AlfalfaGEDB | Msa0748000

M. sativa cultivar zhongmu-4 / Msa0748000

KEGG: -
GO: -
PFAM: -

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0748000	G7IAC0	93.827	81	5	0	1	81	1	81	1.91e-49	159

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0006980	Msa0748000	0.806243	9.042031e-50	-8.615850e-47
Msa0016120	Msa0748000	0.801798	7.595906e-49	-8.615850e-47
Msa0080910	Msa0748000	0.804088	2.555231e-49	-8.615850e-47
Msa0080990	Msa0748000	0.999706	0.000000e+00	-8.615850e-47
Msa0109880	Msa0748000	0.819995	8.664876e-53	-8.615850e-47
Msa0641360	Msa0748000	0.807169	5.763596e-50	-8.615850e-47
Msa0669840	Msa0748000	0.805915	1.059972e-49	-8.615850e-47
Msa0682530	Msa0748000	0.812426	4.264315e-51	-8.615850e-47
Msa0739580	Msa0748000	0.840895	6.602129e-58	-8.615850e-47
Msa0748000	Msa0782360	0.811367	7.252945e-51	-8.615850e-47
Msa0748000	Msa0828830	0.821885	3.182759e-53	-8.615850e-47
Msa0748000	Msa0860280	0.822989	1.763242e-53	-8.615850e-47
Msa0748000	Msa0929870	0.815801	7.673728e-52	-8.615850e-47
Msa0748000	Msa0999300	0.848521	5.813869e-60	-8.615850e-47
Msa0748000	Msa0999350	0.822904	1.845582e-53	-8.615850e-47
Msa0748000	Msa0999360	0.808404	3.148892e-50	-8.615850e-47
Msa0748000	Msa0999400	0.814873	1.234349e-51	-8.615850e-47
Msa0748000	Msa0999410	0.812223	4.723882e-51	-8.615850e-47
Msa0748000	Msa1001890	0.831520	1.593606e-55	-8.615850e-47
Msa0748000	Msa1034680	0.808890	2.479655e-50	-8.615850e-47
Msa0748000	Msa1037770	0.804039	2.614934e-49	-8.615850e-47
Msa0748000	Msa1176160	0.818262	2.148491e-52	-8.615850e-47
Msa0748000	Msa1201160	0.809324	2.002129e-50	-8.615850e-47
Msa0748000	Msa1228190	0.872983	2.089813e-67	-8.615850e-47
Msa0748000	Msa1271260	0.847446	1.150392e-59	-8.615850e-47
Msa0748000	Msa1277400	0.809443	1.887502e-50	-8.615850e-47
Msa0748000	Msa1294290	0.813829	2.099184e-51	-8.615850e-47
Msa0748000	Msa1305310	0.802889	4.527654e-49	-8.615850e-47
Msa0748000	Msa1307150	0.800583	1.346555e-48	-8.615850e-47
Msa0748000	Msa1307190	0.822696	2.063731e-53	-8.615850e-47
Msa0748000	Msa1339580	0.961040	3.041946e-119	-8.615850e-47
Msa0748000	Msa1356990	0.971334	5.323593e-133	-8.615850e-47
