AlfalfaGEDB | Msa0599600

M. sativa cultivar zhongmu-4 / Msa0599600

KEGG: K00430
GO: GO:0001101 GO:0003674 GO:0003824 GO:0004601 GO:0005575 GO:0005618 GO:0005622 GO:0005623 GO:0005634 GO:0005737 GO:0005783 GO:0005911 GO:0006950 GO:0006970 GO:0006972 GO:0008150 GO:0008152 GO:0009266 GO:0009269 GO:0009409 GO:0009414 GO:0009415 GO:0009505 GO:0009506 GO:0009628 GO:0009636 GO:0009651 GO:0009664 GO:0009987 GO:0010035 GO:0012505 GO:0016043 GO:0016209 GO:0016491 GO:0016684 GO:0030054 GO:0030312 GO:0042221 GO:0042538 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044424 GO:0044444 GO:0044464 GO:0045229 GO:0050896 GO:0051716 GO:0055044 GO:0055114 GO:0070887 GO:0071554 GO:0071555 GO:0071669 GO:0071840 GO:0071944 GO:0097237 GO:0098754 GO:0098869 GO:1901700 GO:1990748
PFAM: PF00141.26

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0599600	XP_013455618.1	80.982	326	8	2	6	277	1	326	0.0	525

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0599600	sp\|Q9SUT2\|PER39_ARATH	47.799	318	110	5	16	277	9	326	9.92e-98	292

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0004580	Msa0599600	0.830048	3.656376e-55	-8.615850e-47
Msa0010150	Msa0599600	0.837735	4.361999e-57	-8.615850e-47
Msa0024280	Msa0599600	0.851894	6.590443e-61	-8.615850e-47
Msa0024290	Msa0599600	0.825222	5.273806e-54	-8.615850e-47
Msa0027860	Msa0599600	0.834203	3.433885e-56	-8.615850e-47
Msa0036230	Msa0599600	0.800151	1.649082e-48	-8.615850e-47
Msa0036580	Msa0599600	0.816729	4.759770e-52	-8.615850e-47
Msa0048950	Msa0599600	0.850475	1.657557e-60	-8.615850e-47
Msa0059880	Msa0599600	0.884139	2.475437e-71	-8.615850e-47
Msa0061590	Msa0599600	0.802226	6.203483e-49	-8.615850e-47
Msa0061600	Msa0599600	0.818193	2.226757e-52	-8.615850e-47
Msa0072030	Msa0599600	0.871847	5.000689e-67	-8.615850e-47
Msa0074620	Msa0599600	0.833904	4.079884e-56	-8.615850e-47
Msa0075560	Msa0599600	0.815052	1.126597e-51	-8.615850e-47
Msa0084150	Msa0599600	0.817517	3.164620e-52	-8.615850e-47
Msa0084160	Msa0599600	0.822955	1.795817e-53	-8.615850e-47
Msa0102930	Msa0599600	0.824766	6.755219e-54	-8.615850e-47
Msa0106120	Msa0599600	0.808917	2.447328e-50	-8.615850e-47
Msa0106130	Msa0599600	0.807347	5.284573e-50	-8.615850e-47
Msa0114610	Msa0599600	0.800074	1.709228e-48	-8.615850e-47
Msa0120050	Msa0599600	0.839111	1.926050e-57	-8.615850e-47
Msa0120070	Msa0599600	0.829660	4.545313e-55	-8.615850e-47
Msa0123530	Msa0599600	0.800153	1.647544e-48	-8.615850e-47
Msa0128350	Msa0599600	0.808755	2.650673e-50	-8.615850e-47
Msa0139270	Msa0599600	0.814041	1.885020e-51	-8.615850e-47
Msa0139460	Msa0599600	0.823400	1.413769e-53	-8.615850e-47
Msa0139720	Msa0599600	0.801378	9.263841e-49	-8.615850e-47
Msa0140270	Msa0599600	0.814270	1.678553e-51	-8.615850e-47
Msa0143680	Msa0599600	0.805203	1.494790e-49	-8.615850e-47
Msa0143710	Msa0599600	0.814634	1.393980e-51	-8.615850e-47
Msa0143740	Msa0599600	0.810806	9.596445e-51	-8.615850e-47
Msa0143770	Msa0599600	0.812898	3.363256e-51	-8.615850e-47
Msa0147670	Msa0599600	0.834328	3.193889e-56	-8.615850e-47
Msa0150910	Msa0599600	0.873415	1.497310e-67	-8.615850e-47
Msa0150920	Msa0599600	0.823244	1.537218e-53	-8.615850e-47
Msa0152650	Msa0599600	0.809383	1.944661e-50	-8.615850e-47
Msa0154750	Msa0599600	0.800720	1.262623e-48	-8.615850e-47
Msa0160580	Msa0599600	0.803358	3.620819e-49	-8.615850e-47
Msa0163340	Msa0599600	0.870744	1.157912e-66	-8.615850e-47
Msa0163370	Msa0599600	0.845888	3.066742e-59	-8.615850e-47
Msa0168010	Msa0599600	0.821693	3.525816e-53	-8.615850e-47
Msa0170990	Msa0599600	0.836243	1.049099e-56	-8.615850e-47
Msa0176620	Msa0599600	0.820447	6.827145e-53	-8.615850e-47
Msa0177550	Msa0599600	0.831746	1.401647e-55	-8.615850e-47
Msa0197750	Msa0599600	0.843841	1.093238e-58	-8.615850e-47
Msa0199860	Msa0599600	0.811624	6.379331e-51	-8.615850e-47
Msa0207930	Msa0599600	0.806331	8.663187e-50	-8.615850e-47
Msa0212550	Msa0599600	0.828751	7.554230e-55	-8.615850e-47
Msa0216760	Msa0599600	0.800139	1.658028e-48	-8.615850e-47
Msa0219210	Msa0599600	0.839413	1.608773e-57	-8.615850e-47
Msa0223880	Msa0599600	0.818226	2.189416e-52	-8.615850e-47
Msa0225910	Msa0599600	0.811412	7.093220e-51	-8.615850e-47
Msa0234120	Msa0599600	0.807683	4.485035e-50	-8.615850e-47
Msa0366510	Msa0599600	0.825524	4.472877e-54	-8.615850e-47
Msa0374040	Msa0599600	0.807691	4.465950e-50	-8.615850e-47
Msa0374130	Msa0599600	0.818551	1.848131e-52	-8.615850e-47
Msa0393900	Msa0599600	0.842160	3.063867e-58	-8.615850e-47
Msa0396700	Msa0599600	0.826608	2.471504e-54	-8.615850e-47
Msa0396790	Msa0599600	0.826601	2.480813e-54	-8.615850e-47
Msa0398690	Msa0599600	0.813961	1.963763e-51	-8.615850e-47
Msa0414480	Msa0599600	0.826105	3.255246e-54	-8.615850e-47
Msa0444250	Msa0599600	0.811516	6.732230e-51	-8.615850e-47
Msa0444400	Msa0599600	0.831741	1.405299e-55	-8.615850e-47
Msa0445530	Msa0599600	0.817461	3.257986e-52	-8.615850e-47
Msa0453970	Msa0599600	0.801685	8.012658e-49	-8.615850e-47
Msa0464300	Msa0599600	0.805942	1.046040e-49	-8.615850e-47
Msa0464310	Msa0599600	0.835146	1.988020e-56	-8.615850e-47
Msa0469550	Msa0599600	0.841045	6.027265e-58	-8.615850e-47
Msa0470370	Msa0599600	0.801403	9.152943e-49	-8.615850e-47
Msa0470650	Msa0599600	-0.801599	8.346047e-49	-8.615850e-47
Msa0472390	Msa0599600	0.804075	2.570420e-49	-8.615850e-47
Msa0242700	Msa0599600	0.810956	8.906828e-51	-8.615850e-47
Msa0243990	Msa0599600	0.800550	1.367593e-48	-8.615850e-47
Msa0252930	Msa0599600	0.829264	5.673013e-55	-8.615850e-47
Msa0255010	Msa0599600	0.804137	2.495041e-49	-8.615850e-47
Msa0264940	Msa0599600	0.805995	1.019664e-49	-8.615850e-47
Msa0265060	Msa0599600	0.818191	2.229208e-52	-8.615850e-47
Msa0266640	Msa0599600	0.822725	2.031641e-53	-8.615850e-47
Msa0266650	Msa0599600	0.818903	1.537212e-52	-8.615850e-47
Msa0272420	Msa0599600	-0.805467	1.316616e-49	-8.615850e-47
Msa0274250	Msa0599600	0.819236	1.290977e-52	-8.615850e-47
Msa0274260	Msa0599600	0.844513	7.217385e-59	-8.615850e-47
Msa0277280	Msa0599600	0.832365	9.853579e-56	-8.615850e-47
Msa0278460	Msa0599600	0.819938	8.927980e-53	-8.615850e-47
Msa0278940	Msa0599600	0.803366	3.607749e-49	-8.615850e-47
Msa0278950	Msa0599600	0.829666	4.531399e-55	-8.615850e-47
Msa0291750	Msa0599600	0.803950	2.729479e-49	-8.615850e-47
Msa0298270	Msa0599600	0.849297	3.538875e-60	-8.615850e-47
Msa0302990	Msa0599600	0.805304	1.423758e-49	-8.615850e-47
Msa0312570	Msa0599600	-0.807056	6.091059e-50	-8.615850e-47
Msa0318370	Msa0599600	0.800784	1.225323e-48	-8.615850e-47
Msa0328090	Msa0599600	0.820657	6.109913e-53	-8.615850e-47
Msa0332720	Msa0599600	0.804604	1.994692e-49	-8.615850e-47
Msa0336630	Msa0599600	0.852414	4.689066e-61	-8.615850e-47
Msa0340650	Msa0599600	0.814593	1.423522e-51	-8.615850e-47
Msa0343720	Msa0599600	0.817267	3.602471e-52	-8.615850e-47
Msa0356200	Msa0599600	0.808396	3.161082e-50	-8.615850e-47
