AlfalfaGEDB | Msa0741570

M. sativa cultivar zhongmu-4 / Msa0741570

KEGG: K14963
GO: GO:0000003 GO:0001101 GO:0003002 GO:0003006 GO:0003674 GO:0005488 GO:0005515 GO:0005575 GO:0005622 GO:0005623 GO:0005634 GO:0005737 GO:0005829 GO:0006355 GO:0007154 GO:0007165 GO:0007275 GO:0007389 GO:0008150 GO:0009653 GO:0009719 GO:0009725 GO:0009733 GO:0009753 GO:0009755 GO:0009790 GO:0009791 GO:0009793 GO:0009867 GO:0009888 GO:0009889 GO:0009890 GO:0009892 GO:0009933 GO:0009987 GO:0010014 GO:0010016 GO:0010033 GO:0010051 GO:0010072 GO:0010154 GO:0010468 GO:0010556 GO:0010558 GO:0010605 GO:0010629 GO:0019219 GO:0019222 GO:0022414 GO:0023052 GO:0031323 GO:0031324 GO:0031326 GO:0031327 GO:0032501 GO:0032502 GO:0032870 GO:0042221 GO:0042802 GO:0042803 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044424 GO:0044444 GO:0044464 GO:0045892 GO:0045934 GO:0046983 GO:0048316 GO:0048367 GO:0048507 GO:0048508 GO:0048519 GO:0048523 GO:0048532 GO:0048608 GO:0048731 GO:0048856 GO:0050789 GO:0050794 GO:0050896 GO:0051171 GO:0051172 GO:0051252 GO:0051253 GO:0051716 GO:0060255 GO:0061458 GO:0065007 GO:0070887 GO:0071229 GO:0071310 GO:0071395 GO:0071495 GO:0080090 GO:0090421 GO:1901700 GO:1901701 GO:1902679 GO:1903506 GO:1903507 GO:2000112 GO:2000113 GO:2001141
PFAM: -

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0741570	XP_040995868.1	91.026	78	7	0	1	78	31	108	1.01e-41	142

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0741570	sp\|Q10NY2\|TPR3_ORYSJ	89.744	78	8	0	1	78	100	177	2.52e-41	145

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0741570	A0A2I0HSB2	91.026	78	7	0	1	78	100	177	1.18e-41	143

