AlfalfaGEDB | Msa0822650

M. sativa cultivar zhongmu-4 / Msa0822650

KEGG: K14963
GO: GO:0000003 GO:0001101 GO:0003002 GO:0003006 GO:0003674 GO:0005488 GO:0005515 GO:0005575 GO:0005622 GO:0005623 GO:0005634 GO:0005737 GO:0005829 GO:0006355 GO:0007154 GO:0007165 GO:0007275 GO:0007389 GO:0008150 GO:0009653 GO:0009719 GO:0009725 GO:0009733 GO:0009753 GO:0009755 GO:0009790 GO:0009791 GO:0009793 GO:0009867 GO:0009888 GO:0009889 GO:0009890 GO:0009892 GO:0009933 GO:0009987 GO:0010014 GO:0010016 GO:0010033 GO:0010051 GO:0010072 GO:0010154 GO:0010468 GO:0010556 GO:0010558 GO:0010605 GO:0010629 GO:0019219 GO:0019222 GO:0022414 GO:0023052 GO:0031323 GO:0031324 GO:0031326 GO:0031327 GO:0032501 GO:0032502 GO:0032870 GO:0042221 GO:0042802 GO:0042803 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044424 GO:0044444 GO:0044464 GO:0045892 GO:0045934 GO:0046983 GO:0048316 GO:0048367 GO:0048507 GO:0048508 GO:0048519 GO:0048523 GO:0048532 GO:0048608 GO:0048731 GO:0048856 GO:0050789 GO:0050794 GO:0050896 GO:0051171 GO:0051172 GO:0051252 GO:0051253 GO:0051716 GO:0060255 GO:0061458 GO:0065007 GO:0070887 GO:0071229 GO:0071310 GO:0071395 GO:0071495 GO:0080090 GO:0090421 GO:1901700 GO:1901701 GO:1902679 GO:1903506 GO:1903507 GO:2000112 GO:2000113 GO:2001141
PFAM: -

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0822650	XP_040995868.1	91.026	78	7	0	1	78	31	108	1.01e-41	142

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0822650	sp\|Q10NY2\|TPR3_ORYSJ	89.744	78	8	0	1	78	100	177	2.52e-41	145

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0822650	A0A2I0HSB2	91.026	78	7	0	1	78	100	177	1.18e-41	143

