AlfalfaGEDB | Msa1133850

M. sativa cultivar zhongmu-4 / Msa1133850

KEGG: K14488
GO: -
PFAM: PF02519.17

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1133850	XP_013447781.1	95.783	166	3	1	1	166	1	162	2.62e-112	326

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1133850	sp\|Q9SGU2\|SAU71_ARATH	46.479	71	38	0	61	131	28	98	9.66e-17	74.7

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1133850	I3T7S1	95.783	166	3	1	1	166	1	162	1.25e-112	326

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0004990	Msa1133850	0.801243	9.872192e-49	-8.615850e-47
Msa0038010	Msa1133850	0.826157	3.164762e-54	-8.615850e-47
Msa0043840	Msa1133850	0.809189	2.140056e-50	-8.615850e-47
Msa0053040	Msa1133850	0.802083	6.639628e-49	-8.615850e-47
Msa0059880	Msa1133850	0.814870	1.236251e-51	-8.615850e-47
Msa0085710	Msa1133850	0.816634	4.999136e-52	-8.615850e-47
Msa0096860	Msa1133850	0.814193	1.745046e-51	-8.615850e-47
Msa0622890	Msa1133850	0.825151	5.480335e-54	-8.615850e-47
Msa0629040	Msa1133850	0.802786	4.756259e-49	-8.615850e-47
Msa0641700	Msa1133850	0.827967	1.167444e-54	-8.615850e-47
Msa0655370	Msa1133850	0.818951	1.499191e-52	-8.615850e-47
Msa0666580	Msa1133850	0.803505	3.376072e-49	-8.615850e-47
Msa0680460	Msa1133850	0.809772	1.603993e-50	-8.615850e-47
Msa0689840	Msa1133850	0.821731	3.454629e-53	-8.615850e-47
Msa0711230	Msa1133850	0.800694	1.277835e-48	-8.615850e-47
Msa0711240	Msa1133850	0.822442	2.363994e-53	-8.615850e-47
Msa0716600	Msa1133850	0.815862	7.438702e-52	-8.615850e-47
Msa0717030	Msa1133850	0.806819	6.835092e-50	-8.615850e-47
Msa0718770	Msa1133850	0.805001	1.648255e-49	-8.615850e-47
Msa0721260	Msa1133850	0.803978	2.692951e-49	-8.615850e-47
Msa0727480	Msa1133850	0.811276	7.590125e-51	-8.615850e-47
Msa0728520	Msa1133850	0.813647	2.302446e-51	-8.615850e-47
Msa0730890	Msa1133850	0.800386	1.476650e-48	-8.615850e-47
Msa0735340	Msa1133850	0.822552	2.228786e-53	-8.615850e-47
Msa0738570	Msa1133850	0.804209	2.411004e-49	-8.615850e-47
Msa0747710	Msa1133850	0.802223	6.213275e-49	-8.615850e-47
Msa0750790	Msa1133850	0.814602	1.416831e-51	-8.615850e-47
Msa0750830	Msa1133850	0.817138	3.852356e-52	-8.615850e-47
Msa0753410	Msa1133850	0.837157	6.135750e-57	-8.615850e-47
Msa0756570	Msa1133850	0.824029	1.007002e-53	-8.615850e-47
Msa0758000	Msa1133850	0.806445	8.198401e-50	-8.615850e-47
Msa0758150	Msa1133850	0.805090	1.578840e-49	-8.615850e-47
Msa0776540	Msa1133850	0.815809	7.641973e-52	-8.615850e-47
Msa0777210	Msa1133850	0.805669	1.193800e-49	-8.615850e-47
Msa0783580	Msa1133850	0.802578	5.249593e-49	-8.615850e-47
Msa0794200	Msa1133850	0.806038	9.984593e-50	-8.615850e-47
Msa0795330	Msa1133850	0.832828	7.564126e-56	-8.615850e-47
Msa0799110	Msa1133850	0.800693	1.278469e-48	-8.615850e-47
Msa0814350	Msa1133850	0.811707	6.118067e-51	-8.615850e-47
Msa0817100	Msa1133850	0.807744	4.352095e-50	-8.615850e-47
Msa0819110	Msa1133850	0.815000	1.156517e-51	-8.615850e-47
Msa0129270	Msa1133850	0.810206	1.293612e-50	-8.615850e-47
Msa0130360	Msa1133850	0.808224	3.439658e-50	-8.615850e-47
Msa0132250	Msa1133850	0.823546	1.306760e-53	-8.615850e-47
Msa0137970	Msa1133850	0.802424	5.648083e-49	-8.615850e-47
Msa0143710	Msa1133850	0.801776	7.677511e-49	-8.615850e-47
Msa0154750	Msa1133850	0.818001	2.460819e-52	-8.615850e-47
Msa0175060	Msa1133850	0.807377	5.206567e-50	-8.615850e-47
