AlfalfaGEDB | MsG0380013923.01

M. sativa cultivar ZhongmuNo.1 / MsG0380013923.01

KEGG: K02874
GO: GO:0003735 GO:0005840 GO:0006412 GO:0015934
PFAM: PF00238

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsG0380013923.01.T01	RHN59744.1	97.03	101	3	0	1	101	1	101	1.97E-62	194

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsG0380013923.01.T01	B5LMQ9	87.879	99	12	0	1	99	1	99	7.37E-57	174

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
MsG0080048690.01	MsG0380013923.01	0.814709	1.342215e-51	9.072089e-49
MsG0080048692.01	MsG0380013923.01	0.875453	3.045121e-68	1.422417e-64
MsG0080048698.01	MsG0380013923.01	0.886674	2.785780e-72	2.009112e-68
MsG0080048699.01	MsG0380013923.01	0.928888	1.524447e-92	8.259172e-88
MsG0080049076.01	MsG0380013923.01	0.804099	2.541582e-49	1.299093e-46
MsG0180002226.01	MsG0380013923.01	0.828909	6.916994e-55	6.969426e-52
MsG0180004435.01	MsG0380013923.01	0.810858	9.350784e-51	5.700364e-48
MsG0380013448.01	MsG0380013923.01	0.842220	2.953520e-58	4.447416e-55
MsG0380013888.01	MsG0380013923.01	0.834879	2.322479e-56	2.792609e-53
MsG0380013916.01	MsG0380013923.01	0.865050	7.823193e-65	2.510928e-61
MsG0380013917.01	MsG0380013923.01	0.872143	3.987746e-67	1.650450e-63
MsG0380013920.01	MsG0380013923.01	0.884313	2.132939e-71	1.400658e-67
MsG0380013923.01	MsG0380013926.01	0.863868	1.830263e-64	5.632723e-61
MsG0380013923.01	MsG0380013929.01	0.882457	1.025628e-70	6.251904e-67
MsG0380013923.01	MsG0380013931.01	0.892982	9.597570e-75	8.975311e-71
MsG0380013923.01	MsG0380013932.01	0.830162	3.429137e-55	3.584278e-52
MsG0380013923.01	MsG0380013940.01	0.816825	4.528309e-52	3.242832e-49
MsG0380013923.01	MsG0380013941.01	0.881727	1.887465e-70	1.118253e-66
MsG0380013923.01	MsG0380013942.01	0.920047	2.097155e-87	6.958046e-83
MsG0380013923.01	MsG0380013943.01	0.824280	8.794431e-54	7.753926e-51
MsG0380013923.01	MsG0380013944.01	0.948738	5.191777e-107	9.875526e-102
MsG0380013923.01	MsG0380013945.01	0.821721	3.473023e-53	2.848081e-50
MsG0380013923.01	MsG0380013948.01	0.868793	5.011991e-66	1.836645e-62
MsG0380013923.01	MsG0380013950.01	0.800513	1.391247e-48	6.490362e-46
MsG0380013923.01	MsG0380013951.01	0.925166	2.650927e-90	1.166078e-85
MsG0380013923.01	MsG0380013952.01	0.889921	1.569992e-73	1.292175e-69
MsG0380013923.01	MsG0380013953.01	0.815963	7.059890e-52	4.938039e-49
MsG0380013923.01	MsG0380013957.01	0.824573	7.503744e-54	6.672760e-51
MsG0380013923.01	MsG0380013959.01	0.808306	3.303966e-50	1.882639e-47
MsG0380013923.01	MsG0380013961.01	0.811878	5.616012e-51	3.516988e-48
