AlfalfaGEDB | Msa0327110

M. sativa cultivar zhongmu-4 / Msa0327110

KEGG: K19496|K20826
GO: GO:0005575 GO:0005622 GO:0005623 GO:0005634 GO:0005737 GO:0006139 GO:0006351 GO:0006366 GO:0006725 GO:0006807 GO:0008150 GO:0008152 GO:0009058 GO:0009059 GO:0009987 GO:0010467 GO:0016070 GO:0018130 GO:0019438 GO:0030154 GO:0030880 GO:0032502 GO:0032774 GO:0032991 GO:0034641 GO:0034645 GO:0034654 GO:0043170 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044237 GO:0044238 GO:0044249 GO:0044260 GO:0044271 GO:0044424 GO:0044464 GO:0046483 GO:0048869 GO:0061695 GO:0071704 GO:0090304 GO:0097659 GO:1901360 GO:1901362 GO:1901576 GO:1902494 GO:1990234
PFAM: -

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0327110	AES66015.1	79.452	73	9	1	1	73	1	67	6.04e-31	114

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0327110	G7IIY9	79.452	73	9	1	1	73	1	67	2.88e-31	114

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0007440	Msa0327110	0.809343	1.982627e-50	-8.615850e-47
Msa0014710	Msa0327110	0.831028	2.104800e-55	-8.615850e-47
Msa0040620	Msa0327110	0.801431	9.031783e-49	-8.615850e-47
Msa0084380	Msa0327110	0.803658	3.137728e-49	-8.615850e-47
Msa0089820	Msa0327110	0.802691	4.976006e-49	-8.615850e-47
Msa0109900	Msa0327110	0.801543	8.566969e-49	-8.615850e-47
Msa0112770	Msa0327110	0.806457	8.149893e-50	-8.615850e-47
Msa0114060	Msa0327110	0.802774	4.782886e-49	-8.615850e-47
Msa0131770	Msa0327110	0.802971	4.353909e-49	-8.615850e-47
Msa0138500	Msa0327110	0.804605	1.993372e-49	-8.615850e-47
Msa0138520	Msa0327110	0.803133	4.031097e-49	-8.615850e-47
Msa0178510	Msa0327110	0.805090	1.578724e-49	-8.615850e-47
Msa0180500	Msa0327110	0.811366	7.257166e-51	-8.615850e-47
Msa0289250	Msa0327110	0.891425	4.021192e-74	-8.615850e-47
Msa0289330	Msa0327110	0.833514	5.104837e-56	-8.615850e-47
Msa0306210	Msa0327110	-0.804793	1.821818e-49	-8.615850e-47
Msa0309770	Msa0327110	0.802499	5.449278e-49	-8.615850e-47
Msa0327110	Msa0333030	0.812587	3.932925e-51	-8.615850e-47
Msa0327110	Msa0381610	-0.800865	1.179432e-48	-8.615850e-47
Msa0327110	Msa0433410	-0.805012	1.639457e-49	-8.615850e-47
Msa0327110	Msa0434180	0.804065	2.582709e-49	-8.615850e-47
Msa0327110	Msa0484780	0.812810	3.515915e-51	-8.615850e-47
Msa0327110	Msa0532350	0.801508	8.713365e-49	-8.615850e-47
Msa0327110	Msa0545700	0.810335	1.213461e-50	-8.615850e-47
Msa0327110	Msa0562440	0.828443	8.967210e-55	-8.615850e-47
Msa0327110	Msa0592440	0.802678	5.005823e-49	-8.615850e-47
Msa0327110	Msa0613440	0.804481	2.116527e-49	-8.615850e-47
Msa0327110	Msa0620960	0.806265	8.948432e-50	-8.615850e-47