Msa0183920	Msa1133850	0.802480	5.499224e-49	-8.615850e-47
Msa0219810	Msa1133850	0.806526	7.883401e-50	-8.615850e-47
Msa0375550	Msa1133850	0.810199	1.297886e-50	-8.615850e-47
Msa0424240	Msa1133850	0.811734	6.036740e-51	-8.615850e-47
Msa0433090	Msa1133850	0.815620	8.423152e-52	-8.615850e-47
Msa0478400	Msa1133850	0.813640	2.310996e-51	-8.615850e-47
Msa0987020	Msa1133850	0.800228	1.590295e-48	-8.615850e-47
Msa0987550	Msa1133850	0.831753	1.396006e-55	-8.615850e-47
Msa1003120	Msa1133850	0.986779	6.104219e-168	-8.615850e-47
Msa1021620	Msa1133850	0.800571	1.353891e-48	-8.615850e-47
Msa1036590	Msa1133850	0.814808	1.275516e-51	-8.615850e-47
Msa1037530	Msa1133850	0.801785	7.643695e-49	-8.615850e-47
Msa1046220	Msa1133850	0.822153	2.758912e-53	-8.615850e-47
Msa1047300	Msa1133850	0.812862	3.423497e-51	-8.615850e-47
Msa1047340	Msa1133850	0.811368	7.249343e-51	-8.615850e-47
Msa1063260	Msa1133850	0.805077	1.588514e-49	-8.615850e-47
Msa1076900	Msa1133850	0.818308	2.097779e-52	-8.615850e-47
Msa1085820	Msa1133850	0.812821	3.496082e-51	-8.615850e-47
Msa1090990	Msa1133850	0.978806	1.329657e-146	-8.615850e-47
Msa1100330	Msa1133850	0.817558	3.098372e-52	-8.615850e-47
Msa0240580	Msa1133850	0.813823	2.105776e-51	-8.615850e-47
Msa0245660	Msa1133850	0.834901	2.292739e-56	-8.615850e-47
Msa0278960	Msa1133850	0.808609	2.847172e-50	-8.615850e-47
Msa0322460	Msa1133850	0.804987	1.658974e-49	-8.615850e-47
Msa0336640	Msa1133850	0.818515	1.882647e-52	-8.615850e-47
Msa1109540	Msa1133850	0.801743	7.795269e-49	-8.615850e-47
Msa1109890	Msa1133850	0.800001	1.768423e-48	-8.615850e-47
Msa1110900	Msa1133850	0.802766	4.800840e-49	-8.615850e-47
Msa1111650	Msa1133850	0.800976	1.119154e-48	-8.615850e-47
Msa1133850	Msa1165860	0.803871	2.834871e-49	-8.615850e-47
Msa1133850	Msa1191270	0.808621	2.830752e-50	-8.615850e-47
Msa1133850	Msa1211160	0.802987	4.322509e-49	-8.615850e-47
Msa1133850	Msa1211320	0.830481	2.866423e-55	-8.615850e-47
Msa1133850	Msa1214960	0.800392	1.472705e-48	-8.615850e-47
Msa1133850	Msa1259570	0.824131	9.532399e-54	-8.615850e-47
Msa1133850	Msa1335500	0.824031	1.006159e-53	-8.615850e-47
Msa1133850	Msa1357840	0.819802	9.591875e-53	-8.615850e-47
Msa1133850	Msa1362520	0.803270	3.777248e-49	-8.615850e-47
Msa1133850	Msa1364690	0.818506	1.892029e-52	-8.615850e-47
Msa1133850	Msa1373560	0.811569	6.556967e-51	-8.615850e-47
Msa1133850	Msa1376520	0.815755	7.856042e-52	-8.615850e-47
Msa1133850	Msa1377190	0.830912	2.247369e-55	-8.615850e-47
Msa1133850	Msa1377460	0.820168	7.909563e-53	-8.615850e-47
Msa1133850	Msa1378950	0.805568	1.253861e-49	-8.615850e-47
Msa1133850	Msa1379250	0.801370	9.298809e-49	-8.615850e-47
Msa1133850	Msa1409060	0.820502	6.629764e-53	-8.615850e-47
Msa1133850	Msa1417220	0.804603	1.995652e-49	-8.615850e-47
Msa1133850	Msa1429190	0.810445	1.148665e-50	-8.615850e-47
Msa1133850	Msa1437590	0.814579	1.433857e-51	-8.615850e-47
Msa1133850	Msa1445780	0.826958	2.038099e-54	-8.615850e-47
Msa1133850	Msa1446090	0.810041	1.403976e-50	-8.615850e-47
Msa0524710	Msa1133850	0.815180	1.055157e-51	-8.615850e-47
Msa0538450	Msa1133850	0.805849	1.094141e-49	-8.615850e-47
Msa0538520	Msa1133850	0.806356	8.558143e-50	-8.615850e-47
Msa0538650	Msa1133850	0.817601	3.029736e-52	-8.615850e-47
Msa0561830	Msa1133850	0.801179	1.017408e-48	-8.615850e-47