MsG0380013923.01	MsG0380013962.01	0.824806	6.610487e-54	5.918332e-51
MsG0380013923.01	MsG0380013966.01	0.899724	1.491892e-77	1.867791e-73
MsG0380013923.01	MsG0380013967.01	0.824585	7.451777e-54	6.629332e-51
MsG0380013923.01	MsG0380013968.01	0.927722	7.909252e-92	4.008444e-87
MsG0380013923.01	MsG0380013969.01	0.887868	9.776448e-73	7.397269e-69
MsG0380013923.01	MsG0380013971.01	0.806598	7.609576e-50	4.147159e-47
MsG0380013923.01	MsG0380013972.01	0.877314	6.941450e-69	3.474955e-65
MsG0380013923.01	MsG0380013977.01	0.826845	2.169064e-54	2.058008e-51
MsG0380013923.01	MsG0380013981.01	0.874263	7.743410e-68	3.463278e-64
MsG0380013923.01	MsG0380013995.01	0.907473	4.876884e-81	8.664367e-77
MsG0380013923.01	MsG0380014004.01	0.815780	7.758238e-52	5.399726e-49
MsG0380013923.01	MsG0380014005.01	0.829710	4.419525e-55	4.559750e-52
MsG0380013923.01	MsG0380014006.01	0.819584	1.075928e-52	8.313571e-50
MsG0380013923.01	MsG0380014008.01	0.935719	5.447629e-97	4.458226e-92
MsG0380013923.01	MsG0380014011.01	0.820911	5.340531e-53	4.281723e-50
MsG0380013923.01	MsG0380014018.01	0.913077	9.344394e-84	2.171450e-79
MsG0380013923.01	MsG0380014023.01	0.868168	7.977927e-66	2.858144e-62
MsG0380013923.01	MsG0380014026.01	0.879291	1.405043e-69	7.576461e-66
MsG0380013923.01	MsG0380014032.01	0.822020	2.962116e-53	2.449710e-50
MsG0380013923.01	MsG0380014033.01	0.870920	1.013271e-66	4.011679e-63
MsG0380013923.01	MsG0380014036.01	0.839895	1.204834e-57	1.687497e-54
MsG0380013923.01	MsG0380014039.01	0.964920	6.137597e-124	3.759016e-118
MsG0380013923.01	MsG0380014040.01	0.948182	1.565280e-106	2.873860e-101
MsG0380013923.01	MsG0380014044.01	0.849086	4.052228e-60	7.595322e-57
MsG0380013923.01	MsG0380014051.01	0.912528	1.756309e-83	3.968317e-79
MsG0380013923.01	MsG0380014057.01	0.904675	9.581645e-80	1.498164e-75
MsG0380013923.01	MsG0380017007.01	0.928291	3.553985e-92	1.856251e-87
MsG0380013923.01	MsG0480018296.01	0.878208	3.383287e-69	1.751273e-65
MsG0380013923.01	MsG0480020052.01	0.815816	7.615111e-52	5.304895e-49
MsG0380013923.01	MsG0480023810.01	-0.807447	5.031763e-50	2.803336e-47
MsG0380013923.01	MsG0580027677.01	0.818227	2.188178e-52	1.628352e-49
MsG0380013923.01	MsG0780035951.01	0.801530	8.622797e-49	4.127452e-46
MsG0380013923.01	MsG0780038197.01	0.817987	2.479431e-52	1.832987e-49
MsG0380013923.01	MsG0780040316.01	0.802667	5.031939e-49	2.479254e-46
MsG0380013923.01	MsG0880045630.01	0.816822	4.534959e-52	3.247399e-49
MsG0280009971.01	MsG0380013923.01	-0.838768	2.363984e-57	3.198301e-54
MsG0280010145.01	MsG0380013923.01	0.925747	1.205277e-90	5.465452e-86

