AlfalfaGEDB | Msa0931200

M. sativa cultivar zhongmu-4 / Msa0931200

KEGG: K02710|K02712
GO: GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0009536 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044424 GO:0044444 GO:0044464
PFAM: PF02533.18

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0931200	RDY14692.1	90.722	97	9	0	1	97	4	100	7.75e-56	178

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0931200	sp\|Q49L15\|PSBK_EUCGG	91.667	60	5	0	1	60	1	60	1.80e-32	110

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0017120	Msa0931200	0.802801	4.722299e-49	-8.615850e-47
Msa0095200	Msa0931200	0.803331	3.669193e-49	-8.615850e-47
Msa0681890	Msa0931200	0.800344	1.506238e-48	-8.615850e-47
Msa0772210	Msa0931200	0.803817	2.908911e-49	-8.615850e-47
Msa0222070	Msa0931200	0.803751	3.001341e-49	-8.615850e-47
Msa0222120	Msa0931200	0.801948	7.076840e-49	-8.615850e-47
Msa0263620	Msa0931200	0.800234	1.585505e-48	-8.615850e-47
Msa0268180	Msa0931200	0.852766	3.720589e-61	-8.615850e-47
Msa0268380	Msa0931200	0.828130	1.066967e-54	-8.615850e-47
Msa0268420	Msa0931200	0.857912	1.181285e-62	-8.615850e-47
Msa0268540	Msa0931200	0.847471	1.132465e-59	-8.615850e-47
Msa0268650	Msa0931200	0.836520	8.919508e-57	-8.615850e-47
Msa0268730	Msa0931200	0.858845	6.226973e-63	-8.615850e-47
Msa0268850	Msa0931200	0.847768	9.384952e-60	-8.615850e-47
Msa0268930	Msa0931200	0.851458	8.759450e-61	-8.615850e-47
Msa0269060	Msa0931200	0.852425	4.655694e-61	-8.615850e-47
Msa0344200	Msa0931200	0.804719	1.887804e-49	-8.615850e-47
Msa0344290	Msa0931200	0.800545	1.370599e-48	-8.615850e-47
Msa0524090	Msa0931200	0.808597	2.864072e-50	-8.615850e-47
Msa0582530	Msa0931200	0.828316	9.620602e-55	-8.615850e-47
Msa0582620	Msa0931200	0.863210	2.928610e-64	-8.615850e-47
Msa0582710	Msa0931200	0.815512	8.900336e-52	-8.615850e-47
Msa0582740	Msa0931200	0.862520	4.781872e-64	-8.615850e-47
Msa0582830	Msa0931200	0.804459	2.138933e-49	-8.615850e-47
Msa0582900	Msa0931200	0.848722	5.112412e-60	-8.615850e-47
Msa0900320	Msa0931200	0.802883	4.540420e-49	-8.615850e-47
Msa0924860	Msa0931200	0.853722	1.980662e-61	-8.615850e-47
Msa0931090	Msa0931200	0.841728	3.983850e-58	-8.615850e-47
Msa0931150	Msa0931200	0.813473	2.514008e-51	-8.615850e-47
Msa0931200	Msa0958020	0.804310	2.296735e-49	-8.615850e-47
Msa0931200	Msa0965960	0.804006	2.656812e-49	-8.615850e-47
Msa0931200	Msa0983710	0.812718	3.682331e-51	-8.615850e-47
Msa0931200	Msa0992570	0.815161	1.065332e-51	-8.615850e-47
Msa0931200	Msa0992590	0.805263	1.452488e-49	-8.615850e-47
Msa0931200	Msa1002040	0.823102	1.659710e-53	-8.615850e-47
Msa0931200	Msa1030280	0.808402	3.151629e-50	-8.615850e-47
Msa0931200	Msa1086060	0.836281	1.026142e-56	-8.615850e-47
Msa0931200	Msa1086160	0.811410	7.097971e-51	-8.615850e-47
Msa0931200	Msa1086170	0.862036	6.733390e-64	-8.615850e-47
Msa0931200	Msa1086290	0.835655	1.478815e-56	-8.615850e-47
Msa0931200	Msa1086370	0.848844	4.730935e-60	-8.615850e-47
Msa0931200	Msa1086440	0.808664	2.770878e-50	-8.615850e-47
Msa0931200	Msa1086480	0.812875	3.402490e-51	-8.615850e-47
Msa0931200	Msa1086870	0.843128	1.695211e-58	-8.615850e-47
Msa0931200	Msa1091690	0.824484	7.872475e-54	-8.615850e-47
Msa0931200	Msa1143140	0.846655	1.895459e-59	-8.615850e-47
Msa0931200	Msa1143150	0.821930	3.107607e-53	-8.615850e-47
Msa0931200	Msa1327820	0.802959	4.380278e-49	-8.615850e-47
Msa0931200	Msa1354890	0.870878	1.046013e-66	-8.615850e-47
Msa0931200	Msa1355060	0.861009	1.386452e-63	-8.615850e-47
Msa0931200	Msa1380580	0.816202	6.244570e-52	-8.615850e-47
Msa0931200	Msa1394050	0.814484	1.505065e-51	-8.615850e-47
Msa0931200	Msa1394140	0.854613	1.095517e-61	-8.615850e-47
Msa0931200	Msa1394240	0.833607	4.839379e-56	-8.615850e-47
Msa0931200	Msa1422750	0.801207	1.004057e-48	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	q. start	q. end	s. start	s. end	e-value	bit score
Msa0931200	MtrunA17_Chr4g0015681	96.667	60	2	1	60	1	60	7.64e-35	113
Msa0931200	MtrunA17_CPg0492901	96.667	60	2	1	60	1	60	7.64e-35	113
Msa0931200	MtrunA17_Chr4g0016771	96.667	60	2	1	60	1	60	7.64e-35	113