Msa0568920	Msa1133850	0.825731	3.994908e-54	-8.615850e-47
Msa0594320	Msa1133850	0.802006	6.885924e-49	-8.615850e-47
Msa0597820	Msa1133850	0.800772	1.231898e-48	-8.615850e-47
Msa0846870	Msa1133850	0.801564	8.486077e-49	-8.615850e-47
Msa0847140	Msa1133850	0.816219	6.191165e-52	-8.615850e-47
Msa0863840	Msa1133850	0.821695	3.522137e-53	-8.615850e-47
Msa0863850	Msa1133850	0.813228	2.845930e-51	-8.615850e-47
Msa0868820	Msa1133850	0.817936	2.545458e-52	-8.615850e-47
Msa0870170	Msa1133850	0.801184	1.014879e-48	-8.615850e-47
Msa0874750	Msa1133850	0.819968	8.788925e-53	-8.615850e-47
Msa0886370	Msa1133850	0.814890	1.223246e-51	-8.615850e-47
Msa0890210	Msa1133850	0.801292	9.647180e-49	-8.615850e-47
Msa0896920	Msa1133850	0.816216	6.198337e-52	-8.615850e-47
Msa0902340	Msa1133850	0.820126	8.084840e-53	-8.615850e-47
Msa0910590	Msa1133850	0.825853	3.738230e-54	-8.615850e-47
Msa0910830	Msa1133850	0.806841	6.762360e-50	-8.615850e-47
Msa0913500	Msa1133850	0.834494	2.901171e-56	-8.615850e-47
Msa0931370	Msa1133850	0.809359	1.967102e-50	-8.615850e-47
Msa0932890	Msa1133850	0.801056	1.077899e-48	-8.615850e-47
Msa0933610	Msa1133850	0.807427	5.082952e-50	-8.615850e-47
Msa0948430	Msa1133850	0.826994	1.998291e-54	-8.615850e-47
Msa0951060	Msa1133850	0.815685	8.145803e-52	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1133850	MtrunA17_Chr7g0214201	95.783	166	3	1	1	166	1	162	2.41e-116	326
Msa1133850	MtrunA17_Chr3g0131991	47.692	130	56	3	7	136	1	118	2.56e-31	110
Msa1133850	MtrunA17_Chr8g0386111	45.455	110	53	2	43	145	14	123	7.22e-26	96.3
Msa1133850	MtrunA17_Chr8g0386131	54.430	79	32	1	71	145	49	127	3.62e-24	92.4
Msa1133850	MtrunA17_Chr8g0386121	54.688	64	29	0	72	135	47	110	7.03e-21	82.4
Msa1133850	MtrunA17_Chr4g0036141	51.562	64	31	0	71	134	37	100	1.66e-17	74.3
Msa1133850	MtrunA17_Chr3g0127561	43.373	83	45	1	57	137	19	101	4.15e-17	72.8
Msa1133850	MtrunA17_Chr4g0070071	46.970	66	35	0	71	136	69	134	8.50e-17	73.2
Msa1133850	MtrunA17_Chr2g0311341	42.391	92	40	1	40	131	40	118	1.10e-16	72.4
Msa1133850	MtrunA17_Chr2g0301531	42.254	71	41	0	71	141	76	146	1.83e-16	72.4
Msa1133850	MtrunA17_Chr3g0139171	35.461	141	73	4	15	146	15	146	3.41e-16	72.0
Msa1133850	MtrunA17_Chr8g0358871	50.769	65	32	0	67	131	31	95	6.40e-16	69.7
Msa1133850	MtrunA17_Chr3g0121801	41.667	84	44	2	47	129	5	84	1.02e-15	68.6
Msa1133850	MtrunA17_Chr7g0266581	41.667	72	38	1	74	145	53	120	1.64e-15	68.9
Msa1133850	MtrunA17_Chr1g0156341	39.744	78	47	0	65	142	31	108	2.14e-15	69.3
Msa1133850	MtrunA17_Chr3g0145401	40.000	95	51	3	38	130	15	105	4.93e-15	67.4
Msa1133850	MtrunA17_Chr1g0178451	41.096	73	43	0	63	135	41	113	7.31e-15	67.4
Msa1133850	MtrunA17_Chr7g0276101	43.478	69	37	1	71	137	23	91	2.60e-14	65.1
Msa1133850	MtrunA17_Chr4g0000251	36.620	71	45	0	70	140	69	139	3.46e-14	66.2
Msa1133850	MtrunA17_Chr7g0266571	43.548	62	35	0	74	135	53	114	7.87e-14	64.7
Msa1133850	MtrunA17_Chr4g0036711	43.056	72	40	1	66	136	10	81	8.86e-14	63.2
Msa1133850	MtrunA17_Chr4g0036561	39.474	76	45	1	56	130	5	80	1.56e-13	62.8
Msa1133850	MtrunA17_Chr3g0121721	40.000	85	46	2	47	130	5	85	1.59e-13	62.8
Msa1133850	MtrunA17_Chr3g0121731	37.647	85	48	2	47	130	5	85	1.79e-13	62.8
Msa1133850	MtrunA17_Chr3g0121701	37.647	85	48	2	47	130	5	85	1.97e-13	62.8
Msa1133850	MtrunA17_Chr1g0147571	40.909	66	39	0	71	136	104	169	3.65e-13	64.7