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0112750	Msa0741570	0.810501	1.117323e-50	-8.615850e-47
Msa0114060	Msa0741570	0.801049	1.081718e-48	-8.615850e-47
Msa0119960	Msa0741570	0.804728	1.879076e-49	-8.615850e-47
Msa0627410	Msa0741570	0.839691	1.361716e-57	-8.615850e-47
Msa0657970	Msa0741570	0.829957	3.848903e-55	-8.615850e-47
Msa0696640	Msa0741570	0.802500	5.448660e-49	-8.615850e-47
Msa0697060	Msa0741570	0.824876	6.364933e-54	-8.615850e-47
Msa0741570	Msa0760130	0.821114	4.794640e-53	-8.615850e-47
Msa0741570	Msa0762360	0.811921	5.496788e-51	-8.615850e-47
Msa0741570	Msa0766630	0.815236	1.025127e-51	-8.615850e-47
Msa0741570	Msa0804880	0.802701	4.952554e-49	-8.615850e-47
Msa0741570	Msa0806090	0.800545	1.370512e-48	-8.615850e-47
Msa0741570	Msa0811080	0.806199	9.236736e-50	-8.615850e-47
Msa0741570	Msa0822650	0.931602	2.961290e-94	-8.615850e-47
Msa0741570	Msa0885280	0.829346	5.419880e-55	-8.615850e-47
Msa0741570	Msa0885290	0.860427	2.081090e-63	-8.615850e-47
Msa0741570	Msa0886750	0.803463	3.444241e-49	-8.615850e-47
Msa0741570	Msa0887990	0.841105	5.814328e-58	-8.615850e-47
Msa0741570	Msa0898380	0.812715	3.686695e-51	-8.615850e-47
Msa0741570	Msa0922720	0.802290	6.019289e-49	-8.615850e-47
Msa0741570	Msa0927290	0.809251	2.075174e-50	-8.615850e-47
Msa0741570	Msa0954910	0.806493	8.008135e-50	-8.615850e-47
Msa0741570	Msa0954920	0.808958	2.397789e-50	-8.615850e-47
Msa0741570	Msa0965750	0.810367	1.194152e-50	-8.615850e-47
Msa0741570	Msa0990350	0.800705	1.271564e-48	-8.615850e-47
Msa0741570	Msa1059570	0.810634	1.045578e-50	-8.615850e-47
Msa0741570	Msa1071110	0.807510	4.879254e-50	-8.615850e-47
Msa0741570	Msa1077870	0.800863	1.180348e-48	-8.615850e-47
Msa0741570	Msa1082500	0.832200	1.082576e-55	-8.615850e-47
Msa0741570	Msa1084240	0.825972	3.501607e-54	-8.615850e-47
Msa0741570	Msa1092990	0.800024	1.749982e-48	-8.615850e-47
Msa0741570	Msa1098400	0.800307	1.532567e-48	-8.615850e-47
Msa0741570	Msa1116260	0.820060	8.371941e-53	-8.615850e-47
Msa0741570	Msa1137690	0.803907	2.786402e-49	-8.615850e-47
Msa0741570	Msa1148020	0.806691	7.272855e-50	-8.615850e-47
Msa0741570	Msa1160670	0.830804	2.389487e-55	-8.615850e-47
Msa0741570	Msa1160690	0.818209	2.208480e-52	-8.615850e-47
Msa0741570	Msa1178720	0.819077	1.403587e-52	-8.615850e-47
Msa0741570	Msa1187940	0.819231	1.294882e-52	-8.615850e-47
Msa0741570	Msa1187950	0.810956	8.905173e-51	-8.615850e-47
Msa0741570	Msa1397610	0.838123	3.466547e-57	-8.615850e-47
Msa0741570	Msa1411020	0.817590	3.047973e-52	-8.615850e-47
Msa0741570	Msa1420140	0.811339	7.357673e-51	-8.615850e-47
Msa0741570	Msa1420490	0.816201	6.246743e-52	-8.615850e-47
Msa0741570	Msa1423390	0.817547	3.116409e-52	-8.615850e-47
Msa0741570	Msa1424290	0.816142	6.439916e-52	-8.615850e-47
Msa0741570	Msa1425100	0.812013	5.248034e-51	-8.615850e-47
Msa0741570	Msa1434350	0.815478	9.055543e-52	-8.615850e-47
Msa0741570	Msa1438250	0.809622	1.727339e-50	-8.615850e-47
Msa0741570	Msa1439320	0.817151	3.825922e-52	-8.615850e-47
Msa0741570	Msa1440370	0.816099	6.585639e-52	-8.615850e-47
Msa0741570	Msa1440810	0.815398	9.437164e-52	-8.615850e-47
Msa0142220	Msa0741570	0.810000	1.432756e-50	-8.615850e-47
Msa0153910	Msa0741570	0.804526	2.071220e-49	-8.615850e-47
Msa0203500	Msa0741570	0.804951	1.688320e-49	-8.615850e-47
Msa0220580	Msa0741570	0.806146	9.475963e-50	-8.615850e-47
Msa0233300	Msa0741570	0.807612	4.643312e-50	-8.615850e-47
Msa0379640	Msa0741570	0.803111	4.074378e-49	-8.615850e-47
Msa0406120	Msa0741570	0.802298	5.995104e-49	-8.615850e-47
Msa0431500	Msa0741570	0.816248	6.100126e-52	-8.615850e-47
Msa0432290	Msa0741570	0.818417	1.981434e-52	-8.615850e-47
Msa0456200	Msa0741570	0.834824	2.397300e-56	-8.615850e-47
Msa0456840	Msa0741570	0.803306	3.712280e-49	-8.615850e-47
Msa0270520	Msa0741570	0.815779	7.760647e-52	-8.615850e-47
Msa0326200	Msa0741570	0.844260	8.441653e-59	-8.615850e-47
Msa0353190	Msa0741570	0.856053	4.173081e-62	-8.615850e-47
Msa0353690	Msa0741570	0.820184	7.843439e-53	-8.615850e-47
Msa0363300	Msa0741570	0.813846	2.081108e-51	-8.615850e-47
Msa0484780	Msa0741570	0.816796	4.596428e-52	-8.615850e-47
Msa0502270	Msa0741570	0.813086	3.058728e-51	-8.615850e-47
Msa0512890	Msa0741570	0.805853	1.092107e-49	-8.615850e-47
Msa0512900	Msa0741570	0.823646	1.237997e-53	-8.615850e-47
Msa0532350	Msa0741570	0.818913	1.529313e-52	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0741570	MtrunA17_Chr4g0003011	92.308	78	6	0	1	78	100	177	1.21e-43	149
Msa0741570	MtrunA17_Chr2g0333311	91.026	78	7	0	1	78	100	177	6.95e-43	147
Msa0741570	MtrunA17_Chr4g0064101	84.615	78	12	0	1	78	100	177	4.21e-40	139
Msa0741570	MtrunA17_Chr7g0271991	80.769	78	15	0	1	78	100	177	4.37e-38	133
Msa0741570	MtrunA17_Chr1g0192431	79.487	78	16	0	1	78	100	177	8.63e-38	132
Msa0741570	MtrunA17_Chr4g0067791	80.769	78	15	0	1	78	100	177	1.36e-36	129
Msa0741570	MtrunA17_Chr2g0295261	47.436	78	41	0	1	78	31	108	3.14e-19	77.8
Msa0741570	MtrunA17_Chr2g0310451	44.872	78	43	0	1	78	76	153	4.38e-19	77.8
Msa0741570	MtrunA17_Chr1g0149531	45.455	77	42	0	1	77	34	110	1.68e-18	73.2
Msa0741570	MtrunA17_Chr2g0295291	44.872	78	31	1	1	78	35	100	3.05e-15	64.3
Msa0741570	MtrunA17_Chr1g0153401	38.462	78	48	0	1	78	102	179	1.20e-12	59.7
Msa0741570	MtrunA17_Chr2g0295351	50.943	53	26	0	26	78	93	145	1.00e-11	58.5