Msa0356250	Msa0599600	0.819435	1.163513e-52	-8.615850e-47
Msa0356410	Msa0599600	0.803250	3.813378e-49	-8.615850e-47
Msa0491760	Msa0599600	0.801210	1.002441e-48	-8.615850e-47
Msa0491770	Msa0599600	0.824098	9.701839e-54	-8.615850e-47
Msa0491800	Msa0599600	0.831466	1.643191e-55	-8.615850e-47
Msa0491950	Msa0599600	0.820456	6.795841e-53	-8.615850e-47
Msa0515130	Msa0599600	0.814028	1.897752e-51	-8.615850e-47
Msa0515260	Msa0599600	0.840267	9.638918e-58	-8.615850e-47
Msa0531030	Msa0599600	0.816596	5.097927e-52	-8.615850e-47
Msa0531080	Msa0599600	0.827812	1.272524e-54	-8.615850e-47
Msa0532680	Msa0599600	0.806817	6.841779e-50	-8.615850e-47
Msa0533510	Msa0599600	0.823747	1.172361e-53	-8.615850e-47
Msa0533520	Msa0599600	0.821218	4.537129e-53	-8.615850e-47
Msa0535570	Msa0599600	0.858160	9.966519e-63	-8.615850e-47
Msa0538440	Msa0599600	0.831834	1.333019e-55	-8.615850e-47
Msa0538450	Msa0599600	0.831147	1.967989e-55	-8.615850e-47
Msa0538520	Msa0599600	0.826913	2.089733e-54	-8.615850e-47
Msa0538530	Msa0599600	0.829553	4.826964e-55	-8.615850e-47
Msa0543740	Msa0599600	0.879902	8.523123e-70	-8.615850e-47
Msa0548760	Msa0599600	0.832327	1.007167e-55	-8.615850e-47
Msa0548770	Msa0599600	0.805073	1.592008e-49	-8.615850e-47
Msa0548970	Msa0599600	0.846961	1.563369e-59	-8.615850e-47
Msa0549920	Msa0599600	0.824238	8.994605e-54	-8.615850e-47
Msa0554660	Msa0599600	0.819738	9.918961e-53	-8.615850e-47
Msa0555920	Msa0599600	0.800702	1.273357e-48	-8.615850e-47
Msa0579530	Msa0599600	0.830708	2.522844e-55	-8.615850e-47
Msa0587920	Msa0599600	0.836166	1.097410e-56	-8.615850e-47
Msa0589450	Msa0599600	0.804528	2.068405e-49	-8.615850e-47
Msa0589720	Msa0599600	0.805881	1.077364e-49	-8.615850e-47
Msa0589730	Msa0599600	0.814162	1.773205e-51	-8.615850e-47
Msa0589740	Msa0599600	0.808499	3.005102e-50	-8.615850e-47
Msa0591490	Msa0599600	0.841921	3.542660e-58	-8.615850e-47
Msa0593870	Msa0599600	0.802078	6.652863e-49	-8.615850e-47
Msa0594320	Msa0599600	0.807556	4.771377e-50	-8.615850e-47
Msa0594330	Msa0599600	0.830108	3.535680e-55	-8.615850e-47
Msa0599600	Msa0601920	0.809229	2.097468e-50	-8.615850e-47
Msa0599600	Msa0602050	0.805571	1.251778e-49	-8.615850e-47
Msa0599600	Msa0603950	0.823807	1.135482e-53	-8.615850e-47
Msa0599600	Msa0604280	0.804274	2.336801e-49	-8.615850e-47
Msa0599600	Msa0605410	0.802431	5.628229e-49	-8.615850e-47
Msa0599600	Msa0605460	0.828456	8.901641e-55	-8.615850e-47
Msa0599600	Msa0605470	0.863493	2.393373e-64	-8.615850e-47
Msa0599600	Msa0609460	0.816625	5.021172e-52	-8.615850e-47
Msa0599600	Msa0616300	0.802494	5.461731e-49	-8.615850e-47
Msa0599600	Msa0623750	0.810104	1.360471e-50	-8.615850e-47
Msa0599600	Msa0629720	0.811540	6.651784e-51	-8.615850e-47
Msa0599600	Msa0630130	0.826715	2.330142e-54	-8.615850e-47
Msa0599600	Msa0631700	0.842204	2.982043e-58	-8.615850e-47
Msa0599600	Msa0634290	0.840012	1.123467e-57	-8.615850e-47
Msa0599600	Msa0640290	0.855840	4.814200e-62	-8.615850e-47
Msa0599600	Msa0643840	0.865325	6.409304e-65	-8.615850e-47
Msa0599600	Msa0645100	0.817315	3.515110e-52	-8.615850e-47
Msa0599600	Msa0645120	0.806233	9.087474e-50	-8.615850e-47
Msa0599600	Msa0645150	0.813327	2.706832e-51	-8.615850e-47
Msa0599600	Msa0646040	0.820918	5.322058e-53	-8.615850e-47
Msa0599600	Msa0650100	0.812479	4.153619e-51	-8.615850e-47
Msa0599600	Msa0650310	0.822297	2.554932e-53	-8.615850e-47
Msa0599600	Msa0650440	0.808242	3.410260e-50	-8.615850e-47
Msa0599600	Msa0668210	0.803251	3.811414e-49	-8.615850e-47
Msa0599600	Msa0668220	0.839231	1.792696e-57	-8.615850e-47
Msa0599600	Msa0668230	0.808844	2.536745e-50	-8.615850e-47
Msa0599600	Msa0670220	0.801108	1.051731e-48	-8.615850e-47
Msa0599600	Msa0670360	0.855010	8.401300e-62	-8.615850e-47
Msa0599600	Msa0678620	0.887888	9.600109e-73	-8.615850e-47
Msa0599600	Msa0682730	0.801742	7.799241e-49	-8.615850e-47
Msa0599600	Msa0684590	0.829010	6.537212e-55	-8.615850e-47
Msa0599600	Msa0684600	0.812634	3.841434e-51	-8.615850e-47
Msa0599600	Msa0684720	0.849741	2.661403e-60	-8.615850e-47
Msa0599600	Msa0685080	0.812205	4.766307e-51	-8.615850e-47
Msa0599600	Msa0692090	0.809819	1.566977e-50	-8.615850e-47
Msa0599600	Msa0711230	0.803725	3.039207e-49	-8.615850e-47
Msa0599600	Msa0711240	0.819801	9.595748e-53	-8.615850e-47
Msa0599600	Msa0715260	0.803835	2.883166e-49	-8.615850e-47
Msa0599600	Msa0727480	0.853589	2.162795e-61	-8.615850e-47
Msa0599600	Msa0728520	0.801101	1.055228e-48	-8.615850e-47
Msa0599600	Msa0735130	0.809029	2.315628e-50	-8.615850e-47
Msa0599600	Msa0735280	0.847059	1.469473e-59	-8.615850e-47
Msa0599600	Msa0757240	0.803616	3.201791e-49	-8.615850e-47
Msa0599600	Msa0758150	0.809638	1.713988e-50	-8.615850e-47
Msa0599600	Msa0768670	0.858596	7.391357e-63	-8.615850e-47
Msa0599600	Msa0768720	0.861540	9.547738e-64	-8.615850e-47
Msa0599600	Msa0776540	0.800146	1.652840e-48	-8.615850e-47
Msa0599600	Msa0777070	0.822903	1.846631e-53	-8.615850e-47
Msa0599600	Msa0777250	0.869454	3.059808e-66	-8.615850e-47
Msa0599600	Msa0787860	0.840999	6.198572e-58	-8.615850e-47
Msa0599600	Msa0796430	0.805838	1.099999e-49	-8.615850e-47
Msa0599600	Msa0798230	0.804150	2.480206e-49	-8.615850e-47
Msa0599600	Msa0813840	0.804157	2.471203e-49	-8.615850e-47
Msa0599600	Msa0814160	0.849310	3.509464e-60	-8.615850e-47
Msa0599600	Msa0814230	0.870571	1.319805e-66	-8.615850e-47
Msa0599600	Msa0816140	0.813657	2.291095e-51	-8.615850e-47
Msa0599600	Msa0817100	0.806070	9.831959e-50	-8.615850e-47
Msa0599600	Msa0822410	0.810370	1.192074e-50	-8.615850e-47
Msa0599600	Msa0824850	0.817953	2.523944e-52	-8.615850e-47
Msa0599600	Msa0824860	0.848457	6.054080e-60	-8.615850e-47
Msa0599600	Msa0831890	0.802545	5.332342e-49	-8.615850e-47
Msa0599600	Msa0834270	0.817382	3.394473e-52	-8.615850e-47
Msa0599600	Msa0854840	0.836966	6.865521e-57	-8.615850e-47
Msa0599600	Msa0861730	0.827401	1.596446e-54	-8.615850e-47
Msa0599600	Msa0863840	0.831772	1.380722e-55	-8.615850e-47
Msa0599600	Msa0863850	0.824003	1.021321e-53	-8.615850e-47
Msa0599600	Msa0863860	0.820444	6.835763e-53	-8.615850e-47
Msa0599600	Msa0864160	0.839309	1.711976e-57	-8.615850e-47
Msa0599600	Msa0883610	0.804775	1.837549e-49	-8.615850e-47
Msa0599600	Msa0883640	0.873296	1.641758e-67	-8.615850e-47
Msa0599600	Msa0890210	0.804731	1.876956e-49	-8.615850e-47
Msa0599600	Msa0893840	0.843715	1.181350e-58	-8.615850e-47
Msa0599600	Msa0895420	0.821545	3.813503e-53	-8.615850e-47
Msa0599600	Msa0896920	0.859276	4.626847e-63	-8.615850e-47
Msa0599600	Msa0896950	0.804501	2.096051e-49	-8.615850e-47
Msa0599600	Msa0902340	0.817149	3.829297e-52	-8.615850e-47
Msa0599600	Msa0910830	0.874150	8.454871e-68	-8.615850e-47
Msa0599600	Msa0913550	0.856861	2.415443e-62	-8.615850e-47
Msa0599600	Msa0922090	0.802616	5.154908e-49	-8.615850e-47
Msa0599600	Msa0933610	0.817156	3.815930e-52	-8.615850e-47
Msa0599600	Msa0941120	0.837871	4.025223e-57	-8.615850e-47