Msa1133850	MtrunA17_Chr4g0036181	43.056	72	40	1	57	127	69	140	4.10e-13	63.2
Msa1133850	MtrunA17_Chr3g0130911	40.000	85	42	2	63	139	2	85	4.90e-13	62.0
Msa1133850	MtrunA17_Chr8g0358971	47.541	61	31	1	71	130	25	85	5.64e-13	61.2
Msa1133850	MtrunA17_Chr1g0179511	39.062	64	39	0	71	134	19	82	6.02e-13	62.4
Msa1133850	MtrunA17_Chr8g0346181	41.975	81	41	3	69	143	25	105	6.85e-13	61.6
Msa1133850	MtrunA17_Chr4g0036531	42.424	66	37	1	71	135	25	90	7.35e-13	61.2
Msa1133850	MtrunA17_Chr8g0358981	37.647	85	48	2	47	130	5	85	7.84e-13	61.2
Msa1133850	MtrunA17_Chr8g0359011	50.000	58	28	1	71	127	3	60	8.00e-13	60.5
Msa1133850	MtrunA17_Chr7g0264401	47.541	61	32	0	71	131	40	100	9.15e-13	61.6
Msa1133850	MtrunA17_Chr2g0281291	50.769	65	29	2	69	130	22	86	9.42e-13	60.8
Msa1133850	MtrunA17_Chr1g0199531	46.032	63	34	0	69	131	48	110	1.18e-12	61.2
Msa1133850	MtrunA17_Chr4g0036751	38.158	76	46	1	56	130	5	80	1.88e-12	60.1
Msa1133850	MtrunA17_Chr4g0036461	45.902	61	32	1	71	130	25	85	2.10e-12	60.1
Msa1133850	MtrunA17_Chr4g0036611	47.541	61	31	1	71	130	25	85	2.47e-12	59.7
Msa1133850	MtrunA17_Chr4g0036271	42.424	66	37	1	71	135	23	88	2.61e-12	59.7
Msa1133850	MtrunA17_Chr4g0036211	36.047	86	54	1	57	141	150	235	3.09e-12	62.8
Msa1133850	MtrunA17_Chr4g0036201	37.500	80	49	1	57	135	12	91	4.85e-12	58.9
Msa1133850	MtrunA17_Chr3g0121761	49.153	59	27	2	71	127	25	82	5.89e-12	58.9
Msa1133850	MtrunA17_Chr4g0036841	48.276	58	29	1	71	127	35	92	5.97e-12	58.9
Msa1133850	MtrunA17_Chr4g0036831	38.667	75	45	1	57	130	12	86	6.46e-12	58.5
Msa1133850	MtrunA17_Chr4g0036811	40.909	66	38	1	71	135	26	91	7.03e-12	58.5
Msa1133850	MtrunA17_Chr4g0011821	37.662	77	45	1	71	144	79	155	7.64e-12	60.1
Msa1133850	MtrunA17_Chr7g0264551	38.889	72	42	1	62	131	43	114	1.13e-11	58.9
Msa1133850	MtrunA17_Chr3g0139711	36.471	85	50	2	47	130	5	86	1.41e-11	57.8
Msa1133850	MtrunA17_Chr4g0036571	36.559	93	54	3	42	130	29	120	1.61e-11	58.5
Msa1133850	MtrunA17_Chr3g0121781	47.458	59	28	2	71	127	25	82	1.70e-11	57.4
Msa1133850	MtrunA17_Chr8g0358991	47.458	59	28	2	71	127	25	82	1.83e-11	57.4
Msa1133850	MtrunA17_Chr3g0139701	37.647	85	48	2	47	130	63	143	2.25e-11	58.5
Msa1133850	MtrunA17_Chr4g0036221	47.541	61	30	2	71	130	26	85	2.54e-11	57.0
Msa1133850	MtrunA17_Chr4g0036801	45.902	61	32	1	71	130	26	86	2.63e-11	57.0
Msa1133850	MtrunA17_Chr4g0036491	45.902	61	32	1	71	130	25	85	2.99e-11	57.0
Msa1133850	MtrunA17_Chr1g0181011	32.500	120	54	2	14	131	55	149	3.68e-11	58.5
Msa1133850	MtrunA17_Chr3g0121741	45.763	59	29	2	71	127	25	82	4.31e-11	56.6
Msa1133850	MtrunA17_Chr4g0036191	48.333	60	28	2	72	130	27	84	4.68e-11	56.2
Msa1133850	MtrunA17_Chr3g0121711	45.763	59	29	2	71	127	25	82	5.85e-11	56.2
Msa1133850	MtrunA17_Chr4g0036581	45.763	59	31	1	73	130	27	85	5.85e-11	56.2
Msa1133850	MtrunA17_Chr4g0036541	36.842	76	47	1	56	130	5	80	6.29e-11	55.8
Msa1133850	MtrunA17_Chr4g0036431	37.975	79	43	2	58	130	7	85	6.57e-11	55.8
Msa1133850	MtrunA17_Chr4g0036401	33.721	86	51	2	56	135	5	90	7.54e-11	55.8
Msa1133850	MtrunA17_Chr4g0036761	44.262	61	33	1	71	130	23	83	7.83e-11	55.8
Msa1133850	MtrunA17_Chr8g0385011	36.471	85	48	2	54	138	5	83	8.36e-11	56.2
Msa1133850	MtrunA17_Chr4g0036821	39.394	66	39	1	71	135	26	91	8.40e-11	55.8
Msa1133850	MtrunA17_Chr4g0036691	36.842	76	47	1	56	130	5	80	8.49e-11	55.5
Msa1133850	MtrunA17_Chr4g0036651	34.524	84	49	2	58	135	7	90	8.56e-11	55.8