Msa0327110	Msa0641670	0.802770	4.791017e-49	-8.615850e-47
Msa0327110	Msa0693380	0.811639	6.330967e-51	-8.615850e-47
Msa0327110	Msa0716840	0.819376	1.200113e-52	-8.615850e-47
Msa0327110	Msa0731940	0.829160	6.014058e-55	-8.615850e-47
Msa0327110	Msa0744040	0.800255	1.570176e-48	-8.615850e-47
Msa0327110	Msa0766630	0.801554	8.523436e-49	-8.615850e-47
Msa0327110	Msa0807370	0.809431	1.898888e-50	-8.615850e-47
Msa0327110	Msa0810220	0.810798	9.635020e-51	-8.615850e-47
Msa0327110	Msa0820850	0.811334	7.374381e-51	-8.615850e-47
Msa0327110	Msa0828850	0.801539	8.583001e-49	-8.615850e-47
Msa0327110	Msa0831850	0.803439	3.483805e-49	-8.615850e-47
Msa0327110	Msa0849030	0.817533	3.138476e-52	-8.615850e-47
Msa0327110	Msa0861130	0.817614	3.009654e-52	-8.615850e-47
Msa0327110	Msa0884470	0.808195	3.490268e-50	-8.615850e-47
Msa0327110	Msa0925290	0.800411	1.459813e-48	-8.615850e-47
Msa0327110	Msa0927380	0.804393	2.207737e-49	-8.615850e-47
Msa0327110	Msa0933100	0.800058	1.721993e-48	-8.615850e-47
Msa0327110	Msa0938220	0.807685	4.480002e-50	-8.615850e-47
Msa0327110	Msa0962840	0.805242	1.467351e-49	-8.615850e-47
Msa0327110	Msa1014540	0.819910	9.062105e-53	-8.615850e-47
Msa0327110	Msa1082500	0.811329	7.393703e-51	-8.615850e-47
Msa0327110	Msa1104090	0.800129	1.665764e-48	-8.615850e-47
Msa0327110	Msa1113170	0.812903	3.354053e-51	-8.615850e-47
Msa0327110	Msa1186950	-0.813181	2.914178e-51	-8.615850e-47
Msa0327110	Msa1257130	0.804097	2.544117e-49	-8.615850e-47
Msa0327110	Msa1282580	-0.809069	2.270381e-50	-8.615850e-47
Msa0327110	Msa1284680	0.806690	7.277898e-50	-8.615850e-47
Msa0327110	Msa1306850	0.802690	4.976617e-49	-8.615850e-47
Msa0327110	Msa1340260	0.800434	1.443699e-48	-8.615850e-47
Msa0327110	Msa1364830	0.800775	1.230272e-48	-8.615850e-47
Msa0327110	Msa1372150	0.802796	4.733081e-49	-8.615850e-47
Msa0327110	Msa1403480	0.809419	1.910271e-50	-8.615850e-47
Msa0327110	Msa1410100	0.897805	9.845936e-77	-8.615850e-47
Msa0327110	Msa1419960	0.810341	1.209391e-50	-8.615850e-47
Msa0327110	Msa1427230	0.802025	6.823456e-49	-8.615850e-47
Msa0327110	Msa1443060	0.804082	2.561876e-49	-8.615850e-47
Msa0327110	Msa1451620	-0.801594	8.366445e-49	-8.615850e-47
Msa0327110	Msa1453560	0.806394	8.403310e-50	-8.615850e-47
Msa0327110	Msa1466540	0.813799	2.132159e-51	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0327110	MtrunA17_Chr1g0160961	47.312	93	29	3	1	73	1328	1420	1.22e-14	66.6
Msa0327110	MtrunA17_Chr5g0419891	46.237	93	30	3	1	73	1204	1296	5.57e-13	62.0

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Find 10 sgRNAs with CRISPR-Local