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0931200	ATCG00070.1	76.667	60	14	0	1	60	1	60	3.76e-26	92.0
Msa0931200	ATCG00080.1	97.222	36	1	0	62	97	1	36	2.92e-19	73.9

Find 6 sgRNAs with CRISPR-Local

Find 30 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TATGCTTAATATCTTTAGCT+TGG	0.440922	6_2:+80380496	None:intergenic
ACTGGCATAAAATCTACAAT+TGG	0.453871	6_2:-80380599	None:intergenic
AATGATCCAGGACGTAATCC+TGG	0.474800	6_2:+80381146	Msa0931200:CDS
GGATTCCTATCTAATGATCC+AGG	0.536202	6_2:+80381134	Msa0931200:CDS
TCACGTCCAGGATTACGTCC+TGG	0.548081	6_2:-80381152	None:intergenic
TACGTCCTGGATCATTAGAT+AGG	0.581605	6_2:-80381139	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	ATTCCAAATATTAAAATTTT+TGG	+	chr6_2:80380786-80380805	Msa0931200:intron	10.0%
!!!	TATCCAAAAATTTTAATATT+TGG	-	chr6_2:80380792-80380811	None:intergenic	10.0%
!!	ATTTCAAAAAAAAAAAACTT+AGG	-	chr6_2:80380943-80380962	None:intergenic	10.0%
!!!	AATTTTAATATTTGGAATCA+AGG	-	chr6_2:80380784-80380803	None:intergenic	15.0%
!!!	CGTTTTTTTTTTAATTATCT+TGG	+	chr6_2:80381038-80381057	Msa0931200:intron	15.0%
!!	GAAAAAACTACTTGAATAAA+GGG	-	chr6_2:80380543-80380562	None:intergenic	20.0%
!!	AGAAAAAACTACTTGAATAA+AGG	-	chr6_2:80380544-80380563	None:intergenic	20.0%
!!!	TTATTCAAGTAGTTTTTTCT+TGG	+	chr6_2:80380544-80380563	Msa0931200:CDS	20.0%
!!	TGAAAATTCTATTATTCGAT+TGG	+	chr6_2:80380830-80380849	Msa0931200:intron	20.0%
!!!	TGTGGATATGAAAAAAATTT+TGG	+	chr6_2:80380881-80380900	Msa0931200:intron	20.0%
!!	TCTTATAAACTTAGTATCAA+AGG	+	chr6_2:80380972-80380991	Msa0931200:intron	20.0%
!!!	TTTTTCTCTTAGCTTTTGTT+TGG	+	chr6_2:80380636-80380655	Msa0931200:CDS	25.0%
!!!	TTTGTTTCTCTTTTCATCTT+CGG	+	chr6_2:80381113-80381132	Msa0931200:CDS	25.0%
!	AATTGGATTCAAAAAAGCGT+AGG	-	chr6_2:80380585-80380604	None:intergenic	30.0%
	ACTGGCATAAAATCTACAAT+TGG	-	chr6_2:80380602-80380621	None:intergenic	30.0%
!!	AAAAAGAGTAAGGGTATTAC+TGG	-	chr6_2:80380620-80380639	None:intergenic	30.0%
	GCTAAGAGAAAAAAGAGTAA+GGG	-	chr6_2:80380629-80380648	None:intergenic	30.0%
	AGCTAAGAGAAAAAAGAGTA+AGG	-	chr6_2:80380630-80380649	None:intergenic	30.0%
!!	AATCAAGATCTAGGTATTGG+TGG	-	chr6_2:80380862-80380881	None:intergenic	35.0%
	CACAATCAAGATCTAGGTAT+TGG	-	chr6_2:80380865-80380884	None:intergenic	35.0%
	CAATACCTAGATCTTGATTG+TGG	+	chr6_2:80380863-80380882	Msa0931200:intron	35.0%
	CATATCCACAATCAAGATCT+AGG	-	chr6_2:80380871-80380890	None:intergenic	35.0%
	GAGAATCTATTCTCTTTCTC+TGG	+	chr6_2:80381015-80381034	Msa0931200:intron	35.0%
!	TTCAAAAAAGCGTAGGCTTC+AGG	-	chr6_2:80380578-80380597	None:intergenic	40.0%
	GGATTCCTATCTAATGATCC+AGG	+	chr6_2:80381134-80381153	Msa0931200:CDS	40.0%
	TACGTCCTGGATCATTAGAT+AGG	-	chr6_2:80381142-80381161	None:intergenic	40.0%
!!	CAAGATCTAGGTATTGGTGG+TGG	-	chr6_2:80380859-80380878	None:intergenic	45.0%
	AATGATCCAGGACGTAATCC+TGG	+	chr6_2:80381146-80381165	Msa0931200:CDS	45.0%
!!!	AATAAATTCTTAATTTTTTT+CGG	-	chr6_2:80380707-80380726	None:intergenic	5.0%
	TCACGTCCAGGATTACGTCC+TGG	-	chr6_2:80381155-80381174	None:intergenic	55.0%

