AlfalfaGEDB | MS.gene09668

M. sativa cultivar XinJiangDaYe / MS.gene09668

KEGG: -
GO: -
PFAM: -

Nr:

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MS.gene09668.t1	XP_003611450.2	70.6	153	43	1	1	153	210	360	7.20E-47	196.8

Swissprot:

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Trembl:

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MS.gene09668.t1	G7JZV4	70.6	153	43	1	1	153	210	360	5.2e-47	196.8

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network:

Gene1	Gene2	correlation coefficient	p_value	FDR
MS.gene049150	MS.gene09668	0.820238	7.62E-53	-1.69E-46
MS.gene049151	MS.gene09668	0.813168	2.93E-51	-1.69E-46
MS.gene049153	MS.gene09668	0.821829	3.28E-53	-1.69E-46
MS.gene049159	MS.gene09668	0.813057	3.10E-51	-1.69E-46
MS.gene049260	MS.gene09668	0.801112	1.05E-48	-1.69E-46
MS.gene049378	MS.gene09668	0.838824	2.29E-57	-1.69E-46
MS.gene049758	MS.gene09668	0.836328	9.98E-57	-1.69E-46
MS.gene049910	MS.gene09668	0.842419	2.62E-58	-1.69E-46
MS.gene050128	MS.gene09668	0.802634	5.11E-49	-1.69E-46
MS.gene050226	MS.gene09668	0.859823	3.17E-63	-1.69E-46
MS.gene050227	MS.gene09668	0.863318	2.71E-64	-1.69E-46
MS.gene050228	MS.gene09668	0.85791	1.18E-62	-1.69E-46
MS.gene050442	MS.gene09668	0.876244	1.63E-68	-1.69E-46
MS.gene050558	MS.gene09668	0.816669	4.91E-52	-1.69E-46
MS.gene050623	MS.gene09668	-0.834759	2.49E-56	-1.69E-46
MS.gene050642	MS.gene09668	0.80226	6.10E-49	-1.69E-46
MS.gene050680	MS.gene09668	0.820938	5.26E-53	-1.69E-46
MS.gene050719	MS.gene09668	0.810454	1.14E-50	-1.69E-46
MS.gene050721	MS.gene09668	0.808901	2.47E-50	-1.69E-46
MS.gene050724	MS.gene09668	0.801861	7.37E-49	-1.69E-46
MS.gene050762	MS.gene09668	0.811288	7.55E-51	-1.69E-46
MS.gene050763	MS.gene09668	0.812239	4.69E-51	-1.69E-46
MS.gene050787	MS.gene09668	0.805488	1.30E-49	-1.69E-46
MS.gene050820	MS.gene09668	0.820773	5.75E-53	-1.69E-46
MS.gene05119	MS.gene09668	-0.805441	1.33E-49	-1.69E-46
MS.gene051663	MS.gene09668	0.807908	4.02E-50	-1.69E-46
MS.gene051860	MS.gene09668	0.863171	3.01E-64	-1.69E-46
MS.gene051983	MS.gene09668	0.840523	8.26E-58	-1.69E-46
MS.gene052077	MS.gene09668	0.804512	2.08E-49	-1.69E-46
MS.gene052255	MS.gene09668	0.80223	6.19E-49	-1.69E-46
MS.gene052426	MS.gene09668	0.827254	1.73E-54	-1.69E-46
MS.gene053184	MS.gene09668	0.810522	1.11E-50	-1.69E-46
MS.gene053494	MS.gene09668	0.819596	1.07E-52	-1.69E-46
MS.gene053559	MS.gene09668	0.822443	2.36E-53	-1.69E-46
MS.gene053577	MS.gene09668	0.819529	1.11E-52	-1.69E-46
MS.gene053836	MS.gene09668	0.864979	8.23E-65	-1.69E-46
MS.gene054083	MS.gene09668	0.802423	5.65E-49	-1.69E-46
MS.gene05417	MS.gene09668	0.800414	1.46E-48	-1.69E-46
MS.gene054379	MS.gene09668	0.819416	1.18E-52	-1.69E-46
MS.gene054467	MS.gene09668	0.803301	3.72E-49	-1.69E-46
MS.gene054468	MS.gene09668	0.818118	2.32E-52	-1.69E-46
MS.gene054473	MS.gene09668	0.817661	2.94E-52	-1.69E-46
MS.gene054542	MS.gene09668	0.809492	1.84E-50	-1.69E-46
MS.gene054930	MS.gene09668	0.880771	4.17E-70	-1.69E-46
MS.gene054983	MS.gene09668	0.810494	1.12E-50	-1.69E-46
MS.gene05510	MS.gene09668	0.841058	5.98E-58	-1.69E-46
MS.gene055358	MS.gene09668	0.805984	1.02E-49	-1.69E-46
MS.gene055701	MS.gene09668	0.839071	1.97E-57	-1.69E-46
MS.gene056873	MS.gene09668	0.806346	8.60E-50	-1.69E-46
MS.gene056875	MS.gene09668	0.848416	6.21E-60	-1.69E-46
MS.gene056979	MS.gene09668	0.839031	2.02E-57	-1.69E-46
MS.gene057121	MS.gene09668	0.800611	1.33E-48	-1.69E-46
MS.gene057469	MS.gene09668	0.848892	4.59E-60	-1.69E-46
MS.gene05761	MS.gene09668	0.833033	6.73E-56	-1.69E-46
MS.gene057750	MS.gene09668	0.8353	1.82E-56	-1.69E-46
MS.gene057754	MS.gene09668	0.801068	1.07E-48	-1.69E-46
MS.gene057869	MS.gene09668	0.83071	2.52E-55	-1.69E-46
MS.gene058002	MS.gene09668	0.807819	4.20E-50	-1.69E-46
MS.gene05811	MS.gene09668	0.801224	9.96E-49	-1.69E-46
MS.gene058146	MS.gene09668	0.812866	3.42E-51	-1.69E-46
MS.gene058399	MS.gene09668	0.816412	5.60E-52	-1.69E-46
MS.gene058982	MS.gene09668	0.806072	9.82E-50	-1.69E-46
MS.gene05907	MS.gene09668	0.803278	3.76E-49	-1.69E-46
MS.gene059124	MS.gene09668	0.826788	2.24E-54	-1.69E-46
MS.gene059128	MS.gene09668	0.831037	2.09E-55	-1.69E-46
MS.gene059161	MS.gene09668	0.80288	4.55E-49	-1.69E-46
MS.gene059285	MS.gene09668	0.803916	2.77E-49	-1.69E-46
MS.gene05984	MS.gene09668	0.82021	7.74E-53	-1.69E-46
MS.gene059899	MS.gene09668	0.804012	2.65E-49	-1.69E-46
MS.gene060011	MS.gene09668	0.819055	1.42E-52	-1.69E-46
MS.gene060137	MS.gene09668	-0.820812	5.63E-53	-1.69E-46
MS.gene060322	MS.gene09668	0.819802	9.59E-53	-1.69E-46
MS.gene060495	MS.gene09668	0.817052	4.03E-52	-1.69E-46
MS.gene06052	MS.gene09668	0.801933	7.13E-49	-1.69E-46
MS.gene060683	MS.gene09668	0.84552	3.86E-59	-1.69E-46
MS.gene060685	MS.gene09668	0.840719	7.34E-58	-1.69E-46
MS.gene060802	MS.gene09668	0.829016	6.52E-55	-1.69E-46
MS.gene060803	MS.gene09668	0.827654	1.39E-54	-1.69E-46
MS.gene060942	MS.gene09668	0.807491	4.93E-50	-1.69E-46
MS.gene060998	MS.gene09668	0.841237	5.37E-58	-1.69E-46
MS.gene061049	MS.gene09668	0.810707	1.01E-50	-1.69E-46