Find 16 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
GAAGCTTTACATGATCTTTA+TGG	0.133014	2_4:-38615888	Msa0327110:CDS
GGAAATACTTGAACAAAATA+TGG	0.213077	2_4:-38615924	Msa0327110:CDS
AATCAAATCACCATAAGATA+TGG	0.411090	2_4:+38615722	None:intergenic
GAAATACTTGAACAAAATAT+GGG	0.498830	2_4:-38615923	Msa0327110:CDS
CGTGATATTTATTGAAGACC+TGG	0.520735	2_4:-38615760	Msa0327110:CDS
GTGAGCTTCTTGATAAGTCA+AGG	0.535389	2_4:-38615866	Msa0327110:intron
TGGCAGAAAACTGCTCTACC+AGG	0.557176	2_4:+38615742	None:intergenic
TACTTGAACAAAATATGGGT+GGG	0.594710	2_4:-38615919	Msa0327110:CDS
ATACTTGAACAAAATATGGG+TGG	0.616313	2_4:-38615920	Msa0327110:CDS
AAATAGAAGTTTCAACATAG+CGG	0.666181	2_4:+38615670	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	CAAAATAAACAAGTTATTTT+GGG	-	chr2_4:38615757-38615776	Msa0327110:CDS	15.0%
!!!	AAAATAAACAAGTTATTTTG+GGG	-	chr2_4:38615758-38615777	Msa0327110:CDS	15.0%
!!	GAAATACTTGAACAAAATAT+GGG	-	chr2_4:38615671-38615690	Msa0327110:CDS	20.0%
!!!	CCAAAATAACTTGTTTATTT+TGG	+	chr2_4:38615759-38615778	None:intergenic	20.0%
!!!	CCAAAATAAACAAGTTATTT+TGG	-	chr2_4:38615756-38615775	Msa0327110:CDS	20.0%
!	GGAAATACTTGAACAAAATA+TGG	-	chr2_4:38615670-38615689	Msa0327110:CDS	25.0%
!	AATCAAATCACCATAAGATA+TGG	+	chr2_4:38615875-38615894	None:intergenic	25.0%
!	AAATAGAAGTTTCAACATAG+CGG	+	chr2_4:38615927-38615946	None:intergenic	25.0%
	ATACTTGAACAAAATATGGG+TGG	-	chr2_4:38615674-38615693	Msa0327110:CDS	30.0%
	TACTTGAACAAAATATGGGT+GGG	-	chr2_4:38615675-38615694	Msa0327110:CDS	30.0%
	GAAGCTTTACATGATCTTTA+TGG	-	chr2_4:38615706-38615725	Msa0327110:CDS	30.0%
!!	ATGGTGATTTGATTTTTGCT+CGG	-	chr2_4:38615881-38615900	Msa0327110:CDS	30.0%
	CGTGATATTTATTGAAGACC+TGG	-	chr2_4:38615834-38615853	Msa0327110:intron	35.0%
!	CAGTTTTCTGCCATATCTTA+TGG	-	chr2_4:38615862-38615881	Msa0327110:intron	35.0%
	GTGAGCTTCTTGATAAGTCA+AGG	-	chr2_4:38615728-38615747	Msa0327110:CDS	40.0%
	TGGCAGAAAACTGCTCTACC+AGG	+	chr2_4:38615855-38615874	None:intergenic	50.0%

Chromosome	Type	Strat	End	Strand	Name
chr2_4	gene	38615668	38615948	38615668	ID=Msa0327110;Name=Msa0327110
chr2_4	mRNA	38615668	38615948	38615668	ID=Msa0327110-mRNA-1;Parent=Msa0327110;Name=Msa0327110-mRNA-1;_AED=0.48;_eAED=0.48;_QI=0\|0\|0\|1\|0\|0\|2\|0\|73
chr2_4	exon	38615867	38615948	38615867	ID=Msa0327110-mRNA-1:exon:11611;Parent=Msa0327110-mRNA-1
chr2_4	exon	38615668	38615807	38615668	ID=Msa0327110-mRNA-1:exon:11610;Parent=Msa0327110-mRNA-1
chr2_4	CDS	38615867	38615948	38615867	ID=Msa0327110-mRNA-1:cds;Parent=Msa0327110-mRNA-1
chr2_4	CDS	38615668	38615807	38615668	ID=Msa0327110-mRNA-1:cds;Parent=Msa0327110-mRNA-1

Gene Sequence	>Msa0327110 ATGGAAATACTTGAACAAAATATGGGTGGGATACTTTTGAAGCTTTACATGATCTTTATGGTGAGCTTCTTGATAAGTCAAGATTCAAATTCGAGATTCACGAGTTACGTGATATTTATTGAAGACCTGGTAGAGCAGTTTTCTGCCATATCTTATGGTGATTTGATTTTTGCTCGGAAAATTTCACTATATTTACACCGCTATGTTGAAACTTCTATTTAA
Protein sequence	>Msa0327110 MEILEQNMGGILLKLYMIFMVSFLISQDSNSRFTSYVIFIEDLVEQFSAISYGDLIFARKISLYLHRYVETSI*