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsG0380013923.01.T01	MTR_4g051390	92.929	99	7	0	1	99	1	99	1.27e-60	181
MsG0380013923.01.T01	MTR_2g087550	92.929	99	7	0	1	99	1	99	1.29e-59	181
MsG0380013923.01.T01	MTR_1779s0020	79.798	99	20	0	1	99	1	99	1.81e-54	165
MsG0380013923.01.T01	MTR_0002s0780	68.539	89	27	1	12	99	139	227	6.01e-35	120
MsG0380013923.01.T01	MTR_5g096490	42.222	90	50	1	1	90	14	101	2.60e-15	66.6
MsG0380013923.01.T01	MTR_5g007240	42.222	90	50	1	1	90	47	134	4.06e-15	67.0
MsG0380013923.01.T01	MTR_5g096490	42.222	90	50	1	1	90	47	134	4.06e-15	67.0
MsG0380013923.01.T01	MTR_7g098290	36.782	87	48	2	8	90	11	94	3.48e-11	55.8
MsG0380013923.01.T01	MTR_7g098290	36.782	87	48	2	8	90	26	109	5.08e-11	55.8
MsG0380013923.01.T01	MTR_1g069585	36.782	87	48	2	8	90	26	109	5.08e-11	55.8

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
MsG0380013923.01.T01	ATCG00780	80.808	99	19	0	1	99	1	99	1.05e-54	166
MsG0380013923.01.T01	AT5G46160	36.364	99	61	1	2	100	48	144	7.20e-19	77.0
MsG0380013923.01.T01	AT5G46160	36.364	99	61	1	2	100	47	143	7.85e-19	76.6
MsG0380013923.01.T01	AT3G04400	36.782	87	48	2	8	90	11	94	1.06e-11	57.4
MsG0380013923.01.T01	AT2G33370	36.782	87	48	2	8	90	11	94	1.06e-11	57.4
MsG0380013923.01.T01	AT3G04400	36.782	87	48	2	8	90	26	109	1.32e-11	57.4
MsG0380013923.01.T01	AT2G33370	36.782	87	48	2	8	90	26	109	1.32e-11	57.4
MsG0380013923.01.T01	AT1G04480	36.782	87	48	2	8	90	26	109	1.32e-11	57.4
MsG0380013923.01.T01	AT1G17560	32.353	102	55	2	2	91	26	125	3.86e-11	56.6
MsG0380013923.01.T01	AT1G17560	32.353	102	55	2	2	91	49	148	4.40e-11	57.0