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1133850	AT5G50760.1	43.966	116	63	1	19	134	5	118	5.53e-24	92.8
Msa1133850	AT1G56150.1	46.479	71	38	0	61	131	28	98	9.82e-18	74.7
Msa1133850	AT5G20810.1	48.485	66	34	0	71	136	79	144	1.87e-17	75.5
Msa1133850	AT5G20810.2	48.485	66	34	0	71	136	79	144	2.70e-17	75.5
Msa1133850	AT3G43120.1	46.970	66	35	0	71	136	79	144	6.04e-17	73.9
Msa1133850	AT3G12830.1	40.206	97	54	1	39	131	14	110	6.97e-16	70.5
Msa1133850	AT1G16510.1	46.970	66	35	0	66	131	49	114	1.71e-15	69.7
Msa1133850	AT2G46690.1	44.444	72	37	1	69	137	22	93	2.21e-15	68.9
Msa1133850	AT3G61900.1	40.230	87	40	2	69	143	28	114	2.92e-15	68.9
Msa1133850	AT4G00880.1	42.169	83	44	2	57	137	16	96	1.43e-14	66.6
Msa1133850	AT4G34750.2	42.623	61	35	0	71	131	37	97	2.19e-14	67.0
Msa1133850	AT4G34750.1	42.623	61	35	0	71	131	37	97	2.19e-14	67.0
Msa1133850	AT1G75590.1	47.368	57	30	0	71	127	42	98	1.05e-13	65.5
Msa1133850	AT5G10990.1	36.735	98	58	2	32	127	2	97	1.30e-13	65.1
Msa1133850	AT5G53590.1	41.096	73	38	1	71	138	46	118	2.72e-13	63.9
Msa1133850	AT1G79130.1	36.275	102	52	2	33	134	23	111	2.80e-13	63.5
Msa1133850	AT2G24400.1	41.379	87	49	1	53	137	46	132	1.72e-12	62.8
Msa1133850	AT1G19840.1	42.623	61	35	0	71	131	41	101	2.42e-12	61.6
Msa1133850	AT4G31320.1	41.250	80	42	2	72	146	81	160	3.84e-12	62.0
Msa1133850	AT3G20220.1	41.270	63	36	1	71	132	47	109	1.09e-11	58.9
Msa1133850	AT4G34760.1	27.273	121	63	2	7	127	4	99	1.40e-11	58.5
Msa1133850	AT2G37030.1	42.623	61	35	0	71	131	49	109	1.77e-11	58.5
Msa1133850	AT3G60690.1	38.542	96	52	3	59	149	74	167	2.08e-11	59.7
Msa1133850	AT5G66260.1	37.879	66	40	1	71	136	34	98	3.96e-11	57.0
Msa1133850	AT3G51200.1	40.323	62	37	0	70	131	39	100	6.39e-11	56.6