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0017510	Msa0822650	0.808428	3.111754e-50	-8.615850e-47
Msa0045770	Msa0822650	0.803050	4.193333e-49	-8.615850e-47
Msa0067140	Msa0822650	0.800341	1.508006e-48	-8.615850e-47
Msa0112750	Msa0822650	0.800665	1.295813e-48	-8.615850e-47
Msa0114060	Msa0822650	0.810744	9.898637e-51	-8.615850e-47
Msa0119960	Msa0822650	0.813486	2.497550e-51	-8.615850e-47
Msa0612930	Msa0822650	0.808157	3.555289e-50	-8.615850e-47
Msa0627410	Msa0822650	0.822984	1.768075e-53	-8.615850e-47
Msa0657970	Msa0822650	0.832537	8.931768e-56	-8.615850e-47
Msa0688480	Msa0822650	0.800170	1.634156e-48	-8.615850e-47
Msa0693380	Msa0822650	0.813657	2.290981e-51	-8.615850e-47
Msa0697060	Msa0822650	0.815292	9.963470e-52	-8.615850e-47
Msa0741570	Msa0822650	0.931602	2.961290e-94	-8.615850e-47
Msa0760130	Msa0822650	0.820990	5.120405e-53	-8.615850e-47
Msa0762360	Msa0822650	0.803246	3.820608e-49	-8.615850e-47
Msa0766630	Msa0822650	0.824256	8.908961e-54	-8.615850e-47
Msa0777930	Msa0822650	0.800922	1.148397e-48	-8.615850e-47
Msa0806090	Msa0822650	0.809443	1.887954e-50	-8.615850e-47
Msa0820850	Msa0822650	0.804876	1.750416e-49	-8.615850e-47
Msa0822650	Msa0861130	0.806594	7.625347e-50	-8.615850e-47
Msa0822650	Msa0880140	0.806227	9.114290e-50	-8.615850e-47
Msa0822650	Msa0885280	0.834751	2.500091e-56	-8.615850e-47
Msa0822650	Msa0885290	0.838705	2.454158e-57	-8.615850e-47
Msa0822650	Msa0887990	0.815616	8.439485e-52	-8.615850e-47
Msa0822650	Msa0897880	0.808270	3.363122e-50	-8.615850e-47
Msa0822650	Msa0898380	0.813154	2.954975e-51	-8.615850e-47
Msa0822650	Msa0907070	0.811195	7.903015e-51	-8.615850e-47
Msa0822650	Msa0909120	0.811423	7.054417e-51	-8.615850e-47
Msa0822650	Msa0909140	0.816400	5.639204e-52	-8.615850e-47
Msa0822650	Msa0918220	0.805040	1.617197e-49	-8.615850e-47
Msa0822650	Msa0927290	0.821822	3.291087e-53	-8.615850e-47
Msa0822650	Msa0935910	0.810607	1.059876e-50	-8.615850e-47
Msa0822650	Msa0954910	0.832391	9.709753e-56	-8.615850e-47
Msa0822650	Msa0965750	0.820238	7.624748e-53	-8.615850e-47
Msa0822650	Msa0969450	0.829499	4.973663e-55	-8.615850e-47
Msa0822650	Msa0969520	0.803262	3.791807e-49	-8.615850e-47
Msa0822650	Msa0975220	0.804757	1.853632e-49	-8.615850e-47
Msa0822650	Msa1014540	0.803656	3.141974e-49	-8.615850e-47
Msa0822650	Msa1015730	0.809440	1.890376e-50	-8.615850e-47
Msa0822650	Msa1015790	0.813980	1.944778e-51	-8.615850e-47
Msa0822650	Msa1059570	0.823339	1.460549e-53	-8.615850e-47
Msa0822650	Msa1081880	0.802672	5.019267e-49	-8.615850e-47
Msa0822650	Msa1082500	0.843687	1.202488e-58	-8.615850e-47
Msa0822650	Msa1098400	0.805417	1.348310e-49	-8.615850e-47
Msa0822650	Msa1098420	0.801490	8.787756e-49	-8.615850e-47
Msa0822650	Msa1117170	0.800722	1.261209e-48	-8.615850e-47
Msa0822650	Msa1136090	0.806642	7.451416e-50	-8.615850e-47
Msa0822650	Msa1137690	0.802147	6.438696e-49	-8.615850e-47
Msa0822650	Msa1160670	0.814489	1.501404e-51	-8.615850e-47
Msa0822650	Msa1160690	0.811728	6.054152e-51	-8.615850e-47
Msa0822650	Msa1162550	-0.801612	8.294776e-49	-8.615850e-47
Msa0822650	Msa1178720	0.812974	3.235417e-51	-8.615850e-47
Msa0822650	Msa1187950	0.800179	1.627293e-48	-8.615850e-47
Msa0822650	Msa1249490	0.809370	1.956921e-50	-8.615850e-47
Msa0822650	Msa1283860	0.808687	2.740053e-50	-8.615850e-47
Msa0822650	Msa1284680	0.806846	6.746399e-50	-8.615850e-47
Msa0822650	Msa1291660	0.802188	6.316446e-49	-8.615850e-47
Msa0822650	Msa1297290	0.800511	1.392811e-48	-8.615850e-47
Msa0822650	Msa1298310	0.805543	1.268971e-49	-8.615850e-47
Msa0822650	Msa1318990	0.801780	7.661918e-49	-8.615850e-47