Find 16 sgRNAs with CRISPR-Local

Find 16 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
GATCTTTCTAAAGATGAATT+TGG	0.231628	3:+48417073	None:intergenic
ATTATCGGCTACATTTAAAT+AGG	0.265072	3:+48417198	None:intergenic
AATCGACGGTATGCTTATAT+TGG	0.402113	3:-48417130	MsG0380013923.01.T01:CDS
TAGAAAGATCTGAAGTGATC+AGG	0.408019	3:-48417060	MsG0380013923.01.T01:CDS
TTGATGTGTATTCGAATCAT+AGG	0.441171	3:-48417160	MsG0380013923.01.T01:CDS
GCTACATTTAAATAGGTTTG+AGG	0.470779	3:+48417205	None:intergenic
TTCGCGGGCTCCGCTATTAT+CGG	0.494194	3:+48417183	None:intergenic
TCTCAATTCTCGGGCTATTG+CGG	0.549036	3:+48416917	None:intergenic
AGAAAGATCTGAAGTGATCA+GGG	0.551046	3:-48417059	MsG0380013923.01.T01:CDS
TTCGAATACACATCAATTCG+CGG	0.564271	3:+48417167	None:intergenic
TGATAAAGAAGAAATCCAAA+AGG	0.575450	3:-48416954	MsG0380013923.01.T01:CDS
AAAGAACTAAAACGTAGTAA+TGG	0.588124	3:-48417016	MsG0380013923.01.T01:CDS
TCGAATACACATCAATTCGC+GGG	0.590291	3:+48417168	None:intergenic
AATAAAGTATGATGATAATG+CGG	0.651706	3:-48416987	MsG0380013923.01.T01:CDS
TTAAATGTAGCCGATAATAG+CGG	0.666581	3:-48417193	MsG0380013923.01.T01:CDS
TCATAGGAGCTAGTAATCGA+CGG	0.670576	3:-48417144	MsG0380013923.01.T01:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	AATAAAGTATGATGATAATG+CGG	-	Chr3:48417158-48417177	MsG0380013923.01.T01:CDS	20.0%
!	AAAGAACTAAAACGTAGTAA+TGG	-	Chr3:48417129-48417148	MsG0380013923.01.T01:CDS	25.0%
!	TGATAAAGAAGAAATCCAAA+AGG	-	Chr3:48417191-48417210	MsG0380013923.01.T01:CDS	25.0%
!!	ATTATCGGCTACATTTAAAT+AGG	+	Chr3:48416950-48416969	None:intergenic	25.0%
!!	GATCTTTCTAAAGATGAATT+TGG	+	Chr3:48417075-48417094	None:intergenic	25.0%
	GCTACATTTAAATAGGTTTG+AGG	+	Chr3:48416943-48416962	None:intergenic	30.0%
	TTAAATGTAGCCGATAATAG+CGG	-	Chr3:48416952-48416971	MsG0380013923.01.T01:CDS	30.0%
	TTGATGTGTATTCGAATCAT+AGG	-	Chr3:48416985-48417004	MsG0380013923.01.T01:CDS	30.0%
!!	GAAAAAATTCGAGTTCCTTT+TGG	+	Chr3:48417209-48417228	None:intergenic	30.0%
	AATCGACGGTATGCTTATAT+TGG	-	Chr3:48417015-48417034	MsG0380013923.01.T01:CDS	35.0%
	TTCGAATACACATCAATTCG+CGG	+	Chr3:48416981-48417000	None:intergenic	35.0%
!	AGAAAGATCTGAAGTGATCA+GGG	-	Chr3:48417086-48417105	MsG0380013923.01.T01:CDS	35.0%
!	TAGAAAGATCTGAAGTGATC+AGG	-	Chr3:48417085-48417104	MsG0380013923.01.T01:CDS	35.0%
	TCATAGGAGCTAGTAATCGA+CGG	-	Chr3:48417001-48417020	MsG0380013923.01.T01:CDS	40.0%
	TCGAATACACATCAATTCGC+GGG	+	Chr3:48416980-48416999	None:intergenic	40.0%
	TTCGCGGGCTCCGCTATTAT+CGG	+	Chr3:48416965-48416984	None:intergenic	55.0%

Chromosome	Type	Strat	End	Strand	Name
Chr3	gene	48416931	48417236	48416931	ID=MsG0380013923.01;Name=MsG0380013923.01
Chr3	mRNA	48416931	48417236	48416931	ID=MsG0380013923.01.T01;Parent=MsG0380013923.01;Name=MsG0380013923.01.T01;_AED=0.50;_eAED=0.50;_QI=0\|-1\|0\|1\|-1\|1\|1\|0\|101
Chr3	exon	48416931	48417236	48416931	ID=MsG0380013923.01.T01:exon:9173;Parent=MsG0380013923.01.T01
Chr3	CDS	48416931	48417236	48416931	ID=MsG0380013923.01.T01:cds;Parent=MsG0380013923.01.T01

Gene Sequence	>MsG0380013923.01.T01 ATGATTCAACCTCAAACCTATTTAAATGTAGCCGATAATAGCGGAGCCCGCGAATTGATGTGTATTCGAATCATAGGAGCTAGTAATCGACGGTATGCTTATATTGGTGACATTGTTGTTGCTGTAATCAAAAAAGCAGTACCAAATTCATCTTTAGAAAGATCTGAAGTGATCAGGGCTGTAATTGTACGTACTTGTAAAGAACTAAAACGTAGTAATGGTATAATAATAAAGTATGATGATAATGCGGCAGTTCTCATTGATAAAGAAGAAATCCAAAAGGAACTCGAATTTTTTCCGCAATAG
Protein sequence	>MsG0380013923.01.T01 MIQPQTYLNVADNSGARELMCIRIIGASNRRYAYIGDIVVAVIKKAVPNSSLERSEVIRAVIVRTCKELKRSNGIIIKYDDNAAVLIDKEEIQKELEFFPQ*