Msa0748000	Msa1379970	0.852337	4.931672e-61	-8.615850e-47
Msa0748000	Msa1406780	0.832685	8.207505e-56	-8.615850e-47
Msa0748000	Msa1421550	0.840410	8.841726e-58	-8.615850e-47
Msa0748000	Msa1424690	0.808751	2.655842e-50	-8.615850e-47
Msa0748000	Msa1431850	0.841417	4.812909e-58	-8.615850e-47
Msa0748000	Msa1437700	0.815821	7.595959e-52	-8.615850e-47
Msa0748000	Msa1442630	0.808657	2.780632e-50	-8.615850e-47
Msa0748000	Msa1443140	0.823997	1.024737e-53	-8.615850e-47
Msa0748000	Msa1449940	0.808966	2.388755e-50	-8.615850e-47
Msa0124130	Msa0748000	0.830063	3.625935e-55	-8.615850e-47
Msa0149140	Msa0748000	0.812075	5.087164e-51	-8.615850e-47
Msa0156250	Msa0748000	0.832105	1.142888e-55	-8.615850e-47
Msa0212150	Msa0748000	0.843402	1.432335e-58	-8.615850e-47
Msa0221290	Msa0748000	0.816124	6.501767e-52	-8.615850e-47
Msa0236110	Msa0748000	0.800099	1.689207e-48	-8.615850e-47
Msa0406000	Msa0748000	0.836178	1.089595e-56	-8.615850e-47
Msa0424340	Msa0748000	0.802314	5.948695e-49	-8.615850e-47
Msa0451400	Msa0748000	0.836549	8.768733e-57	-8.615850e-47
Msa0252770	Msa0748000	0.864747	9.732568e-65	-8.615850e-47
Msa0276080	Msa0748000	0.818880	1.556049e-52	-8.615850e-47
Msa0289920	Msa0748000	0.837150	6.157935e-57	-8.615850e-47
Msa0306120	Msa0748000	0.844476	7.382536e-59	-8.615850e-47
Msa0314630	Msa0748000	0.804296	2.312740e-49	-8.615850e-47
Msa0329620	Msa0748000	0.883616	3.858319e-71	-8.615850e-47
Msa0359250	Msa0748000	0.837589	4.753491e-57	-8.615850e-47
Msa0492190	Msa0748000	0.821766	3.390961e-53	-8.615850e-47
Msa0575740	Msa0748000	0.814860	1.242243e-51	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0748000	MtrunA17_Chr1g0193271	80.723	83	14	1	1	81	1	83	7.35e-43	134
Msa0748000	MtrunA17_Chr1g0193251	83.750	80	13	0	2	81	4	83	5.68e-36	116
Msa0748000	MtrunA17_Chr7g0271321	48.101	79	38	2	1	76	1	79	4.12e-19	73.9
Msa0748000	MtrunA17_Chr1g0193261	56.923	65	22	3	15	73	18	82	2.23e-17	69.7
Msa0748000	MtrunA17_Chr1g0193231	56.923	65	22	3	15	73	18	82	2.25e-17	69.7
Msa0748000	MtrunA17_Chr1g0193301	56.923	65	22	3	15	73	19	83	2.63e-17	69.7
Msa0748000	MtrunA17_Chr1g0193291	59.016	61	20	3	18	73	20	80	1.01e-15	65.5