Msa0599600	Msa0948050	0.802316	5.943614e-49	-8.615850e-47
Msa0599600	Msa0951150	0.848823	4.793220e-60	-8.615850e-47
Msa0599600	Msa0960090	0.874274	7.678016e-68	-8.615850e-47
Msa0599600	Msa0962290	0.803196	3.913070e-49	-8.615850e-47
Msa0599600	Msa0967820	0.827873	1.229828e-54	-8.615850e-47
Msa0599600	Msa0985250	0.818895	1.543912e-52	-8.615850e-47
Msa0599600	Msa0985700	0.873967	9.752224e-68	-8.615850e-47
Msa0599600	Msa0987640	0.848111	7.544886e-60	-8.615850e-47
Msa0599600	Msa0993450	0.839858	1.232004e-57	-8.615850e-47
Msa0599600	Msa0996980	0.828001	1.145783e-54	-8.615850e-47
Msa0599600	Msa1003110	0.817067	3.996831e-52	-8.615850e-47
Msa0599600	Msa1006170	0.824112	9.627203e-54	-8.615850e-47
Msa0599600	Msa1018590	0.802630	5.120275e-49	-8.615850e-47
Msa0599600	Msa1020540	0.800117	1.674798e-48	-8.615850e-47
Msa0599600	Msa1021620	0.866979	1.917681e-65	-8.615850e-47
Msa0599600	Msa1022490	0.814917	1.206874e-51	-8.615850e-47
Msa0599600	Msa1022510	0.831510	1.602484e-55	-8.615850e-47
Msa0599600	Msa1022580	0.804066	2.581572e-49	-8.615850e-47
Msa0599600	Msa1024350	0.859113	5.177562e-63	-8.615850e-47
Msa0599600	Msa1024420	0.809891	1.512329e-50	-8.615850e-47
Msa0599600	Msa1026050	0.854104	1.536538e-61	-8.615850e-47
Msa0599600	Msa1037350	0.803006	4.283676e-49	-8.615850e-47
Msa0599600	Msa1041630	0.834514	2.868221e-56	-8.615850e-47
Msa0599600	Msa1046220	0.802440	5.605337e-49	-8.615850e-47
Msa0599600	Msa1060320	0.812370	4.386405e-51	-8.615850e-47
Msa0599600	Msa1061670	0.867469	1.337630e-65	-8.615850e-47
Msa0599600	Msa1064940	0.815103	1.097167e-51	-8.615850e-47
Msa0599600	Msa1076830	0.836523	8.901587e-57	-8.615850e-47
Msa0599600	Msa1079610	-0.804817	1.800680e-49	-8.615850e-47
Msa0599600	Msa1081610	0.825949	3.546770e-54	-8.615850e-47
Msa0599600	Msa1087370	0.808615	2.839312e-50	-8.615850e-47
Msa0599600	Msa1087380	0.847512	1.103369e-59	-8.615850e-47
Msa0599600	Msa1098100	0.803001	4.292860e-49	-8.615850e-47
Msa0599600	Msa1100560	0.813523	2.451491e-51	-8.615850e-47
Msa0599600	Msa1104960	0.844914	5.625756e-59	-8.615850e-47
Msa0599600	Msa1106680	0.824719	6.931604e-54	-8.615850e-47
Msa0599600	Msa1106960	0.859820	3.173915e-63	-8.615850e-47
Msa0599600	Msa1109880	0.866678	2.391216e-65	-8.615850e-47
Msa0599600	Msa1109890	0.880905	3.732276e-70	-8.615850e-47
Msa0599600	Msa1112730	0.824906	6.260683e-54	-8.615850e-47
Msa0599600	Msa1132560	0.800457	1.428141e-48	-8.615850e-47
Msa0599600	Msa1133860	0.812749	3.625212e-51	-8.615850e-47
Msa0599600	Msa1138110	0.822719	2.037875e-53	-8.615850e-47
Msa0599600	Msa1147030	0.837257	5.782719e-57	-8.615850e-47
Msa0599600	Msa1148210	0.812920	3.324872e-51	-8.615850e-47
Msa0599600	Msa1149020	0.845474	3.969761e-59	-8.615850e-47
Msa0599600	Msa1156240	0.801497	8.756490e-49	-8.615850e-47
Msa0599600	Msa1164240	0.804010	2.652538e-49	-8.615850e-47
Msa0599600	Msa1166530	0.846667	1.880695e-59	-8.615850e-47
Msa0599600	Msa1170340	0.820533	6.524553e-53	-8.615850e-47
Msa0599600	Msa1173290	0.809602	1.744703e-50	-8.615850e-47
Msa0599600	Msa1181680	0.801256	9.808653e-49	-8.615850e-47
Msa0599600	Msa1207480	0.806714	7.192561e-50	-8.615850e-47
Msa0599600	Msa1214960	0.812621	3.866648e-51	-8.615850e-47
Msa0599600	Msa1216600	0.827041	1.947083e-54	-8.615850e-47
Msa0599600	Msa1219780	0.811690	6.172039e-51	-8.615850e-47
Msa0599600	Msa1221170	0.811849	5.698792e-51	-8.615850e-47
Msa0599600	Msa1222030	0.807065	6.064328e-50	-8.615850e-47
Msa0599600	Msa1233650	0.831934	1.259444e-55	-8.615850e-47
Msa0599600	Msa1236680	0.806849	6.734828e-50	-8.615850e-47
Msa0599600	Msa1262810	0.829508	4.950970e-55	-8.615850e-47
Msa0599600	Msa1265500	0.822172	2.729987e-53	-8.615850e-47
Msa0599600	Msa1266710	0.801267	9.762124e-49	-8.615850e-47
Msa0599600	Msa1269050	0.866629	2.478969e-65	-8.615850e-47
Msa0599600	Msa1270010	0.802273	6.066483e-49	-8.615850e-47
Msa0599600	Msa1286420	0.823149	1.618417e-53	-8.615850e-47
Msa0599600	Msa1296870	0.819433	1.164582e-52	-8.615850e-47
Msa0599600	Msa1300610	0.866125	3.584064e-65	-8.615850e-47
Msa0599600	Msa1314710	0.828140	1.060817e-54	-8.615850e-47
Msa0599600	Msa1319290	0.814917	1.206983e-51	-8.615850e-47
Msa0599600	Msa1323030	0.862534	4.733755e-64	-8.615850e-47
Msa0599600	Msa1323120	0.884983	1.202477e-71	-8.615850e-47
Msa0599600	Msa1323150	0.804144	2.486954e-49	-8.615850e-47
Msa0599600	Msa1323160	0.857627	1.435053e-62	-8.615850e-47
Msa0599600	Msa1329740	0.835282	1.837494e-56	-8.615850e-47
Msa0599600	Msa1343590	0.807755	4.328798e-50	-8.615850e-47
Msa0599600	Msa1350490	0.812175	4.838912e-51	-8.615850e-47
Msa0599600	Msa1355330	0.803171	3.958973e-49	-8.615850e-47
Msa0599600	Msa1355340	0.825417	4.740457e-54	-8.615850e-47
Msa0599600	Msa1357490	0.840342	9.211362e-58	-8.615850e-47
Msa0599600	Msa1357750	0.846990	1.534107e-59	-8.615850e-47
Msa0599600	Msa1357860	0.832836	7.532067e-56	-8.615850e-47
Msa0599600	Msa1370930	0.807454	5.014334e-50	-8.615850e-47
Msa0599600	Msa1373560	0.804303	2.305016e-49	-8.615850e-47
Msa0599600	Msa1376070	0.838945	2.126429e-57	-8.615850e-47
Msa0599600	Msa1377520	0.822769	1.983751e-53	-8.615850e-47
Msa0599600	Msa1378950	0.809239	2.088092e-50	-8.615850e-47
Msa0599600	Msa1380490	0.822818	1.932529e-53	-8.615850e-47
Msa0599600	Msa1386020	-0.806689	7.281847e-50	-8.615850e-47
Msa0599600	Msa1386120	0.822170	2.733871e-53	-8.615850e-47
Msa0599600	Msa1386260	0.820602	6.290431e-53	-8.615850e-47
Msa0599600	Msa1393440	0.819360	1.210141e-52	-8.615850e-47
Msa0599600	Msa1395690	0.819184	1.327128e-52	-8.615850e-47
Msa0599600	Msa1407210	0.806645	7.437141e-50	-8.615850e-47
Msa0599600	Msa1407670	0.840253	9.717865e-58	-8.615850e-47
Msa0599600	Msa1409600	0.821902	3.153690e-53	-8.615850e-47
Msa0599600	Msa1411550	0.840202	1.002157e-57	-8.615850e-47
Msa0599600	Msa1413090	0.803226	3.857771e-49	-8.615850e-47
Msa0599600	Msa1420020	0.849993	2.262791e-60	-8.615850e-47
Msa0599600	Msa1421120	0.801850	7.412900e-49	-8.615850e-47
Msa0599600	Msa1421130	0.812359	4.410689e-51	-8.615850e-47
Msa0599600	Msa1426420	0.807269	5.490562e-50	-8.615850e-47
Msa0599600	Msa1427670	0.821863	3.220041e-53	-8.615850e-47
Msa0599600	Msa1445900	0.877806	4.677429e-69	-8.615850e-47
Msa0599600	Msa1447790	0.800084	1.701292e-48	-8.615850e-47
Msa0599600	Msa1448150	0.816195	6.267387e-52	-8.615850e-47
Msa0599600	Msa1449770	0.844214	8.682468e-59	-8.615850e-47
Msa0599600	Msa1453650	0.824293	8.731770e-54	-8.615850e-47
Msa0599600	Msa1456600	0.814606	1.414427e-51	-8.615850e-47
Msa0599600	Msa1459610	0.846929	1.594370e-59	-8.615850e-47
Msa0599600	Msa1460310	0.804771	1.840843e-49	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0599600	MtrunA17_Chr4g0024121	80.982	326	8	2	6	277	1	326	0.0	525
Msa0599600	MtrunA17_Chr2g0322861	57.313	335	82	7	1	277	55	386	3.57e-129	372
Msa0599600	MtrunA17_Chr7g0268501	41.718	326	130	6	6	277	1	320	3.03e-80	245