Query id	Subject id	identity %	alignment length	mismatches	q. start	q. end	s. start	s. end	e-value	bit score
Msa0741570	AT1G15750.3	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0741570	AT1G15750.1	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0741570	AT1G15750.2	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0741570	AT1G15750.4	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0741570	AT1G80490.1	87.179	78	10	1	78	100	177	4.57e-41	142
Msa0741570	AT1G80490.3	87.179	78	10	1	78	100	177	4.57e-41	142
Msa0741570	AT1G80490.2	87.179	78	10	1	78	100	177	4.57e-41	142
Msa0741570	AT3G15880.3	83.333	78	13	1	78	100	177	3.31e-39	137
Msa0741570	AT3G15880.2	83.333	78	13	1	78	100	177	3.31e-39	137
Msa0741570	AT3G15880.1	83.333	78	13	1	78	100	177	3.41e-39	137
Msa0741570	AT3G15880.4	83.333	78	13	1	78	100	177	3.41e-39	137
Msa0741570	AT3G16830.1	80.769	78	15	1	78	100	177	3.21e-37	131
Msa0741570	AT5G27030.2	78.205	78	17	1	78	100	177	4.05e-37	131
Msa0741570	AT5G27030.1	78.205	78	17	1	78	100	177	8.72e-37	130

