTTCCTTTCCTTGCTGATTG+TGG	+	chr4_4:5108841-5108860	None:intergenic	45.0%
!	AGAAAATGCTTGCTAGGGGA+CGG	-	chr4_4:5109044-5109063	Msa0665520:CDS	45.0%
!	CCTTGCTGATTGTGGCTTGA+TGG	+	chr4_4:5108833-5108852	None:intergenic	50.0%
	CCATCAAGCCACAATCAGCA+AGG	-	chr4_4:5108830-5108849	Msa0665520:CDS	50.0%
	GGCAGCAGCTTATGCTTCAG+AGG	-	chr4_4:5108999-5109018	Msa0665520:CDS	55.0%
	GTCGTCGTCGTCATCGCATG+AGG	-	chr4_4:5108880-5108899	Msa0665520:CDS	60.0%

Chromosome	Type	Strat	End	Strand	Name
chr4_4	gene	5108809	5109069	5108809	ID=Msa0665520;Name=Msa0665520
chr4_4	mRNA	5108809	5109069	5108809	ID=Msa0665520-mRNA-1;Parent=Msa0665520;Name=Msa0665520-mRNA-1;_AED=0.21;_eAED=0.22;_QI=0\|-1\|0\|1\|-1\|1\|1\|0\|86
chr4_4	exon	5108809	5109069	5108809	ID=Msa0665520-mRNA-1:exon:1702;Parent=Msa0665520-mRNA-1
chr4_4	CDS	5108809	5109069	5108809	ID=Msa0665520-mRNA-1:cds;Parent=Msa0665520-mRNA-1

Gene Sequence	>Msa0665520 ATGAGAAAGAGCTATTTGCAACCATCAAGCCACAATCAGCAAGGAAAGGAAGAGATCAAACATTCATCGGTGTCGTCGTCGTCATCGCATGAGGCAGAGAAGAAAGTGACTCATCAAACAAGAAAGCTAGAGAGATTGCCAAGTGAAGAAGATATCAATGCTAGTGCTGATGCCTTCATTAAGAATTTTAGGCAGCAGCTTATGCTTCAGAGGCTTCAATCCATTGAGAATTATGAGAAAATGCTTGCTAGGGGACGGTAG
Protein sequence	>Msa0665520 MRKSYLQPSSHNQQGKEEIKHSSVSSSSSHEAEKKVTHQTRKLERLPSEEDINASADAFIKNFRQQLMLQRLQSIENYEKMLARGR*