Msa0822650	Msa1322890	0.805237	1.470775e-49	-8.615850e-47
Msa0822650	Msa1329700	0.803164	3.972672e-49	-8.615850e-47
Msa0822650	Msa1372760	0.800316	1.526400e-48	-8.615850e-47
Msa0822650	Msa1385000	0.801670	8.070278e-49	-8.615850e-47
Msa0822650	Msa1392260	0.803544	3.314523e-49	-8.615850e-47
Msa0822650	Msa1397610	0.847666	1.001160e-59	-8.615850e-47
Msa0822650	Msa1411020	0.825784	3.881512e-54	-8.615850e-47
Msa0822650	Msa1420490	0.819927	8.979586e-53	-8.615850e-47
Msa0822650	Msa1423390	0.821602	3.699855e-53	-8.615850e-47
Msa0822650	Msa1424290	0.820556	6.445026e-53	-8.615850e-47
Msa0822650	Msa1434350	0.824095	9.715517e-54	-8.615850e-47
Msa0822650	Msa1438250	0.806277	8.893700e-50	-8.615850e-47
Msa0822650	Msa1439320	0.826074	3.311382e-54	-8.615850e-47
Msa0822650	Msa1440370	0.818187	2.233966e-52	-8.615850e-47
Msa0822650	Msa1440810	0.817183	3.763847e-52	-8.615850e-47
Msa0122590	Msa0822650	0.803456	3.456486e-49	-8.615850e-47
Msa0142220	Msa0822650	0.800522	1.385518e-48	-8.615850e-47
Msa0153910	Msa0822650	0.811052	8.491119e-51	-8.615850e-47
Msa0157290	Msa0822650	0.808223	3.441303e-50	-8.615850e-47
Msa0166870	Msa0822650	0.818865	1.568403e-52	-8.615850e-47
Msa0210450	Msa0822650	0.813197	2.892063e-51	-8.615850e-47
Msa0220580	Msa0822650	0.808230	3.430428e-50	-8.615850e-47
Msa0233300	Msa0822650	0.827893	1.216589e-54	-8.615850e-47
Msa0376590	Msa0822650	0.804652	1.949203e-49	-8.615850e-47
Msa0379640	Msa0822650	0.800572	1.353567e-48	-8.615850e-47
Msa0402290	Msa0822650	0.803504	3.377370e-49	-8.615850e-47
Msa0414230	Msa0822650	0.800009	1.762378e-48	-8.615850e-47
Msa0431690	Msa0822650	0.807365	5.237906e-50	-8.615850e-47
Msa0432300	Msa0822650	0.810615	1.055323e-50	-8.615850e-47
Msa0435230	Msa0822650	0.804460	2.137193e-49	-8.615850e-47
Msa0456200	Msa0822650	0.815363	9.606316e-52	-8.615850e-47
Msa0456840	Msa0822650	0.808218	3.450899e-50	-8.615850e-47
Msa0262510	Msa0822650	0.808622	2.828603e-50	-8.615850e-47
Msa0270520	Msa0822650	0.809699	1.663389e-50	-8.615850e-47
Msa0309020	Msa0822650	0.804210	2.409970e-49	-8.615850e-47
Msa0326200	Msa0822650	0.834516	2.865470e-56	-8.615850e-47
Msa0338110	Msa0822650	0.802143	6.452547e-49	-8.615850e-47
Msa0353190	Msa0822650	0.829332	5.461940e-55	-8.615850e-47
Msa0353690	Msa0822650	0.804442	2.155751e-49	-8.615850e-47
Msa0484780	Msa0822650	0.824670	7.115915e-54	-8.615850e-47
Msa0512900	Msa0822650	0.815077	1.111973e-51	-8.615850e-47
Msa0516370	Msa0822650	0.800069	1.713369e-48	-8.615850e-47
Msa0532350	Msa0822650	0.823871	1.096779e-53	-8.615850e-47
Msa0545210	Msa0822650	0.800005	1.764960e-48	-8.615850e-47
Msa0592680	Msa0822650	0.810248	1.266713e-50	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0822650	MtrunA17_Chr4g0003011	92.308	78	6	0	1	78	100	177	1.21e-43	149
Msa0822650	MtrunA17_Chr2g0333311	91.026	78	7	0	1	78	100	177	6.95e-43	147
Msa0822650	MtrunA17_Chr4g0064101	84.615	78	12	0	1	78	100	177	4.21e-40	139
Msa0822650	MtrunA17_Chr7g0271991	80.769	78	15	0	1	78	100	177	4.37e-38	133
Msa0822650	MtrunA17_Chr1g0192431	79.487	78	16	0	1	78	100	177	8.63e-38	132
Msa0822650	MtrunA17_Chr4g0067791	80.769	78	15	0	1	78	100	177	1.36e-36	129
Msa0822650	MtrunA17_Chr2g0295261	47.436	78	41	0	1	78	31	108	3.14e-19	77.8
Msa0822650	MtrunA17_Chr2g0310451	44.872	78	43	0	1	78	76	153	4.38e-19	77.8
Msa0822650	MtrunA17_Chr1g0149531	45.455	77	42	0	1	77	34	110	1.68e-18	73.2
Msa0822650	MtrunA17_Chr2g0295291	44.872	78	31	1	1	78	35	100	3.05e-15	64.3
Msa0822650	MtrunA17_Chr1g0153401	38.462	78	48	0	1	78	102	179	1.20e-12	59.7
Msa0822650	MtrunA17_Chr2g0295351	50.943	53	26	0	26	78	93	145	1.00e-11	58.5