Chromosome	Type	Strat	End	Strand	Name
chr6_2	gene	80380497	80381181	80380497	ID=Msa0931200;Name=Msa0931200
chr6_2	mRNA	80380497	80381181	80380497	ID=Msa0931200-mRNA-1;Parent=Msa0931200;Name=Msa0931200-mRNA-1;_AED=0.46;_eAED=0.46;_QI=0\|0\|0\|1\|0\|0\|2\|0\|97
chr6_2	exon	80380497	80380671	80380497	ID=Msa0931200-mRNA-1:exon:14073;Parent=Msa0931200-mRNA-1
chr6_2	exon	80381063	80381181	80381063	ID=Msa0931200-mRNA-1:exon:14074;Parent=Msa0931200-mRNA-1
chr6_2	CDS	80380497	80380671	80380497	ID=Msa0931200-mRNA-1:cds;Parent=Msa0931200-mRNA-1
chr6_2	CDS	80381063	80381181	80381063	ID=Msa0931200-mRNA-1:cds;Parent=Msa0931200-mRNA-1

Gene Sequence	>Msa0931200 ATGCTTAATATCTTTAGCTTGGTCTGTATTTGTATTGACTCTGCCCTTTATTCAAGTAGTTTTTTCTTGGCAAAATTACCTGAAGCCTACGCTTTTTTGAATCCAATTGTAGATTTTATGCCAGTAATACCCTTACTCTTTTTTCTCTTAGCTTTTGTTTGGCAAGCTGCTGTAAATTTTGTAATGCTTACTCTAAAACTATTTGTTTACACGATAGTGATATTCTTTGTTTCTCTTTTCATCTTCGGATTCCTATCTAATGATCCAGGACGTAATCCTGGACGTGAAGAATAA
Protein sequence	>Msa0931200 MLNIFSLVCICIDSALYSSSFFLAKLPEAYAFLNPIVDFMPVIPLLFFLLAFVWQAAVNFVMLTLKLFVYTIVIFFVSLFIFGFLSNDPGRNPGREE*