Msa0599600	MtrunA17_Chr7g0268521	41.718	326	130	6	6	277	1	320	3.03e-80	245
Msa0599600	MtrunA17_Chr5g0402581	35.331	317	149	4	16	277	11	326	3.56e-61	196
Msa0599600	MtrunA17_Chr5g0402571	34.700	317	151	5	16	277	11	326	5.20e-60	193
Msa0599600	MtrunA17_Chr3g0128061	36.050	319	149	3	14	277	8	326	6.09e-59	190
Msa0599600	MtrunA17_Chr2g0279041	37.309	327	139	8	12	277	4	325	1.20e-56	184
Msa0599600	MtrunA17_Chr1g0204011	34.891	321	150	6	11	277	7	322	2.64e-56	183
Msa0599600	MtrunA17_Chr3g0129051	34.426	305	151	6	18	273	14	318	5.03e-56	183
Msa0599600	MtrunA17_Chr5g0405991	38.532	327	133	9	8	277	1	316	6.30e-56	182
Msa0599600	MtrunA17_Chr2g0292241	34.985	323	148	6	16	277	9	330	7.29e-56	183
Msa0599600	MtrunA17_Chr6g0477071	37.542	301	135	6	25	277	47	342	3.23e-55	181
Msa0599600	MtrunA17_Chr2g0292211	34.337	332	156	6	7	277	11	341	4.13e-55	181
Msa0599600	MtrunA17_Chr2g0292181	34.579	321	148	6	18	277	20	339	6.38e-55	181
Msa0599600	MtrunA17_Chr5g0404721	37.748	302	131	5	32	277	30	330	9.06e-55	180
Msa0599600	MtrunA17_Chr2g0299691	36.482	307	132	7	31	277	55	358	4.62e-54	179
Msa0599600	MtrunA17_Chr1g0175561	32.209	326	162	6	10	277	2	326	1.08e-52	174
Msa0599600	MtrunA17_Chr2g0292261	33.956	321	150	7	18	277	11	330	1.29e-52	175
Msa0599600	MtrunA17_Chr2g0292111	34.451	328	150	7	14	277	4	330	1.42e-52	175
Msa0599600	MtrunA17_Chr6g0460711	33.438	320	149	7	15	277	2	314	1.51e-52	174
Msa0599600	MtrunA17_Chr2g0291751	33.956	321	149	6	19	277	11	330	2.76e-52	174
Msa0599600	MtrunA17_Chr1g0188431	32.911	316	159	4	10	277	17	327	2.85e-52	173
Msa0599600	MtrunA17_Chr3g0106921	35.168	327	150	9	6	277	1	320	2.94e-52	173
Msa0599600	MtrunA17_Chr3g0114451	34.603	315	155	5	13	277	5	318	3.61e-52	172
Msa0599600	MtrunA17_Chr2g0292251	36.039	308	139	6	27	277	23	329	3.93e-52	174
Msa0599600	MtrunA17_Chr2g0320101	31.889	323	165	6	3	277	2	317	5.52e-52	172
Msa0599600	MtrunA17_Chr8g0371381	35.738	305	136	6	27	277	21	319	9.73e-52	172
Msa0599600	MtrunA17_Chr2g0320071	32.198	323	164	6	3	277	2	317	1.12e-51	171
Msa0599600	MtrunA17_Chr2g0292151	34.139	331	156	6	8	277	1	330	1.99e-51	172
Msa0599600	MtrunA17_Chr7g0258811	32.508	323	159	6	13	277	50	371	2.76e-51	172
Msa0599600	MtrunA17_Chr7g0225221	34.688	320	154	7	10	277	4	320	4.67e-51	170
Msa0599600	MtrunA17_Chr2g0279061	39.847	261	113	6	56	277	11	266	7.14e-51	168
Msa0599600	MtrunA17_Chr4g0063671	33.540	322	150	7	15	277	4	320	7.56e-51	169
Msa0599600	MtrunA17_Chr7g0244461	32.154	311	162	4	15	277	3	312	8.47e-51	169
Msa0599600	MtrunA17_Chr7g0244451	33.762	311	157	4	15	277	7	316	1.24e-50	169
Msa0599600	MtrunA17_Chr2g0292091	33.333	327	159	8	8	277	1	325	7.10e-50	167
Msa0599600	MtrunA17_Chr8g0372601	34.768	302	140	5	32	277	30	330	2.82e-49	166
Msa0599600	MtrunA17_Chr7g0254201	33.444	302	140	7	30	277	18	312	2.85e-49	165
Msa0599600	MtrunA17_Chr4g0070951	32.923	325	156	6	12	277	8	329	3.58e-49	165
Msa0599600	MtrunA17_Chr4g0038161	33.121	314	155	6	17	277	9	320	4.75e-49	165
Msa0599600	MtrunA17_Chr2g0292271	33.333	321	156	5	14	277	11	330	1.88e-48	164
Msa0599600	MtrunA17_Chr4g0013171	32.298	322	165	7	8	277	1	321	3.52e-48	162
Msa0599600	MtrunA17_Chr4g0038151	32.803	314	157	6	16	277	10	321	4.70e-48	162
Msa0599600	MtrunA17_Chr7g0254231	32.770	296	147	6	30	277	20	311	8.80e-48	161
Msa0599600	MtrunA17_Chr4g0043391	31.562	320	162	7	14	277	6	324	1.04e-47	161
Msa0599600	MtrunA17_Chr5g0432441	32.907	313	157	7	17	277	15	326	1.06e-47	161
Msa0599600	MtrunA17_Chr2g0320061	32.484	314	160	6	13	277	8	318	1.37e-47	161
Msa0599600	MtrunA17_Chr2g0320051	32.803	314	159	6	13	277	8	318	1.43e-47	160
Msa0599600	MtrunA17_Chr5g0438021	33.121	314	157	6	17	277	12	325	1.51e-47	161
Msa0599600	MtrunA17_Chr2g0320091	32.484	314	160	7	13	277	8	318	1.57e-47	160
Msa0599600	MtrunA17_Chr8g0364291	32.317	328	160	8	8	277	1	324	4.74e-47	160
Msa0599600	MtrunA17_Chr1g0213061	33.229	319	159	9	10	277	6	321	6.27e-47	159
Msa0599600	MtrunA17_Chr4g0013201	30.887	327	159	6	17	277	13	338	8.64e-47	159
Msa0599600	MtrunA17_Chr4g0038171	32.308	325	163	7	6	277	1	321	2.83e-46	157
Msa0599600	MtrunA17_Chr3g0129061	33.442	308	154	6	16	273	12	318	3.91e-46	157
Msa0599600	MtrunA17_Chr4g0013721	32.143	308	150	6	25	277	93	396	5.95e-46	159
Msa0599600	MtrunA17_Chr2g0320031	31.629	313	166	6	13	277	7	319	7.42e-46	156
Msa0599600	MtrunA17_Chr4g0013191	31.402	328	158	7	17	277	13	340	8.95e-46	157
Msa0599600	MtrunA17_Chr1g0157051	33.123	317	149	8	16	276	8	317	2.29e-45	155
Msa0599600	MtrunA17_Chr2g0292291	32.919	322	153	8	18	277	12	332	2.46e-45	156
Msa0599600	MtrunA17_Chr1g0164891	35.197	304	137	7	33	277	90	392	3.78e-45	156
Msa0599600	MtrunA17_Chr4g0053871	33.866	313	151	6	17	276	14	323	4.08e-45	154
Msa0599600	MtrunA17_Chr2g0292101	32.915	319	155	7	16	277	10	326	1.75e-44	153
Msa0599600	MtrunA17_Chr4g0013181	34.496	258	137	5	51	277	97	353	1.79e-44	154
Msa0599600	MtrunA17_Chr3g0129041	34.202	307	153	7	16	273	12	318	2.86e-44	152
Msa0599600	MtrunA17_Chr5g0401431	32.915	319	155	4	16	276	11	328	3.12e-44	152
Msa0599600	MtrunA17_Chr1g0197411	31.532	333	164	10	4	277	3	330	3.56e-44	152
Msa0599600	MtrunA17_Chr5g0421411	35.145	276	135	9	44	277	12	285	1.00e-43	150
Msa0599600	MtrunA17_Chr5g0400331	34.768	302	137	7	36	277	30	331	2.61e-43	150
Msa0599600	MtrunA17_Chr4g0013821	30.820	305	152	6	28	277	24	324	6.27e-43	149
Msa0599600	MtrunA17_Chr7g0224371	31.034	319	170	6	7	277	6	322	6.59e-43	149
Msa0599600	MtrunA17_Chr3g0136751	31.348	319	157	6	16	277	9	322	9.88e-43	148
Msa0599600	MtrunA17_Chr3g0106901	30.625	320	173	4	6	277	5	323	7.17e-42	146
Msa0599600	MtrunA17_Chr5g0432341	32.492	317	159	9	14	277	7	321	1.08e-41	145
Msa0599600	MtrunA17_Chr4g0046131	32.237	304	145	7	31	274	41	343	1.57e-41	145
Msa0599600	MtrunA17_Chr2g0296621	34.323	303	131	9	32	277	50	341	1.76e-41	145
Msa0599600	MtrunA17_Chr6g0467251	28.923	325	171	7	6	273	3	324	2.27e-41	145
Msa0599600	MtrunA17_Chr5g0432351	31.861	317	161	10	14	277	7	321	1.03e-40	143
Msa0599600	MtrunA17_Chr2g0278671	32.581	310	149	8	25	277	17	323	1.67e-40	142
Msa0599600	MtrunA17_Chr4g0068621	30.921	304	155	6	28	277	34	336	3.66e-40	142
Msa0599600	MtrunA17_Chr1g0194151	31.153	321	161	8	16	277	14	333	4.33e-40	142
Msa0599600	MtrunA17_Chr1g0194271	29.573	328	164	8	16	277	14	340	5.30e-39	139
Msa0599600	MtrunA17_Chr4g0074851	30.034	293	154	3	36	277	36	328	1.01e-38	138
Msa0599600	MtrunA17_Chr1g0155611	31.683	303	149	5	32	277	46	347	2.88e-38	137
Msa0599600	MtrunA17_Chr1g0148021	31.818	330	163	7	8	277	1	328	4.67e-38	136
Msa0599600	MtrunA17_Chr3g0107881	32.508	323	159	10	10	277	6	324	1.93e-37	134
Msa0599600	MtrunA17_Chr4g0072091	30.769	299	149	5	31	273	23	319	4.73e-37	133
Msa0599600	MtrunA17_Chr1g0181511	30.000	300	157	5	30	277	25	323	6.70e-37	133
Msa0599600	MtrunA17_Chr6g0467121	30.909	330	160	9	10	277	40	363	1.18e-36	134
Msa0599600	MtrunA17_Chr4g0076211	31.208	298	142	7	35	277	44	333	1.21e-36	132