Query id	Subject id	identity %	alignment length	mismatches	q. start	q. end	s. start	s. end	e-value	bit score
Msa0822650	AT1G15750.3	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0822650	AT1G15750.1	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0822650	AT1G15750.2	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0822650	AT1G15750.4	88.462	78	9	1	78	100	177	3.81e-42	145
Msa0822650	AT1G80490.1	87.179	78	10	1	78	100	177	4.57e-41	142
Msa0822650	AT1G80490.3	87.179	78	10	1	78	100	177	4.57e-41	142
Msa0822650	AT1G80490.2	87.179	78	10	1	78	100	177	4.57e-41	142
Msa0822650	AT3G15880.3	83.333	78	13	1	78	100	177	3.31e-39	137
Msa0822650	AT3G15880.2	83.333	78	13	1	78	100	177	3.31e-39	137
Msa0822650	AT3G15880.1	83.333	78	13	1	78	100	177	3.41e-39	137
Msa0822650	AT3G15880.4	83.333	78	13	1	78	100	177	3.41e-39	137
Msa0822650	AT3G16830.1	80.769	78	15	1	78	100	177	3.21e-37	131
Msa0822650	AT5G27030.2	78.205	78	17	1	78	100	177	4.05e-37	131
Msa0822650	AT5G27030.1	78.205	78	17	1	78	100	177	8.72e-37	130