Find 41 sgRNAs with CRISPR-Local

Find 52 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ATCATCTTCTTAGCCCTTCC+AGG	0.273002	7_4:-60963	Msa1133850:CDS
CCTTCCCAAGGTTGTACTTT+TGG	0.273068	7_4:-61003	Msa1133850:CDS
ATCACAAACCTTTGCATTTG+AGG	0.328411	7_4:+61174	None:intergenic
GGAAAAGGGAACAAGAAAAT+AGG	0.347522	7_4:-61390	Msa1133850:CDS
GAAGAAGCTGAATCAGAATA+TGG	0.364921	7_4:-61108	Msa1133850:CDS
TTACAAAGTGTTGATGGAAA+TGG	0.371199	7_4:-61037	Msa1133850:CDS
TTATAGCTGCCAAGGACCTT+TGG	0.404368	7_4:-61085	Msa1133850:CDS
AAGAACATGAAGCAAGGAAA+AGG	0.428717	7_4:-61405	Msa1133850:CDS
GATTTGCTCCTTCTTGTCGT+TGG	0.461730	7_4:+61276	None:intergenic
GTTGTTTAAAACAATCATCC+TGG	0.485523	7_4:+60945	None:intergenic
AGAAAATAGACGAAAGAAAG+TGG	0.505985	7_4:-61229	Msa1133850:CDS
TAAAAGACATCAACATTACA+AGG	0.510903	7_4:+61057	None:intergenic
AGAACATGAAGCAAGGAAAA+GGG	0.512113	7_4:-61404	Msa1133850:CDS
TGCAAGTCCATAGGAGGAGG+AGG	0.512745	7_4:-61342	Msa1133850:CDS
ATCATGGCCTAGTCTTCCGC+GGG	0.516084	7_4:-61256	Msa1133850:CDS
AAGGAAGAGCCAAAGGTCCT+TGG	0.517712	7_4:+61076	None:intergenic
CGACAAGAAGGAGCAAATCA+TGG	0.519386	7_4:-61272	Msa1133850:CDS
TAGACGAAAGAAAGTGGCCC+CGG	0.522285	7_4:-61223	Msa1133850:CDS
ACACCGAAAAGCATCCCTCC+GGG	0.524201	7_4:+61205	None:intergenic
TTTAAAACAATCATCCTGGA+AGG	0.525683	7_4:+60949	None:intergenic
TCAAGCAACATCTTGAACAA+AGG	0.532123	7_4:+61129	None:intergenic
ACGACCAAAAGTACAACCTT+GGG	0.533998	7_4:+60999	None:intergenic
CGAAAGAAAGTGGCCCCGGA+GGG	0.535522	7_4:-61219	Msa1133850:CDS
AACGACCAAAAGTACAACCT+TGG	0.538821	7_4:+60998	None:intergenic
AGATGCAAGTCCATAGGAGG+AGG	0.541895	7_4:-61345	Msa1133850:CDS
TACACCGAAAAGCATCCCTC+CGG	0.548704	7_4:+61204	None:intergenic
AAGTCCATAGGAGGAGGAGG+AGG	0.549753	7_4:-61339	Msa1133850:CDS
GAATATGGTTATAGCTGCCA+AGG	0.552741	7_4:-61093	Msa1133850:CDS
CAGTGATTCCAACGACAAGA+AGG	0.563887	7_4:-61284	Msa1133850:CDS
TTAAAACAATCATCCTGGAA+GGG	0.592351	7_4:+60950	None:intergenic
TGGGAGAGATGCAAGTCCAT+AGG	0.597578	7_4:-61351	Msa1133850:CDS
AATCATGGCCTAGTCTTCCG+CGG	0.600149	7_4:-61257	Msa1133850:CDS
GAGAGATGCAAGTCCATAGG+AGG	0.601664	7_4:-61348	Msa1133850:CDS
GATAATGAAGCTCCTTCCCA+AGG	0.617597	7_4:-61015	Msa1133850:CDS
ACATTACAAGGAAGAGCCAA+AGG	0.626356	7_4:+61069	None:intergenic
ACGTTGGACCTCAAATGCAA+AGG	0.634178	7_4:-61182	Msa1133850:CDS
ATTGGCAAGAACATGAAGCA+AGG	0.634830	7_4:-61411	Msa1133850:CDS
ACGAAAGAAAGTGGCCCCGG+AGG	0.651502	7_4:-61220	Msa1133850:CDS
CCAAAAGTACAACCTTGGGA+AGG	0.674764	7_4:+61003	None:intergenic
CACCGAAAAGCATCCCTCCG+GGG	0.706013	7_4:+61206	None:intergenic
TCATGGCCTAGTCTTCCGCG+GGG	0.775767	7_4:-61255	Msa1133850:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!	TAAAAGACATCAACATTACA+AGG	+	chr7_4:61302-61321	None:intergenic	25.0%
	AGAAAATAGACGAAAGAAAG+TGG	-	chr7_4:61127-61146	Msa1133850:CDS	30.0%
!!!	TGTCTTTTACAAAGTGTTGA+TGG	-	chr7_4:61313-61332	Msa1133850:CDS	30.0%
!!	TTACAAAGTGTTGATGGAAA+TGG	-	chr7_4:61319-61338	Msa1133850:CDS	30.0%
	TTAAAACAATCATCCTGGAA+GGG	+	chr7_4:61409-61428	None:intergenic	30.0%
!	TTTAAAACAATCATCCTGGA+AGG	+	chr7_4:61410-61429	None:intergenic	30.0%
!	GTTGTTTAAAACAATCATCC+TGG	+	chr7_4:61414-61433	None:intergenic	30.0%