Msa0599600	MtrunA17_Chr6g0451571	28.391	317	170	6	17	277	19	334	3.34e-36	131
Msa0599600	MtrunA17_Chr5g0432331	29.755	326	174	9	5	277	29	352	4.38e-36	132
Msa0599600	MtrunA17_Chr6g0467161	29.747	316	164	11	16	277	25	336	4.48e-35	129
Msa0599600	MtrunA17_Chr1g0181431	28.667	300	161	6	30	277	25	323	5.82e-35	128
Msa0599600	MtrunA17_Chr5g0432401	31.142	289	159	9	11	273	8	282	8.18e-35	127
Msa0599600	MtrunA17_Chr2g0329641	30.061	326	161	8	14	277	15	335	2.05e-34	127
Msa0599600	MtrunA17_Chr1g0181481	28.000	300	163	4	30	277	25	323	4.17e-34	125
Msa0599600	MtrunA17_Chr2g0316141	31.047	277	140	7	47	274	1	275	4.94e-33	122
Msa0599600	MtrunA17_Chr2g0316181	31.047	277	140	7	47	274	1	275	4.94e-33	122
Msa0599600	MtrunA17_Chr2g0311251	44.444	153	65	2	30	162	9	161	2.18e-31	119
Msa0599600	MtrunA17_Chr4g0075241	26.646	319	173	7	16	277	13	327	2.86e-30	115
Msa0599600	MtrunA17_Chr2g0316481	42.857	154	67	2	30	162	74	227	3.37e-30	117
Msa0599600	MtrunA17_Chr2g0316791	42.857	154	67	2	30	162	74	227	7.08e-30	116
Msa0599600	MtrunA17_Chr2g0316811	42.208	154	68	2	30	162	48	201	3.58e-29	113
Msa0599600	MtrunA17_Chr2g0316831	40.909	154	70	2	30	162	110	263	1.96e-28	112
Msa0599600	MtrunA17_Chr2g0316191	40.909	154	70	2	30	162	74	227	1.05e-27	110
Msa0599600	MtrunA17_Chr2g0311241	25.000	372	150	8	30	274	58	427	4.51e-27	108
Msa0599600	MtrunA17_Chr5g0413051	28.939	311	162	8	26	277	67	377	1.20e-25	104
Msa0599600	MtrunA17_Chr2g0292281	33.649	211	92	7	104	277	17	216	5.44e-23	94.4
Msa0599600	MtrunA17_Chr4g0004591	28.094	299	137	10	32	274	77	353	1.31e-21	92.8
Msa0599600	MtrunA17_Chr1g0196191	60.938	64	25	0	59	122	31	94	4.05e-20	84.7
Msa0599600	MtrunA17_Chr1g0181491	37.037	108	50	1	30	119	10	117	3.00e-19	82.0
Msa0599600	MtrunA17_Chr7g0268491	43.902	82	45	1	196	277	17	97	4.35e-18	77.4
Msa0599600	MtrunA17_Chr6g0468731	55.224	67	27	1	53	119	23	86	6.23e-18	77.0
Msa0599600	MtrunA17_Chr3g0114491	43.119	109	42	3	31	119	17	125	3.42e-17	76.3
Msa0599600	MtrunA17_Chr7g0254181	38.462	104	60	2	60	162	6	106	1.72e-15	72.0
Msa0599600	MtrunA17_Chr7g0254171	45.205	73	40	0	59	131	4	76	1.68e-14	68.9

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0599600	AT4G11290.1	47.799	318	110	5	16	277	9	326	1.01e-98	292
Msa0599600	AT1G05260.1	48.718	312	104	5	21	277	15	325	3.88e-97	288
Msa0599600	AT3G21770.1	46.602	309	109	5	21	274	18	325	2.09e-90	271
Msa0599600	AT5G15180.1	43.465	329	126	8	6	277	4	329	3.39e-82	250
Msa0599600	AT3G01190.1	42.991	321	120	8	15	277	6	321	5.21e-76	234
Msa0599600	AT1G05240.1	39.404	302	117	8	36	277	30	325	1.20e-63	203
Msa0599600	AT1G05250.1	39.404	302	117	8	36	277	30	325	1.20e-63	203
Msa0599600	AT5G39580.1	36.086	327	144	8	8	277	1	319	5.28e-58	188
Msa0599600	AT4G33420.1	36.246	309	146	8	17	277	20	325	7.69e-56	182
Msa0599600	AT4G33420.2	35.922	309	147	7	17	277	67	372	3.10e-55	182
Msa0599600	AT2G18150.1	34.740	308	144	5	26	277	30	336	6.94e-55	181
Msa0599600	AT5G14130.1	33.962	318	149	8	17	277	17	330	4.24e-53	176
Msa0599600	AT5G51890.1	32.915	319	149	7	17	277	11	322	9.53e-53	174
Msa0599600	AT5G14130.2	33.962	318	149	8	17	277	58	371	1.11e-52	176
Msa0599600	AT2G41480.1	34.234	333	153	9	6	277	1	328	1.34e-52	174
Msa0599600	AT5G17820.1	34.076	314	143	6	18	277	10	313	3.03e-52	173
Msa0599600	AT5G19890.1	34.347	329	148	9	8	277	8	327	3.22e-52	173
Msa0599600	AT3G50990.1	36.156	307	139	5	27	277	36	341	1.40e-51	172
Msa0599600	AT5G17820.2	34.154	325	149	7	7	277	53	366	1.42e-51	173
Msa0599600	AT3G03670.1	32.704	318	158	4	14	277	6	321	1.57e-51	171
Msa0599600	AT2G18140.1	34.985	323	152	7	12	277	14	335	1.63e-51	172
Msa0599600	AT2G39040.1	37.061	313	134	9	26	277	40	350	2.98e-51	172
Msa0599600	AT5G64120.1	33.333	333	154	8	8	277	1	328	5.80e-51	170
Msa0599600	AT4G36430.1	33.019	318	153	6	19	277	14	330	6.13e-51	170
Msa0599600	AT2G24800.1	34.539	304	140	5	30	277	29	329	1.16e-50	169
Msa0599600	AT3G32980.1	31.138	334	169	6	4	277	2	334	5.41e-50	168
Msa0599600	AT5G64100.1	36.333	300	126	8	35	277	40	331	2.73e-49	166
Msa0599600	AT5G66390.1	34.603	315	149	6	19	277	20	333	2.81e-49	166
Msa0599600	AT5G42180.1	33.441	311	148	5	17	273	8	313	4.55e-49	165
Msa0599600	AT1G14550.1	32.381	315	161	7	14	277	8	321	5.21e-49	165
Msa0599600	AT2G38390.1	31.562	320	160	6	16	277	15	333	5.97e-49	166
Msa0599600	AT4G26010.2	34.161	322	158	8	2	277	24	337	1.04e-48	165
Msa0599600	AT5G06730.1	30.503	318	163	6	17	277	18	334	3.36e-48	164
Msa0599600	AT4G26010.1	34.528	307	149	7	17	277	9	309	4.55e-48	162
Msa0599600	AT5G06720.1	30.818	318	162	5	17	277	17	333	6.18e-48	162
Msa0599600	AT4G08770.1	32.698	315	146	7	25	277	17	327	6.65e-48	163
Msa0599600	AT3G49110.1	32.000	325	159	6	14	277	13	336	4.41e-47	161
Msa0599600	AT2G38380.1	31.875	320	159	6	16	277	15	333	4.96e-47	160
Msa0599600	AT1G77100.1	34.098	305	147	7	25	277	17	319	6.33e-47	159
Msa0599600	AT5G05340.1	33.893	298	148	6	29	277	27	324	6.71e-47	159
Msa0599600	AT3G49120.1	31.546	317	157	5	20	277	20	335	7.82e-47	160
Msa0599600	AT1G71695.1	34.228	298	142	6	32	277	44	339	8.78e-47	160
Msa0599600	AT1G34510.1	32.166	314	161	7	9	277	3	309	1.53e-46	158
Msa0599600	AT5G58400.1	34.091	308	152	8	17	273	14	321	3.03e-46	158
Msa0599600	AT4G31760.1	32.177	317	154	6	17	277	15	326	1.67e-45	156
Msa0599600	AT1G14540.1	31.210	314	164	8	14	277	4	315	2.50e-45	155
Msa0599600	AT2G22420.1	30.599	317	160	7	16	277	8	319	4.89e-45	155
Msa0599600	AT3G49960.1	34.568	324	149	6	16	277	7	329	5.98e-45	154
Msa0599600	AT4G37530.1	33.762	311	147	5	25	277	20	329	8.14e-45	154
Msa0599600	AT5G19880.1	31.515	330	165	9	8	277	1	329	1.13e-44	154
Msa0599600	AT2G35380.1	33.851	322	153	7	16	277	14	335	1.31e-44	154
Msa0599600	AT2G18980.1	34.347	329	151	8	8	277	1	323	1.99e-43	150
Msa0599600	AT4G17690.1	31.270	307	158	6	23	277	17	322	2.45e-43	150
Msa0599600	AT1G68850.1	32.979	282	147	8	38	277	54	335	4.63e-43	150
Msa0599600	AT4G21960.1	30.183	328	170	7	8	277	1	327	5.48e-43	149
Msa0599600	AT1G44970.1	33.441	311	149	6	24	277	37	346	8.50e-43	149
Msa0599600	AT5G67400.1	33.333	309	147	4	27	277	22	329	1.24e-42	149
Msa0599600	AT5G64110.1	32.667	300	139	6	35	277	37	330	1.27e-42	149
Msa0599600	AT5G58390.1	31.410	312	161	9	14	273	2	312	1.46e-42	148
Msa0599600	AT4G08780.1	31.111	315	151	7	25	277	17	327	1.73e-42	149
Msa0599600	AT4G16270.1	32.886	298	143	7	35	277	53	348	1.77e-42	149
Msa0599600	AT4G37520.1	33.333	306	145	5	30	277	25	329	4.62e-42	147
Msa0599600	AT1G49570.1	31.579	304	149	7	30	275	46	348	4.64e-42	147
Msa0599600	AT4G25980.1	30.312	320	161	8	17	277	10	326	1.19e-40	143
Msa0599600	AT5G40150.1	29.801	302	161	3	27	277	27	328	2.11e-40	143
Msa0599600	AT4G37520.2	33.333	306	142	6	30	277	25	326	6.59e-40	141
Msa0599600	AT4G33870.1	29.254	335	147	6	29	274	65	398	2.67e-39	142
Msa0599600	AT3G28200.1	28.571	301	165	3	27	277	16	316	4.33e-38	136
Msa0599600	AT5G47000.1	30.218	321	161	9	16	277	14	330	8.15e-38	136
Msa0599600	AT5G22410.1	31.230	317	152	12	16	273	12	321	1.39e-36	133