Find 9 sgRNAs with CRISPR-Local

Find 18 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TGCAATTTGTCATGAAATAA+TGG	0.221024	5_3:-61052802	None:intergenic
AATGAACAGTTGTCAAAGTA+TGG	0.361823	5_3:+61052718	Msa0822650:CDS
GTTTAATAAAGAATTGTTCA+AGG	0.463922	5_3:+61052574	Msa0822650:CDS
TTTGTCATGAAATAATGGAT+TGG	0.485562	5_3:-61052797	None:intergenic
GTCTGCGCGGGCAGTCATGT+TGG	0.522666	5_3:+61052750	Msa0822650:CDS
AATCGCACAGCTATTGACAT+TGG	0.587279	5_3:+61052598	Msa0822650:CDS
TGGTGATACTAAGTCTGCGC+GGG	0.592019	5_3:+61052738	Msa0822650:CDS
TAAGGACACTCATCAATCAA+AGG	0.619686	5_3:+61052851	Msa0822650:CDS
ATGGTGATACTAAGTCTGCG+CGG	0.743006	5_3:+61052737	Msa0822650:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	GTTTAATAAAGAATTGTTCA+AGG	+	chr5_3:61052574-61052593	Msa0822650:CDS	20.0%
!!	TATTGACATTGGAGAATTTT+AGG	+	chr5_3:61052609-61052628	Msa0822650:CDS	25.0%
!	ACATCTTACAAACTGAAAAT+AGG	-	chr5_3:61052668-61052687	None:intergenic	25.0%
!	TAATAATAACCCAAACTCAA+TGG	-	chr5_3:61052693-61052712	None:intergenic	25.0%
!!	ATTGAGTTTGGGTTATTATT+AGG	+	chr5_3:61052692-61052711	Msa0822650:intron	25.0%
!!	TTGAGTTTGGGTTATTATTA+GGG	+	chr5_3:61052693-61052712	Msa0822650:intron	25.0%
!!!	TTTGTCATGAAATAATGGAT+TGG	-	chr5_3:61052800-61052819	None:intergenic	25.0%
!	TGCAATTTGTCATGAAATAA+TGG	-	chr5_3:61052805-61052824	None:intergenic	25.0%
!!!	AACATTGAGTTTTTTAGGTT+AGG	-	chr5_3:61052832-61052851	None:intergenic	25.0%
!	ACCTAAAAAACTCAATGTTA+AGG	+	chr5_3:61052833-61052852	Msa0822650:CDS	25.0%
!!!	TCCTTAACATTGAGTTTTTT+AGG	-	chr5_3:61052837-61052856	None:intergenic	25.0%
	AATGAACAGTTGTCAAAGTA+TGG	+	chr5_3:61052718-61052737	Msa0822650:CDS	30.0%
	TAAGATGTAGCCATTGAGTT+TGG	+	chr5_3:61052680-61052699	Msa0822650:intron	35.0%
	AAGATGTAGCCATTGAGTTT+GGG	+	chr5_3:61052681-61052700	Msa0822650:intron	35.0%
	AATCGCACAGCTATTGACAT+TGG	+	chr5_3:61052598-61052617	Msa0822650:CDS	40.0%
	ATGGTGATACTAAGTCTGCG+CGG	+	chr5_3:61052737-61052756	Msa0822650:CDS	45.0%
	TGGTGATACTAAGTCTGCGC+GGG	+	chr5_3:61052738-61052757	Msa0822650:CDS	50.0%
	GTCTGCGCGGGCAGTCATGT+TGG	+	chr5_3:61052750-61052769	Msa0822650:CDS	65.0%

Chromosome	Type	Strat	End	Strand	Name
chr5_3	gene	61052554	61052870	61052554	ID=Msa0822650;Name=Msa0822650
chr5_3	mRNA	61052554	61052870	61052554	ID=Msa0822650-mRNA-1;Parent=Msa0822650;Name=Msa0822650-mRNA-1;_AED=0.11;_eAED=0.11;_QI=0\|0\|0\|1\|0\|0\|2\|0\|78
chr5_3	exon	61052554	61052630	61052554	ID=Msa0822650-mRNA-1:exon:18799;Parent=Msa0822650-mRNA-1
chr5_3	exon	61052714	61052870	61052714	ID=Msa0822650-mRNA-1:exon:18800;Parent=Msa0822650-mRNA-1
chr5_3	CDS	61052554	61052630	61052554	ID=Msa0822650-mRNA-1:cds;Parent=Msa0822650-mRNA-1
chr5_3	CDS	61052714	61052870	61052714	ID=Msa0822650-mRNA-1:cds;Parent=Msa0822650-mRNA-1

Gene Sequence	>Msa0822650 GATTTGAAAGCGTTTGCTACGTTTAATAAAGAATTGTTCAAGGAAATCGCACAGCTATTGACATTGGAGAATTTTAGGGAAAATGAACAGTTGTCAAAGTATGGTGATACTAAGTCTGCGCGGGCAGTCATGTTGGTTGAGCTTAAAAAGCTCATTGAAGCCAATCCATTATTTCATGACAAATTGCAATTTCCTAACCTAAAAAACTCAATGTTAAGGACACTCATCAATCAA
Protein sequence	>Msa0822650 DLKAFATFNKELFKEIAQLLTLENFRENEQLSKYGDTKSARAVMLVELKKLIEANPLFHDKLQFPNLKNSMLRTLINQ