PPI:

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MS.gene09668.t1	MTR_5g014110	90.909	143	11	1	1	143	210	350	6.67e-88	261

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Find 27 sgRNAs with CRISPR-Local

Find 36 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TATTTGGCAGTGAATAAAAT+TGG	0.189398	5.2:-6133496	MS.gene09668:CDS
GAATGTTGAGAAGGAGAATA+AGG	0.275772	5.2:-6133374	MS.gene09668:CDS
GGGGTTGAAAATGCCATATT+TGG	0.313158	5.2:-6133512	MS.gene09668:CDS
AAGCAGAAGCAGAAGCATTC+AGG	0.352808	5.2:-6133295	MS.gene09668:CDS
GGTGAGAGCTTTCAAAGTTT+AGG	0.356862	5.2:-6133274	MS.gene09668:CDS
GAAGGAGATGAAAATGGATT+TGG	0.357391	5.2:-6133398	MS.gene09668:CDS
ATTGTTGAATGAGATGAAAA+TGG	0.365578	5.2:-6133341	MS.gene09668:CDS
ATTTGGCAGTGAATAAAATT+GGG	0.410901	5.2:-6133495	MS.gene09668:CDS
GGTGCTGAAGGAGATGAAAA+TGG	0.412755	5.2:-6133404	MS.gene09668:CDS
ATGAAAATGGGAGTTTCTAA+AGG	0.436835	5.2:-6133328	MS.gene09668:CDS
TAATTGTGAAGGTGATTTGC+AGG	0.455443	5.2:-6133425	MS.gene09668:CDS
GGCAGTGAATAAAATTGGGT+TGG	0.467463	5.2:-6133491	MS.gene09668:CDS
AACAACAACCCTTGTGTCAC+CGG	0.481710	5.2:+6133571	None:intergenic
AATGGGAGTTTCTAAAGGGA+AGG	0.515092	5.2:-6133323	MS.gene09668:CDS
GAATAAAATTGGGTTGGAGA+GGG	0.535296	5.2:-6133485	MS.gene09668:CDS
TTGTTGAATGAGATGAAAAT+GGG	0.539773	5.2:-6133340	MS.gene09668:CDS
TGAAAATGGGAGTTTCTAAA+GGG	0.540370	5.2:-6133327	MS.gene09668:CDS
TATGGCTAGGACGGTGATGC+CGG	0.560278	5.2:-6133590	MS.gene09668:CDS
ACGGTGATGCCGGTGACACA+AGG	0.562748	5.2:-6133580	MS.gene09668:CDS
TGAATAAAATTGGGTTGGAG+AGG	0.567365	5.2:-6133486	MS.gene09668:CDS
GGATTTGGAGAATGTTGAGA+AGG	0.568307	5.2:-6133383	MS.gene09668:CDS
CTTGTGTTGGTGTTATGGCT+AGG	0.572621	5.2:-6133603	None:intergenic
AGGTGATTTGCAGGTGCTGA+AGG	0.592161	5.2:-6133416	MS.gene09668:CDS
AAGACATGAAGAAAGATGAG+TGG	0.604514	5.2:-6133459	MS.gene09668:CDS
TGTTGGTGTTATGGCTAGGA+CGG	0.624391	5.2:-6133599	None:intergenic
AACAACGATGATAATTGTGA+AGG	0.673292	5.2:-6133436	MS.gene09668:CDS
CGGTGATGCCGGTGACACAA+GGG	0.700522	5.2:-6133579	MS.gene09668:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!	AGTTTAGGAAGCAATAAAAA+TGG	-	chr5.2:6133480-6133499	MS.gene09668:CDS	25.0%
!	ATTGTTGAATGAGATGAAAA+TGG	-	chr5.2:6133398-6133417	MS.gene09668:CDS	25.0%
!	ATTTGGCAGTGAATAAAATT+GGG	-	chr5.2:6133244-6133263	MS.gene09668:CDS	25.0%
!	TATTTGGCAGTGAATAAAAT+TGG	-	chr5.2:6133243-6133262	MS.gene09668:CDS	25.0%