Find 9 sgRNAs with CRISPR-Local

Find 18 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TGCAATTTGTCATGAAATAA+TGG	0.221024	5_1:-61287924	None:intergenic
AATGAACAGTTGTCAAAGTA+TGG	0.361823	5_1:+61287840	Msa0741570:CDS
GTTTAATAAAGAATTGTTCA+AGG	0.463922	5_1:+61287696	Msa0741570:CDS
TTTGTCATGAAATAATGGAT+TGG	0.485562	5_1:-61287919	None:intergenic
GTCTGCGCGGGCAGTCATGT+TGG	0.522666	5_1:+61287872	Msa0741570:CDS
AATCGCACAGCTATTGACAT+TGG	0.587279	5_1:+61287720	Msa0741570:CDS
TGGTGATACTAAGTCTGCGC+GGG	0.592019	5_1:+61287860	Msa0741570:CDS
TAAGGACACTCATCAATCAA+AGG	0.619686	5_1:+61287973	Msa0741570:CDS
ATGGTGATACTAAGTCTGCG+CGG	0.743006	5_1:+61287859	Msa0741570:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	GTTTAATAAAGAATTGTTCA+AGG	+	chr5_1:61287696-61287715	Msa0741570:CDS	20.0%
!!	TATTGACATTGGAGAATTTT+AGG	+	chr5_1:61287731-61287750	Msa0741570:CDS	25.0%
!	ACATCTTACAAACTGAAAAT+AGG	-	chr5_1:61287790-61287809	None:intergenic	25.0%
!	TAATAATAACCCAAACTCAA+TGG	-	chr5_1:61287815-61287834	None:intergenic	25.0%
!!	ATTGAGTTTGGGTTATTATT+AGG	+	chr5_1:61287814-61287833	Msa0741570:intron	25.0%
!!	TTGAGTTTGGGTTATTATTA+GGG	+	chr5_1:61287815-61287834	Msa0741570:intron	25.0%
!!!	TTTGTCATGAAATAATGGAT+TGG	-	chr5_1:61287922-61287941	None:intergenic	25.0%
!	TGCAATTTGTCATGAAATAA+TGG	-	chr5_1:61287927-61287946	None:intergenic	25.0%
!!!	AACATTGAGTTTTTTAGGTT+AGG	-	chr5_1:61287954-61287973	None:intergenic	25.0%
!	ACCTAAAAAACTCAATGTTA+AGG	+	chr5_1:61287955-61287974	Msa0741570:CDS	25.0%
!!!	TCCTTAACATTGAGTTTTTT+AGG	-	chr5_1:61287959-61287978	None:intergenic	25.0%
	AATGAACAGTTGTCAAAGTA+TGG	+	chr5_1:61287840-61287859	Msa0741570:CDS	30.0%
	TAAGATGTAGCCATTGAGTT+TGG	+	chr5_1:61287802-61287821	Msa0741570:intron	35.0%
	AAGATGTAGCCATTGAGTTT+GGG	+	chr5_1:61287803-61287822	Msa0741570:intron	35.0%
	AATCGCACAGCTATTGACAT+TGG	+	chr5_1:61287720-61287739	Msa0741570:CDS	40.0%
	ATGGTGATACTAAGTCTGCG+CGG	+	chr5_1:61287859-61287878	Msa0741570:CDS	45.0%
	TGGTGATACTAAGTCTGCGC+GGG	+	chr5_1:61287860-61287879	Msa0741570:CDS	50.0%
	GTCTGCGCGGGCAGTCATGT+TGG	+	chr5_1:61287872-61287891	Msa0741570:CDS	65.0%

Chromosome	Type	Strat	End	Strand	Name
chr5_1	gene	61287676	61287992	61287676	ID=Msa0741570;Name=Msa0741570
chr5_1	mRNA	61287676	61287992	61287676	ID=Msa0741570-mRNA-1;Parent=Msa0741570;Name=Msa0741570-mRNA-1;_AED=0.11;_eAED=0.11;_QI=0\|0\|0\|1\|0\|0\|2\|0\|78
chr5_1	exon	61287676	61287752	61287676	ID=Msa0741570-mRNA-1:exon:17762;Parent=Msa0741570-mRNA-1
chr5_1	exon	61287836	61287992	61287836	ID=Msa0741570-mRNA-1:exon:17763;Parent=Msa0741570-mRNA-1
chr5_1	CDS	61287676	61287752	61287676	ID=Msa0741570-mRNA-1:cds;Parent=Msa0741570-mRNA-1
chr5_1	CDS	61287836	61287992	61287836	ID=Msa0741570-mRNA-1:cds;Parent=Msa0741570-mRNA-1

Gene Sequence	>Msa0741570 GATTTGAAAGCGTTTGCTACGTTTAATAAAGAATTGTTCAAGGAAATCGCACAGCTATTGACATTGGAGAATTTTAGGGAAAATGAACAGTTGTCAAAGTATGGTGATACTAAGTCTGCGCGGGCAGTCATGTTGGTTGAGCTTAAAAAGCTCATTGAAGCCAATCCATTATTTCATGACAAATTGCAATTTCCTAACCTAAAAAACTCAATGTTAAGGACACTCATCAATCAA
Protein sequence	>Msa0741570 DLKAFATFNKELFKEIAQLLTLENFRENEQLSKYGDTKSARAVMLVELKKLIEANPLFHDKLQFPNLKNSMLRTLINQ