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0748000	AT3G05858.1	45.882	85	39	4	1	79	1	84	2.57e-12	57.4

Find 16 sgRNAs with CRISPR-Local

Find 13 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
GTGATGAAGACAAAGGTAAC+TGG	0.348340	5_2:+958801	Msa0748000:CDS
GGTAAGACTAAGTCTTCTTC+AGG	0.365971	5_2:+958692	Msa0748000:CDS
TCAGCTCTCATGTTAATGTT+AGG	0.378896	5_2:-958836	None:intergenic
AAACTCGATTCTTGTATTTG+CGG	0.401356	5_2:-958868	None:intergenic
TGGATCAACTTCATAGCGTT+CGG	0.459202	5_2:-958897	None:intergenic
TTACCTTTGTCTTCATCACT+AGG	0.502543	5_2:-958797	None:intergenic
TATTATGCATTCTAGACCGC+TGG	0.510025	5_2:-958917	None:intergenic
TCAAAGAATAAGTCTAGAGC+AGG	0.540317	5_2:+958743	Msa0748000:CDS
TGATGAAGACAAAGGTAACT+GGG	0.585582	5_2:+958802	Msa0748000:CDS
GCATTAATCATCATGGGAGG+TGG	0.588766	5_2:+958671	None:intergenic
GCAGGATACTATGATGATTG+CGG	0.626514	5_2:+958761	Msa0748000:CDS
ATGATTGCGGATGCAAGACA+TGG	0.656100	5_2:+958774	Msa0748000:CDS
ACGCTATGAAGTTGATCCAG+CGG	0.687155	5_2:+958901	Msa0748000:CDS
TGGCCTAGTGATGAAGACAA+AGG	0.708445	5_2:+958794	Msa0748000:CDS
GCAGCATTAATCATCATGGG+AGG	0.708531	5_2:+958668	None:intergenic
GATGAAGACAAAGGTAACTG+GGG	0.719672	5_2:+958803	Msa0748000:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
	AAACTCGATTCTTGTATTTG+CGG	-	chr5_2:958871-958890	None:intergenic	30.0%
!	TCAAAGAATAAGTCTAGAGC+AGG	+	chr5_2:958743-958762	Msa0748000:CDS	35.0%
	TTACCTTTGTCTTCATCACT+AGG	-	chr5_2:958800-958819	None:intergenic	35.0%
	TGATGAAGACAAAGGTAACT+GGG	+	chr5_2:958802-958821	Msa0748000:CDS	35.0%
	TCAGCTCTCATGTTAATGTT+AGG	-	chr5_2:958839-958858	None:intergenic	35.0%
	GGTAAGACTAAGTCTTCTTC+AGG	+	chr5_2:958692-958711	Msa0748000:CDS	40.0%
	GCAGGATACTATGATGATTG+CGG	+	chr5_2:958761-958780	Msa0748000:CDS	40.0%
	GTGATGAAGACAAAGGTAAC+TGG	+	chr5_2:958801-958820	Msa0748000:CDS	40.0%
	GATGAAGACAAAGGTAACTG+GGG	+	chr5_2:958803-958822	Msa0748000:CDS	40.0%
	TGGATCAACTTCATAGCGTT+CGG	-	chr5_2:958900-958919	None:intergenic	40.0%
	ATGATTGCGGATGCAAGACA+TGG	+	chr5_2:958774-958793	Msa0748000:CDS	45.0%
	TGGCCTAGTGATGAAGACAA+AGG	+	chr5_2:958794-958813	Msa0748000:CDS	45.0%
!	ACGCTATGAAGTTGATCCAG+CGG	+	chr5_2:958901-958920	Msa0748000:CDS	45.0%

Chromosome	Type	Strat	End	Strand	Name
chr5_2	gene	958683	958928	958683	ID=Msa0748000;Name=Msa0748000
chr5_2	mRNA	958683	958928	958683	ID=Msa0748000-mRNA-1;Parent=Msa0748000;Name=Msa0748000-mRNA-1;_AED=0.39;_eAED=0.39;_QI=0\|-1\|0\|1\|-1\|1\|1\|0\|81
chr5_2	exon	958683	958928	958683	ID=Msa0748000-mRNA-1:exon:238;Parent=Msa0748000-mRNA-1
chr5_2	CDS	958683	958928	958683	ID=Msa0748000-mRNA-1:cds;Parent=Msa0748000-mRNA-1

Gene Sequence	>Msa0748000 ATGGGAGGTGGTAAGACTAAGTCTTCTTCAGGTTTCTTCTCAATTTTCAAAATCTTCAAATCAAAGAATAAGTCTAGAGCAGGATACTATGATGATTGCGGATGCAAGACATGGCCTAGTGATGAAGACAAAGGTAACTGGGGTGTTGCTGAGCCTAACATTAACATGAGAGCTGAAGATTTCATCCGCAAATACAAGAATCGAGTTTCAGAATCCGAACGCTATGAAGTTGATCCAGCGGTCTAG
Protein sequence	>Msa0748000 MGGGKTKSSSGFFSIFKIFKSKNKSRAGYYDDCGCKTWPSDEDKGNWGVAEPNINMRAEDFIRKYKNRVSESERYEVDPAV*