Msa0599600	AT2G34060.1	30.263	304	153	5	29	273	39	342	5.81e-36	131
Msa0599600	AT1G24110.1	28.115	313	167	5	19	273	6	318	3.43e-35	129
Msa0599600	AT4G30170.1	31.373	306	147	6	30	277	25	325	3.66e-35	129
Msa0599600	AT2G35380.2	35.102	245	118	6	74	277	3	247	5.10e-35	126
Msa0599600	AT2G43480.1	34.749	259	125	6	58	277	82	335	9.83e-35	128
Msa0599600	AT4G37530.2	33.840	263	115	5	25	229	20	281	4.28e-34	125
Msa0599600	AT1G30870.1	31.353	303	143	8	32	277	51	345	2.68e-33	124
Msa0599600	AT5G24070.1	30.744	309	164	9	10	277	36	335	4.36e-33	124
Msa0599600	AT5G39580.2	34.934	229	102	7	8	214	1	204	1.91e-32	119
Msa0599600	AT2G37130.1	27.152	302	166	5	29	277	27	327	1.71e-31	119
Msa0599600	AT2G37130.2	27.458	295	160	5	36	277	3	296	8.34e-31	117
Msa0599600	AT3G17070.1	26.543	324	174	8	12	273	14	335	3.14e-27	108
Msa0599600	AT4G25980.2	39.850	133	59	2	26	139	65	195	1.02e-26	105
Msa0599600	AT2G24800.2	41.791	134	56	2	30	144	29	159	3.09e-26	103
Msa0599600	AT3G17070.2	27.381	252	146	5	59	273	21	272	1.28e-23	97.4
Msa0599600	AT3G42570.1	35.165	91	58	1	75	164	44	134	5.98e-13	65.5

Find 49 sgRNAs with CRISPR-Local

Find 242 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
CTCTGCCAATTACATGAAAA+TGG	0.170365	4_2:+39433954	Msa0599600:CDS
ATTTGTCTTATAGCAATAAT+TGG	0.198586	4_2:+39434006	Msa0599600:CDS
ATTTGCAGGGTGGGCCTTAT+TGG	0.254925	4_2:+39435057	Msa0599600:intron
AAAACAATTTGTTCAGCTTT+GGG	0.265521	4_2:-39434075	None:intergenic
CAAAACAATTTGTTCAGCTT+TGG	0.265636	4_2:-39434076	None:intergenic
GCATATTCACCGTCTAGATC+TGG	0.345112	4_2:-39435674	None:intergenic
TAGCCTCGAAGTGTAAGATT+TGG	0.347680	4_2:-39434501	None:intergenic
GGAAGGTTCCAACAGGTAGA+AGG	0.383934	4_2:+39435078	Msa0599600:CDS
GGGAGAATTAATGTCAAGAT+TGG	0.389587	4_2:+39435938	Msa0599600:CDS
TCAAATGTATTACGACTTCC+AGG	0.390217	4_2:-39435761	None:intergenic
TCAAACCACACTTATTGAAA+TGG	0.390578	4_2:+39435736	Msa0599600:CDS
AGTCGTAATACATTTGATCT+TGG	0.396009	4_2:+39435767	Msa0599600:CDS
ACTGTCCTCCTAACACTCTT+TGG	0.396163	4_2:+39435164	Msa0599600:CDS
CAACATTGCCAAAGAGTGTT+AGG	0.396433	4_2:-39435172	None:intergenic
TAAGCAATGCAGCATCTGAT+TGG	0.403489	4_2:-39435826	None:intergenic
AGCATCCTTCTCAGCTTGAT+TGG	0.415273	4_2:-39434475	None:intergenic
TTAAAACCTTGAAGTAACTC+TGG	0.458221	4_2:-39433981	None:intergenic
CCTGTTGGAACCTTCCAATA+AGG	0.463341	4_2:-39435071	None:intergenic
GGGAATCCAGAGTTACTTCA+AGG	0.464095	4_2:+39433975	Msa0599600:CDS
ATTCCAAATCTTACACTTCG+AGG	0.467504	4_2:+39434498	Msa0599600:CDS
TCTGCCAATTACATGAAAAT+GGG	0.474216	4_2:+39433955	Msa0599600:CDS
GCAGGGTGGGCCTTATTGGA+AGG	0.485522	4_2:+39435061	Msa0599600:intron
CAAGCAAGTAGTTAAGAGAA+GGG	0.488778	4_2:+39435796	Msa0599600:CDS
TCAAGCAAGTAGTTAAGAGA+AGG	0.493471	4_2:+39435795	Msa0599600:CDS
CATATTCACCGTCTAGATCT+GGG	0.504303	4_2:-39435673	None:intergenic
CCTTATTGGAAGGTTCCAAC+AGG	0.506222	4_2:+39435071	Msa0599600:CDS
AGGACAGTGAGGTTGTGAAA+TGG	0.507765	4_2:-39435149	None:intergenic
TAATGAATTTGGCAAGTCCA+TGG	0.508920	4_2:+39435907	Msa0599600:CDS
GGAGAATTAATGTCAAGATT+GGG	0.509355	4_2:+39435939	Msa0599600:CDS
ACTCCATCCCTTCTACCTGT+TGG	0.547709	4_2:-39435086	None:intergenic
GTGAGGTTGTGAAATGGAGC+AGG	0.547960	4_2:-39435143	None:intergenic
GAAGGTTCCAACAGGTAGAA+GGG	0.566125	4_2:+39435079	Msa0599600:CDS
ACTCATGCTCAATTGCAGCC+AGG	0.571279	4_2:+39434033	Msa0599600:CDS
ACAAACCAATCAAGCTGAGA+AGG	0.572023	4_2:+39434470	Msa0599600:CDS
GTTCCAACAGGTAGAAGGGA+TGG	0.572964	4_2:+39435083	Msa0599600:CDS
AGGGTCCATTTCAATAAGTG+TGG	0.580715	4_2:-39435741	None:intergenic
AATGTCAAGATTGGGACTGA+GGG	0.584429	4_2:+39435947	Msa0599600:CDS
ACACTTATTGAAATGGACCC+TGG	0.584876	4_2:+39435743	Msa0599600:CDS
AAGCAAGTAGTTAAGAGAAG+GGG	0.586770	4_2:+39435797	Msa0599600:CDS
TCAGCACAAGAGACAACACC+AGG	0.593653	4_2:-39434567	None:intergenic
AAACAATTTGTTCAGCTTTG+GGG	0.596812	4_2:-39434074	None:intergenic
TAATGTCAAGATTGGGACTG+AGG	0.599035	4_2:+39435946	Msa0599600:CDS
ATTTCAGGGATGTGATGCAT+CGG	0.627600	4_2:+39434431	Msa0599600:intron
GATCAAGACCCAGATCTAGA+CGG	0.657297	4_2:+39435665	Msa0599600:CDS
GGTTGTGAAATGGAGCAGGA+AGG	0.663275	4_2:-39435139	None:intergenic
CATTGCCAAAGAGTGTTAGG+AGG	0.665435	4_2:-39435169	None:intergenic
AGAGTGTTAGGAGGACAGTG+AGG	0.689613	4_2:-39435160	None:intergenic
CAAATGTATTACGACTTCCA+GGG	0.691933	4_2:-39435760	None:intergenic
CAGCACAAGAGACAACACCA+GGG	0.782900	4_2:-39434566	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	ATTAGATAAATAATGTTATT+TGG	+	chr4_2:39434869-39434888	Msa0599600:intron	10.0%
!!	TAATTTAAGAAAATAAAAGT+AGG	+	chr4_2:39435404-39435423	Msa0599600:intron	10.0%
!!!	TTACTTTTTTTTTAAAAACT+CGG	-	chr4_2:39435451-39435470	None:intergenic	10.0%
!!	ATTAGATAAATAATGTTATT+TGG	+	chr4_2:39434869-39434888	Msa0599600:intron	10.0%
!!	TAATTTAAGAAAATAAAAGT+AGG	+	chr4_2:39435404-39435423	Msa0599600:intron	10.0%
!!!	TTACTTTTTTTTTAAAAACT+CGG	-	chr4_2:39435451-39435470	None:intergenic	10.0%
!!	GTTTAGTATGTATAATTATT+TGG	+	chr4_2:39434980-39434999	Msa0599600:intron	15.0%
!!!	GTATAATTATTTGGTTTTAT+AGG	+	chr4_2:39434989-39435008	Msa0599600:intron	15.0%
!!	GAAAAATTCTTTAATGAATT+TGG	+	chr4_2:39435896-39435915	Msa0599600:CDS	15.0%
!!	GTTTAGTATGTATAATTATT+TGG	+	chr4_2:39434980-39434999	Msa0599600:intron	15.0%
!!!	GTATAATTATTTGGTTTTAT+AGG	+	chr4_2:39434989-39435008	Msa0599600:intron	15.0%
!!	GAAAAATTCTTTAATGAATT+TGG	+	chr4_2:39435896-39435915	Msa0599600:CDS	15.0%
!!	ATTTGTCTTATAGCAATAAT+TGG	+	chr4_2:39434006-39434025	Msa0599600:CDS	20.0%
!!!	CAAAATATTTTGAAGTGTTT+TGG	-	chr4_2:39434720-39434739	None:intergenic	20.0%
!!!	CAAAACACTTCAAAATATTT+TGG	+	chr4_2:39434718-39434737	Msa0599600:intron	20.0%
!!!	ATATTTTGGATTTTTGAATC+TGG	+	chr4_2:39434732-39434751	Msa0599600:intron	20.0%
!!!	TATTTTGGATTTTTGAATCT+GGG	+	chr4_2:39434733-39434752	Msa0599600:intron	20.0%
!!	TCTGATATGCTATATATATT+TGG	+	chr4_2:39434807-39434826	Msa0599600:intron	20.0%
!!	CTGATATGCTATATATATTT+GGG	+	chr4_2:39434808-39434827	Msa0599600:intron	20.0%
!!	ATTTGTCTTATAGCAATAAT+TGG	+	chr4_2:39434006-39434025	Msa0599600:CDS	20.0%
!!!	CAAAATATTTTGAAGTGTTT+TGG	-	chr4_2:39434720-39434739	None:intergenic	20.0%
!!!	CAAAACACTTCAAAATATTT+TGG	+	chr4_2:39434718-39434737	Msa0599600:intron	20.0%
!!!	ATATTTTGGATTTTTGAATC+TGG	+	chr4_2:39434732-39434751	Msa0599600:intron	20.0%
!!!	TATTTTGGATTTTTGAATCT+GGG	+	chr4_2:39434733-39434752	Msa0599600:intron	20.0%
!!	TCTGATATGCTATATATATT+TGG	+	chr4_2:39434807-39434826	Msa0599600:intron	20.0%
!!	CTGATATGCTATATATATTT+GGG	+	chr4_2:39434808-39434827	Msa0599600:intron	20.0%
!!	AAAACAATTTGTTCAGCTTT+GGG	-	chr4_2:39434078-39434097	None:intergenic	25.0%
!!	TTATTATCTTGTTGTGAATG+TGG	+	chr4_2:39434394-39434413	Msa0599600:intron	25.0%
!!!	AATATTTTGAAGTGTTTTGG+AGG	-	chr4_2:39434717-39434736	None:intergenic	25.0%
!!	TAATGTTATTTGGTTATGCA+TGG	+	chr4_2:39434879-39434898	Msa0599600:intron	25.0%