!	TTGTTGAATGAGATGAAAAT+GGG	-	chr5.2:6133399-6133418	MS.gene09668:CDS	25.0%
!!	ATTTTATTCACTGCCAAATA+TGG	+	chr5.2:6133243-6133262	None:intergenic	25.0%
	AACAACGATGATAATTGTGA+AGG	-	chr5.2:6133303-6133322	MS.gene09668:CDS	30.0%
	ATGAAAATGGGAGTTTCTAA+AGG	-	chr5.2:6133411-6133430	MS.gene09668:CDS	30.0%
	TGAAAATGGGAGTTTCTAAA+GGG	-	chr5.2:6133412-6133431	MS.gene09668:CDS	30.0%
!	GAGTGATTTTGAATCTGAAT+TGG	-	chr5.2:6133554-6133573	MS.gene09668:CDS	30.0%
!!	GTTGTTGTTGAATTTTCGTT+GGG	-	chr5.2:6133182-6133201	MS.gene09668:CDS	30.0%
!!	TTGTTGTTGAATTTTCGTTG+GGG	-	chr5.2:6133183-6133202	MS.gene09668:CDS	30.0%
	AAGACATGAAGAAAGATGAG+TGG	-	chr5.2:6133280-6133299	MS.gene09668:CDS	35.0%
	GAATGTTGAGAAGGAGAATA+AGG	-	chr5.2:6133365-6133384	MS.gene09668:CDS	35.0%
!	GAAGGAGATGAAAATGGATT+TGG	-	chr5.2:6133341-6133360	MS.gene09668:CDS	35.0%
!	TAATTGTGAAGGTGATTTGC+AGG	-	chr5.2:6133314-6133333	MS.gene09668:CDS	35.0%
!!	GAATAAAATTGGGTTGGAGA+GGG	-	chr5.2:6133254-6133273	MS.gene09668:CDS	35.0%
!!	GGTTGTTGTTGAATTTTCGT+TGG	-	chr5.2:6133181-6133200	MS.gene09668:CDS	35.0%
!!	TGAATAAAATTGGGTTGGAG+AGG	-	chr5.2:6133253-6133272	MS.gene09668:CDS	35.0%
	GGATTTGGAGAATGTTGAGA+AGG	-	chr5.2:6133356-6133375	MS.gene09668:CDS	40.0%
	GGCAGTGAATAAAATTGGGT+TGG	-	chr5.2:6133248-6133267	MS.gene09668:CDS	40.0%
	GGGGTTGAAAATGCCATATT+TGG	-	chr5.2:6133227-6133246	MS.gene09668:CDS	40.0%
	GGTGAGAGCTTTCAAAGTTT+AGG	-	chr5.2:6133465-6133484	MS.gene09668:CDS	40.0%
!	AATGGGAGTTTCTAAAGGGA+AGG	-	chr5.2:6133416-6133435	MS.gene09668:CDS	40.0%
!	TGTGAGTTTTCCAGGGAAAT+CGG	-	chr5.2:6133206-6133225	MS.gene09668:CDS	40.0%
	AACAACAACCCTTGTGTCAC+CGG	+	chr5.2:6133171-6133190	None:intergenic	45.0%
!	ATTTTCAACCCCGATTTCCC+TGG	+	chr5.2:6133219-6133238	None:intergenic	45.0%
!	GGTGCTGAAGGAGATGAAAA+TGG	-	chr5.2:6133335-6133354	MS.gene09668:CDS	45.0%
!	GTGAGTTTTCCAGGGAAATC+GGG	-	chr5.2:6133207-6133226	MS.gene09668:CDS	45.0%
!	TGAGTTTTCCAGGGAAATCG+GGG	-	chr5.2:6133208-6133227	MS.gene09668:CDS	45.0%
!!	AAGCAGAAGCAGAAGCATTC+AGG	-	chr5.2:6133444-6133463	MS.gene09668:CDS	45.0%
!	GTTGGGGTGTGAGTTTTCCA+GGG	-	chr5.2:6133199-6133218	MS.gene09668:CDS	50.0%
!!	AGGTGATTTGCAGGTGCTGA+AGG	-	chr5.2:6133323-6133342	MS.gene09668:CDS	50.0%
!	CGTTGGGGTGTGAGTTTTCC+AGG	-	chr5.2:6133198-6133217	MS.gene09668:CDS	55.0%
	ACGGTGATGCCGGTGACACA+AGG	-	chr5.2:6133159-6133178	MS.gene09668:CDS	60.0%
	CGGTGATGCCGGTGACACAA+GGG	-	chr5.2:6133160-6133179	MS.gene09668:CDS	60.0%