	AAGAACATGAAGCAAGGAAA+AGG	-	chr7_4:60951-60970	Msa1133850:CDS	35.0%
	AGAACATGAAGCAAGGAAAA+GGG	-	chr7_4:60952-60971	Msa1133850:CDS	35.0%
	GGAAAAGGGAACAAGAAAAT+AGG	-	chr7_4:60966-60985	Msa1133850:CDS	35.0%
	ATCACAAACCTTTGCATTTG+AGG	+	chr7_4:61185-61204	None:intergenic	35.0%
	TCAAGCAACATCTTGAACAA+AGG	+	chr7_4:61230-61249	None:intergenic	35.0%
	GAAGAAGCTGAATCAGAATA+TGG	-	chr7_4:61248-61267	Msa1133850:CDS	35.0%
	ATTGGCAAGAACATGAAGCA+AGG	-	chr7_4:60945-60964	Msa1133850:CDS	40.0%
	GAATATGGTTATAGCTGCCA+AGG	-	chr7_4:61263-61282	Msa1133850:CDS	40.0%
	ACATTACAAGGAAGAGCCAA+AGG	+	chr7_4:61290-61309	None:intergenic	40.0%
!	ACGACCAAAAGTACAACCTT+GGG	+	chr7_4:61360-61379	None:intergenic	40.0%
!	AACGACCAAAAGTACAACCT+TGG	+	chr7_4:61361-61380	None:intergenic	40.0%
	TAGGCCTCATCACAAAAACG+TGG	-	chr7_4:60985-61004	Msa1133850:CDS	45.0%
	AGGCCTCATCACAAAAACGT+GGG	-	chr7_4:60986-61005	Msa1133850:CDS	45.0%
!	TCTCCCACGTTTTTGTGATG+AGG	+	chr7_4:60992-61011	None:intergenic	45.0%
	CAGTGATTCCAACGACAAGA+AGG	-	chr7_4:61072-61091	Msa1133850:CDS	45.0%
!	GATTTGCTCCTTCTTGTCGT+TGG	+	chr7_4:61083-61102	None:intergenic	45.0%
	CGACAAGAAGGAGCAAATCA+TGG	-	chr7_4:61084-61103	Msa1133850:CDS	45.0%
	ACGTTGGACCTCAAATGCAA+AGG	-	chr7_4:61174-61193	Msa1133850:CDS	45.0%
	TTATAGCTGCCAAGGACCTT+TGG	-	chr7_4:61271-61290	Msa1133850:CDS	45.0%
	GATAATGAAGCTCCTTCCCA+AGG	-	chr7_4:61341-61360	Msa1133850:CDS	45.0%
!	CCAAAAGTACAACCTTGGGA+AGG	+	chr7_4:61356-61375	None:intergenic	45.0%
!	CCTTCCCAAGGTTGTACTTT+TGG	-	chr7_4:61353-61372	Msa1133850:CDS	45.0%
	ATCATCTTCTTAGCCCTTCC+AGG	-	chr7_4:61393-61412	Msa1133850:CDS	45.0%
	TGGGAGAGATGCAAGTCCAT+AGG	-	chr7_4:61005-61024	Msa1133850:CDS	50.0%
	GAGAGATGCAAGTCCATAGG+AGG	-	chr7_4:61008-61027	Msa1133850:CDS	50.0%
	AGATGCAAGTCCATAGGAGG+AGG	-	chr7_4:61011-61030	Msa1133850:CDS	50.0%
!	AATCATGGCCTAGTCTTCCG+CGG	-	chr7_4:61099-61118	Msa1133850:CDS	50.0%
	TAGACGAAAGAAAGTGGCCC+CGG	-	chr7_4:61133-61152	Msa1133850:CDS	50.0%
!!	TACACCGAAAAGCATCCCTC+CGG	+	chr7_4:61155-61174	None:intergenic	50.0%
!!	GGATGCTTTTCGGTGTACGT+TGG	-	chr7_4:61158-61177	Msa1133850:CDS	50.0%
	AAGGAAGAGCCAAAGGTCCT+TGG	+	chr7_4:61283-61302	None:intergenic	50.0%
	TGCAAGTCCATAGGAGGAGG+AGG	-	chr7_4:61014-61033	Msa1133850:CDS	55.0%
	AAGTCCATAGGAGGAGGAGG+AGG	-	chr7_4:61017-61036	Msa1133850:CDS	55.0%
!	ATCATGGCCTAGTCTTCCGC+GGG	-	chr7_4:61100-61119	Msa1133850:CDS	55.0%
!	CGTCTATTTTCTTCGCCCCG+CGG	+	chr7_4:61119-61138	None:intergenic	55.0%
!!	ACACCGAAAAGCATCCCTCC+GGG	+	chr7_4:61154-61173	None:intergenic	55.0%
	TCCATAGGAGGAGGAGGAGG+AGG	-	chr7_4:61020-61039	Msa1133850:CDS	60.0%
	TCCTCCTCCTCCTCCTCCTA+TGG	+	chr7_4:61024-61043	None:intergenic	60.0%
	ATAGGAGGAGGAGGAGGAGG+AGG	-	chr7_4:61023-61042	Msa1133850:CDS	60.0%
!	TCATGGCCTAGTCTTCCGCG+GGG	-	chr7_4:61101-61120	Msa1133850:CDS	60.0%
	ACGAAAGAAAGTGGCCCCGG+AGG	-	chr7_4:61136-61155	Msa1133850:CDS	60.0%
	CGAAAGAAAGTGGCCCCGGA+GGG	-	chr7_4:61137-61156	Msa1133850:CDS	60.0%
!!	CACCGAAAAGCATCCCTCCG+GGG	+	chr7_4:61153-61172	None:intergenic	60.0%
	TCTTCGCCCCGCGGAAGACT+AGG	+	chr7_4:61110-61129	None:intergenic	65.0%
!	GGCCCCGGAGGGATGCTTTT+CGG	-	chr7_4:61148-61167	Msa1133850:CDS	65.0%