!!!	TTTAGTTTGTGTGTAGAATT+TGG	-	chr4_2:39435236-39435255	None:intergenic	25.0%
!	AATAAAAAAAGCAGTCAGAT+GGG	-	chr4_2:39435297-39435316	None:intergenic	25.0%
!	ACCAAAACTATCATTATTTC+AGG	+	chr4_2:39435572-39435591	Msa0599600:intron	25.0%
!!	ACCTGAAATAATGATAGTTT+TGG	-	chr4_2:39435576-39435595	None:intergenic	25.0%
!!	ACAAGGCTATATAATTTTAC+TGG	+	chr4_2:39435635-39435654	Msa0599600:intron	25.0%
!!	CTATATAATTTTACTGGCAA+GGG	+	chr4_2:39435641-39435660	Msa0599600:intron	25.0%
!!	AAAACAATTTGTTCAGCTTT+GGG	-	chr4_2:39434078-39434097	None:intergenic	25.0%
!!	TTATTATCTTGTTGTGAATG+TGG	+	chr4_2:39434394-39434413	Msa0599600:intron	25.0%
!!!	AATATTTTGAAGTGTTTTGG+AGG	-	chr4_2:39434717-39434736	None:intergenic	25.0%
!!	TAATGTTATTTGGTTATGCA+TGG	+	chr4_2:39434879-39434898	Msa0599600:intron	25.0%
!!!	TTTAGTTTGTGTGTAGAATT+TGG	-	chr4_2:39435236-39435255	None:intergenic	25.0%
!	AATAAAAAAAGCAGTCAGAT+GGG	-	chr4_2:39435297-39435316	None:intergenic	25.0%
!	ACCAAAACTATCATTATTTC+AGG	+	chr4_2:39435572-39435591	Msa0599600:intron	25.0%
!!	ACCTGAAATAATGATAGTTT+TGG	-	chr4_2:39435576-39435595	None:intergenic	25.0%
!!	ACAAGGCTATATAATTTTAC+TGG	+	chr4_2:39435635-39435654	Msa0599600:intron	25.0%
!!	CTATATAATTTTACTGGCAA+GGG	+	chr4_2:39435641-39435660	Msa0599600:intron	25.0%
	TCTGCCAATTACATGAAAAT+GGG	+	chr4_2:39433955-39433974	Msa0599600:CDS	30.0%
!	GATTCCCATTTTCATGTAAT+TGG	-	chr4_2:39433962-39433981	None:intergenic	30.0%
	TTAAAACCTTGAAGTAACTC+TGG	-	chr4_2:39433984-39434003	None:intergenic	30.0%
!	AAACAATTTGTTCAGCTTTG+GGG	-	chr4_2:39434077-39434096	None:intergenic	30.0%
!	CAAAACAATTTGTTCAGCTT+TGG	-	chr4_2:39434079-39434098	None:intergenic	30.0%
!!!	ATATTTTGACTTTGACTGCT+AGG	+	chr4_2:39434589-39434608	Msa0599600:CDS	30.0%
!!!	TATTTTGACTTTGACTGCTA+GGG	+	chr4_2:39434590-39434609	Msa0599600:CDS	30.0%
!!!	GTGTTTTGGAGGTTTTTATA+GGG	-	chr4_2:39434706-39434725	None:intergenic	30.0%
!!!	AGTGTTTTGGAGGTTTTTAT+AGG	-	chr4_2:39434707-39434726	None:intergenic	30.0%
	CTATACGCTAGTAATGATAA+TGG	-	chr4_2:39435261-39435280	None:intergenic	30.0%
	CAATAAAAAAAGCAGTCAGA+TGG	-	chr4_2:39435298-39435317	None:intergenic	30.0%
!!	TTTAAAAAAAAGCACCGTCA+CGG	+	chr4_2:39435339-39435358	Msa0599600:intron	30.0%
!	GTCAATATTTAAAACTGACG+TGG	+	chr4_2:39435487-39435506	Msa0599600:intron	30.0%
	ATGTCTTCTATATGAAGTGT+CGG	+	chr4_2:39435520-39435539	Msa0599600:intron	30.0%
	TGTTGAAATTGATGAGCAAT+GGG	-	chr4_2:39435618-39435637	None:intergenic	30.0%
	TTGTTGAAATTGATGAGCAA+TGG	-	chr4_2:39435619-39435638	None:intergenic	30.0%
	ATTGCTCATCAATTTCAACA+AGG	+	chr4_2:39435618-39435637	Msa0599600:intron	30.0%
!	GCTATATAATTTTACTGGCA+AGG	+	chr4_2:39435640-39435659	Msa0599600:intron	30.0%
	TCAAACCACACTTATTGAAA+TGG	+	chr4_2:39435736-39435755	Msa0599600:CDS	30.0%
	AGTCGTAATACATTTGATCT+TGG	+	chr4_2:39435767-39435786	Msa0599600:CDS	30.0%
	GGAGAATTAATGTCAAGATT+GGG	+	chr4_2:39435939-39435958	Msa0599600:CDS	30.0%
	TCTGCCAATTACATGAAAAT+GGG	+	chr4_2:39433955-39433974	Msa0599600:CDS	30.0%
!	GATTCCCATTTTCATGTAAT+TGG	-	chr4_2:39433962-39433981	None:intergenic	30.0%
	TTAAAACCTTGAAGTAACTC+TGG	-	chr4_2:39433984-39434003	None:intergenic	30.0%
!	AAACAATTTGTTCAGCTTTG+GGG	-	chr4_2:39434077-39434096	None:intergenic	30.0%
!	CAAAACAATTTGTTCAGCTT+TGG	-	chr4_2:39434079-39434098	None:intergenic	30.0%
!!!	ATATTTTGACTTTGACTGCT+AGG	+	chr4_2:39434589-39434608	Msa0599600:CDS	30.0%
!!!	TATTTTGACTTTGACTGCTA+GGG	+	chr4_2:39434590-39434609	Msa0599600:CDS	30.0%
!!!	GTGTTTTGGAGGTTTTTATA+GGG	-	chr4_2:39434706-39434725	None:intergenic	30.0%
!!!	AGTGTTTTGGAGGTTTTTAT+AGG	-	chr4_2:39434707-39434726	None:intergenic	30.0%
	CTATACGCTAGTAATGATAA+TGG	-	chr4_2:39435261-39435280	None:intergenic	30.0%
	CAATAAAAAAAGCAGTCAGA+TGG	-	chr4_2:39435298-39435317	None:intergenic	30.0%
!!	TTTAAAAAAAAGCACCGTCA+CGG	+	chr4_2:39435339-39435358	Msa0599600:intron	30.0%
!	GTCAATATTTAAAACTGACG+TGG	+	chr4_2:39435487-39435506	Msa0599600:intron	30.0%
	ATGTCTTCTATATGAAGTGT+CGG	+	chr4_2:39435520-39435539	Msa0599600:intron	30.0%
	TGTTGAAATTGATGAGCAAT+GGG	-	chr4_2:39435618-39435637	None:intergenic	30.0%
	TTGTTGAAATTGATGAGCAA+TGG	-	chr4_2:39435619-39435638	None:intergenic	30.0%
	ATTGCTCATCAATTTCAACA+AGG	+	chr4_2:39435618-39435637	Msa0599600:intron	30.0%
!	GCTATATAATTTTACTGGCA+AGG	+	chr4_2:39435640-39435659	Msa0599600:intron	30.0%
	TCAAACCACACTTATTGAAA+TGG	+	chr4_2:39435736-39435755	Msa0599600:CDS	30.0%
	AGTCGTAATACATTTGATCT+TGG	+	chr4_2:39435767-39435786	Msa0599600:CDS	30.0%
	GGAGAATTAATGTCAAGATT+GGG	+	chr4_2:39435939-39435958	Msa0599600:CDS	30.0%
	CTCTGCCAATTACATGAAAA+TGG	+	chr4_2:39433954-39433973	Msa0599600:CDS	35.0%
	TTTCCATGATTGCTTTGTCA+AGG	+	chr4_2:39434161-39434180	Msa0599600:intron	35.0%
	ATACCTTGACAAAGCAATCA+TGG	-	chr4_2:39434167-39434186	None:intergenic	35.0%
!!	TAGCATCGACATATTAATGC+AGG	-	chr4_2:39434253-39434272	None:intergenic	35.0%
	TTGAATAGAATCACGTGTGT+TGG	+	chr4_2:39434296-39434315	Msa0599600:intron	35.0%
	AACTAACATCTGGCATTTCA+GGG	+	chr4_2:39434417-39434436	Msa0599600:intron	35.0%
	ATTCCAAATCTTACACTTCG+AGG	+	chr4_2:39434498-39434517	Msa0599600:CDS	35.0%
!	GGTTTTTATAGGGTGAGAAA+AGG	-	chr4_2:39434696-39434715	None:intergenic	35.0%
!	TTGGATTTTTGAATCTGGGT+TGG	+	chr4_2:39434737-39434756	Msa0599600:intron	35.0%
!	TGGATTTTTGAATCTGGGTT+GGG	+	chr4_2:39434738-39434757	Msa0599600:intron	35.0%
	ATCATGGCAGAACAAACAAA+TGG	-	chr4_2:39435029-39435048	None:intergenic	35.0%
	ATGATTGACATGGATTTGCA+GGG	+	chr4_2:39435044-39435063	Msa0599600:intron	35.0%
	CAAATGTATTACGACTTCCA+GGG	-	chr4_2:39435763-39435782	None:intergenic	35.0%
	TCAAATGTATTACGACTTCC+AGG	-	chr4_2:39435764-39435783	None:intergenic	35.0%
	TCAAGCAAGTAGTTAAGAGA+AGG	+	chr4_2:39435795-39435814	Msa0599600:CDS	35.0%
	CAAGCAAGTAGTTAAGAGAA+GGG	+	chr4_2:39435796-39435815	Msa0599600:CDS	35.0%
	AAGCAAGTAGTTAAGAGAAG+GGG	+	chr4_2:39435797-39435816	Msa0599600:CDS	35.0%
	TAATGAATTTGGCAAGTCCA+TGG	+	chr4_2:39435907-39435926	Msa0599600:CDS	35.0%
!!!	AATTCTCCCCATTTTTTCCA+TGG	-	chr4_2:39435927-39435946	None:intergenic	35.0%
	GGGAGAATTAATGTCAAGAT+TGG	+	chr4_2:39435938-39435957	Msa0599600:CDS	35.0%
	CTCTGCCAATTACATGAAAA+TGG	+	chr4_2:39433954-39433973	Msa0599600:CDS	35.0%
	TTTCCATGATTGCTTTGTCA+AGG	+	chr4_2:39434161-39434180	Msa0599600:intron	35.0%
	ATACCTTGACAAAGCAATCA+TGG	-	chr4_2:39434167-39434186	None:intergenic	35.0%
!!	TAGCATCGACATATTAATGC+AGG	-	chr4_2:39434253-39434272	None:intergenic	35.0%
	TTGAATAGAATCACGTGTGT+TGG	+	chr4_2:39434296-39434315	Msa0599600:intron	35.0%
	AACTAACATCTGGCATTTCA+GGG	+	chr4_2:39434417-39434436	Msa0599600:intron	35.0%
	ATTCCAAATCTTACACTTCG+AGG	+	chr4_2:39434498-39434517	Msa0599600:CDS	35.0%
!	GGTTTTTATAGGGTGAGAAA+AGG	-	chr4_2:39434696-39434715	None:intergenic	35.0%
!	TTGGATTTTTGAATCTGGGT+TGG	+	chr4_2:39434737-39434756	Msa0599600:intron	35.0%
!	TGGATTTTTGAATCTGGGTT+GGG	+	chr4_2:39434738-39434757	Msa0599600:intron	35.0%