Chromosome	Type	Strat	End	Strand	Name
chr5.2	gene	6133150	6133611	6133150	ID=MS.gene09668
chr5.2	mRNA	6133150	6133611	6133150	ID=MS.gene09668.t1;Parent=MS.gene09668
chr5.2	exon	6133150	6133611	6133150	ID=MS.gene09668.t1.exon1;Parent=MS.gene09668.t1
chr5.2	CDS	6133150	6133611	6133150	ID=cds.MS.gene09668.t1;Parent=MS.gene09668.t1

Gene Sequence

>MS.gene09668

ATGGCTAGGACGGTGATGCCGGTGACACAAGGGTTGTTGTTGAATTTTCGTTGGGGTGTGAGTTTTCCAGGGAAATCGGGGTTGAAAATGCCATATTTGGCAGTGAATAAAATTGGGTTGGAGAGGGTTGAAGACATGAAGAAAGATGAGTGGAACAACGATGATAATTGTGAAGGTGATTTGCAGGTGCTGAAGGAGATGAAAATGGATTTGGAGAATGTTGAGAAGGAGAATAAGGAGATGAAGAGATTGTTGAATGAGATGAAAATGGGAGTTTCTAAAGGGAAGGTTTCAAAGCAGAAGCAGAAGCATTCAGGTGAGAGCTTTCAAAGTTTAGGAAGCAATAAAAATGGAAGAAAAGAGAATGAGAAAAAACAAGAAATCAAGTCTCAGAATGTTGTAGTGAGTGATTTTGAATCTGAATTGGAAAAAGCTATAAAAGCTGCTGCTGCTTCTTCTTAG

Protein sequence

>MS.gene09668.t1

MARTVMPVTQGLLLNFRWGVSFPGKSGLKMPYLAVNKIGLERVEDMKKDEWNNDDNCEGDLQVLKEMKMDLENVEKENKEMKRLLNEMKMGVSKGKVSKQKQKHSGESFQSLGSNKNGRKENEKKQEIKSQNVVVSDFESELEKAIKAAAASS