Chromosome	Type	Strat	End	Strand	Name
chr7_4	gene	60939	61439	60939	ID=Msa1133850;Name=Msa1133850
chr7_4	mRNA	60939	61439	60939	ID=Msa1133850-mRNA-1;Parent=Msa1133850;Name=Msa1133850-mRNA-1;_AED=0.00;_eAED=0.00;_QI=0\|-1\|0\|1\|-1\|1\|1\|0\|166
chr7_4	exon	60939	61439	60939	ID=Msa1133850-mRNA-1:exon:23;Parent=Msa1133850-mRNA-1
chr7_4	CDS	60939	61439	60939	ID=Msa1133850-mRNA-1:cds;Parent=Msa1133850-mRNA-1

Gene Sequence

>Msa1133850

ATGGATATTGGCAAGAACATGAAGCAAGGAAAAGGGAACAAGAAAATAGGCCTCATCACAAAAACGTGGGAGAGATGCAAGTCCATAGGAGGAGGAGGAGGAGGAGGACACAAGAGTAAATCATATTCATCATCAGTGATTCCAACGACAAGAAGGAGCAAATCATGGCCTAGTCTTCCGCGGGGCGAAGAAAATAGACGAAAGAAAGTGGCCCCGGAGGGATGCTTTTCGGTGTACGTTGGACCTCAAATGCAAAGGTTTGTGATCAAAACTGAGTATGCTAATCATCCTTTGTTCAAGATGTTGCTTGAAGAAGCTGAATCAGAATATGGTTATAGCTGCCAAGGACCTTTGGCTCTTCCTTGTAATGTTGATGTCTTTTACAAAGTGTTGATGGAAATGGATAATGAAGCTCCTTCCCAAGGTTGTACTTTTGGTCGTTCTCGTTCTTCTTATCATCTTCTTAGCCCTTCCAGGATGATTGTTTTAAACAACTTCTAA

Protein sequence

>Msa1133850

MDIGKNMKQGKGNKKIGLITKTWERCKSIGGGGGGGHKSKSYSSSVIPTTRRSKSWPSLPRGEENRRKKVAPEGCFSVYVGPQMQRFVIKTEYANHPLFKMLLEEAESEYGYSCQGPLALPCNVDVFYKVLMEMDNEAPSQGCTFGRSRSSYHLLSPSRMIVLNNF*