	ATCATGGCAGAACAAACAAA+TGG	-	chr4_2:39435029-39435048	None:intergenic	35.0%
	ATGATTGACATGGATTTGCA+GGG	+	chr4_2:39435044-39435063	Msa0599600:intron	35.0%
	CAAATGTATTACGACTTCCA+GGG	-	chr4_2:39435763-39435782	None:intergenic	35.0%
	TCAAATGTATTACGACTTCC+AGG	-	chr4_2:39435764-39435783	None:intergenic	35.0%
	TCAAGCAAGTAGTTAAGAGA+AGG	+	chr4_2:39435795-39435814	Msa0599600:CDS	35.0%
	CAAGCAAGTAGTTAAGAGAA+GGG	+	chr4_2:39435796-39435815	Msa0599600:CDS	35.0%
	AAGCAAGTAGTTAAGAGAAG+GGG	+	chr4_2:39435797-39435816	Msa0599600:CDS	35.0%
	TAATGAATTTGGCAAGTCCA+TGG	+	chr4_2:39435907-39435926	Msa0599600:CDS	35.0%
!!!	AATTCTCCCCATTTTTTCCA+TGG	-	chr4_2:39435927-39435946	None:intergenic	35.0%
	GGGAGAATTAATGTCAAGAT+TGG	+	chr4_2:39435938-39435957	Msa0599600:CDS	35.0%
!	CAGCTTTTAGCATAGAAACC+TGG	-	chr4_2:39434054-39434073	None:intergenic	40.0%
!	ACGTCTTTCATCAGAAGTGT+CGG	+	chr4_2:39434346-39434365	Msa0599600:intron	40.0%
	GTGAATGTGGAACTAACATC+TGG	+	chr4_2:39434407-39434426	Msa0599600:intron	40.0%
	GAACTAACATCTGGCATTTC+AGG	+	chr4_2:39434416-39434435	Msa0599600:intron	40.0%
	ATTTCAGGGATGTGATGCAT+CGG	+	chr4_2:39434431-39434450	Msa0599600:intron	40.0%
	ACAAACCAATCAAGCTGAGA+AGG	+	chr4_2:39434470-39434489	Msa0599600:CDS	40.0%
	TAGCCTCGAAGTGTAAGATT+TGG	-	chr4_2:39434504-39434523	None:intergenic	40.0%
!!!	CAGGGCATTCTTTTTCAACA+AGG	-	chr4_2:39434551-39434570	None:intergenic	40.0%
	CTTGTTGAAAAAGAATGCCC+TGG	+	chr4_2:39434549-39434568	Msa0599600:CDS	40.0%
	TTGTTCTGCCATGATTGACA+TGG	+	chr4_2:39435034-39435053	Msa0599600:intron	40.0%
	CTGCAAATCCATGTCAATCA+TGG	-	chr4_2:39435045-39435064	None:intergenic	40.0%
	CATGATTGACATGGATTTGC+AGG	+	chr4_2:39435043-39435062	Msa0599600:intron	40.0%
!!	CAACATTGCCAAAGAGTGTT+AGG	-	chr4_2:39435175-39435194	None:intergenic	40.0%
	CTAACACTCTTTGGCAATGT+TGG	+	chr4_2:39435173-39435192	Msa0599600:intron	40.0%
!!	AATGACCTAGTCTTGCTTTC+CGG	+	chr4_2:39435206-39435225	Msa0599600:intron	40.0%
	GTGTGTAGAATTTGGCATAC+CGG	-	chr4_2:39435228-39435247	None:intergenic	40.0%
!	GTTGTATTTGATGACCGTGA+CGG	-	chr4_2:39435356-39435375	None:intergenic	40.0%
!	ATTTCAGGTGCACACACAAT+TGG	+	chr4_2:39435587-39435606	Msa0599600:intron	40.0%
	CATATTCACCGTCTAGATCT+GGG	-	chr4_2:39435676-39435695	None:intergenic	40.0%
	AGGGTCCATTTCAATAAGTG+TGG	-	chr4_2:39435744-39435763	None:intergenic	40.0%
	ACACTTATTGAAATGGACCC+TGG	+	chr4_2:39435743-39435762	Msa0599600:CDS	40.0%
	TAAGCAATGCAGCATCTGAT+TGG	-	chr4_2:39435829-39435848	None:intergenic	40.0%
	TGGCAAGTCCATGGAAAAAA+TGG	+	chr4_2:39435916-39435935	Msa0599600:CDS	40.0%
	GGCAAGTCCATGGAAAAAAT+GGG	+	chr4_2:39435917-39435936	Msa0599600:CDS	40.0%
	GCAAGTCCATGGAAAAAATG+GGG	+	chr4_2:39435918-39435937	Msa0599600:CDS	40.0%
	TAATGTCAAGATTGGGACTG+AGG	+	chr4_2:39435946-39435965	Msa0599600:CDS	40.0%
	AATGTCAAGATTGGGACTGA+GGG	+	chr4_2:39435947-39435966	Msa0599600:CDS	40.0%
!	CAGCTTTTAGCATAGAAACC+TGG	-	chr4_2:39434054-39434073	None:intergenic	40.0%
!	ACGTCTTTCATCAGAAGTGT+CGG	+	chr4_2:39434346-39434365	Msa0599600:intron	40.0%
	GTGAATGTGGAACTAACATC+TGG	+	chr4_2:39434407-39434426	Msa0599600:intron	40.0%
	GAACTAACATCTGGCATTTC+AGG	+	chr4_2:39434416-39434435	Msa0599600:intron	40.0%
	ATTTCAGGGATGTGATGCAT+CGG	+	chr4_2:39434431-39434450	Msa0599600:intron	40.0%
	ACAAACCAATCAAGCTGAGA+AGG	+	chr4_2:39434470-39434489	Msa0599600:CDS	40.0%
	TAGCCTCGAAGTGTAAGATT+TGG	-	chr4_2:39434504-39434523	None:intergenic	40.0%
!!!	CAGGGCATTCTTTTTCAACA+AGG	-	chr4_2:39434551-39434570	None:intergenic	40.0%
	CTTGTTGAAAAAGAATGCCC+TGG	+	chr4_2:39434549-39434568	Msa0599600:CDS	40.0%
	TTGTTCTGCCATGATTGACA+TGG	+	chr4_2:39435034-39435053	Msa0599600:intron	40.0%
	CTGCAAATCCATGTCAATCA+TGG	-	chr4_2:39435045-39435064	None:intergenic	40.0%
	CATGATTGACATGGATTTGC+AGG	+	chr4_2:39435043-39435062	Msa0599600:intron	40.0%
!!	CAACATTGCCAAAGAGTGTT+AGG	-	chr4_2:39435175-39435194	None:intergenic	40.0%
	CTAACACTCTTTGGCAATGT+TGG	+	chr4_2:39435173-39435192	Msa0599600:intron	40.0%
!!	AATGACCTAGTCTTGCTTTC+CGG	+	chr4_2:39435206-39435225	Msa0599600:intron	40.0%
	GTGTGTAGAATTTGGCATAC+CGG	-	chr4_2:39435228-39435247	None:intergenic	40.0%
!	GTTGTATTTGATGACCGTGA+CGG	-	chr4_2:39435356-39435375	None:intergenic	40.0%
!	ATTTCAGGTGCACACACAAT+TGG	+	chr4_2:39435587-39435606	Msa0599600:intron	40.0%
	CATATTCACCGTCTAGATCT+GGG	-	chr4_2:39435676-39435695	None:intergenic	40.0%
	AGGGTCCATTTCAATAAGTG+TGG	-	chr4_2:39435744-39435763	None:intergenic	40.0%
	ACACTTATTGAAATGGACCC+TGG	+	chr4_2:39435743-39435762	Msa0599600:CDS	40.0%
	TAAGCAATGCAGCATCTGAT+TGG	-	chr4_2:39435829-39435848	None:intergenic	40.0%
	TGGCAAGTCCATGGAAAAAA+TGG	+	chr4_2:39435916-39435935	Msa0599600:CDS	40.0%
	GGCAAGTCCATGGAAAAAAT+GGG	+	chr4_2:39435917-39435936	Msa0599600:CDS	40.0%
	GCAAGTCCATGGAAAAAATG+GGG	+	chr4_2:39435918-39435937	Msa0599600:CDS	40.0%
	TAATGTCAAGATTGGGACTG+AGG	+	chr4_2:39435946-39435965	Msa0599600:CDS	40.0%
	AATGTCAAGATTGGGACTGA+GGG	+	chr4_2:39435947-39435966	Msa0599600:CDS	40.0%
	GGGAATCCAGAGTTACTTCA+AGG	+	chr4_2:39433975-39433994	Msa0599600:CDS	45.0%
	CTTCTGATGAAAGACGTGTC+TGG	-	chr4_2:39434343-39434362	None:intergenic	45.0%
	AGCATCCTTCTCAGCTTGAT+TGG	-	chr4_2:39434478-39434497	None:intergenic	45.0%
	ATTGACATGGATTTGCAGGG+TGG	+	chr4_2:39435047-39435066	Msa0599600:intron	45.0%
	TTGACATGGATTTGCAGGGT+GGG	+	chr4_2:39435048-39435067	Msa0599600:intron	45.0%
	CCTGTTGGAACCTTCCAATA+AGG	-	chr4_2:39435074-39435093	None:intergenic	45.0%
	CCTTATTGGAAGGTTCCAAC+AGG	+	chr4_2:39435071-39435090	Msa0599600:CDS	45.0%
	GAAGGTTCCAACAGGTAGAA+GGG	+	chr4_2:39435079-39435098	Msa0599600:CDS	45.0%
	AGGACAGTGAGGTTGTGAAA+TGG	-	chr4_2:39435152-39435171	None:intergenic	45.0%
	ACTGTCCTCCTAACACTCTT+TGG	+	chr4_2:39435164-39435183	Msa0599600:CDS	45.0%
!!	CATTGCCAAAGAGTGTTAGG+AGG	-	chr4_2:39435172-39435191	None:intergenic	45.0%
	GATCAAGACCCAGATCTAGA+CGG	+	chr4_2:39435665-39435684	Msa0599600:CDS	45.0%
	GCATATTCACCGTCTAGATC+TGG	-	chr4_2:39435677-39435696	None:intergenic	45.0%
	GGGAATCCAGAGTTACTTCA+AGG	+	chr4_2:39433975-39433994	Msa0599600:CDS	45.0%
	CTTCTGATGAAAGACGTGTC+TGG	-	chr4_2:39434343-39434362	None:intergenic	45.0%
	AGCATCCTTCTCAGCTTGAT+TGG	-	chr4_2:39434478-39434497	None:intergenic	45.0%
	ATTGACATGGATTTGCAGGG+TGG	+	chr4_2:39435047-39435066	Msa0599600:intron	45.0%
	TTGACATGGATTTGCAGGGT+GGG	+	chr4_2:39435048-39435067	Msa0599600:intron	45.0%
	CCTGTTGGAACCTTCCAATA+AGG	-	chr4_2:39435074-39435093	None:intergenic	45.0%
	CCTTATTGGAAGGTTCCAAC+AGG	+	chr4_2:39435071-39435090	Msa0599600:CDS	45.0%
	GAAGGTTCCAACAGGTAGAA+GGG	+	chr4_2:39435079-39435098	Msa0599600:CDS	45.0%
	AGGACAGTGAGGTTGTGAAA+TGG	-	chr4_2:39435152-39435171	None:intergenic	45.0%
	ACTGTCCTCCTAACACTCTT+TGG	+	chr4_2:39435164-39435183	Msa0599600:CDS	45.0%
!!	CATTGCCAAAGAGTGTTAGG+AGG	-	chr4_2:39435172-39435191	None:intergenic	45.0%
	GATCAAGACCCAGATCTAGA+CGG	+	chr4_2:39435665-39435684	Msa0599600:CDS	45.0%
	GCATATTCACCGTCTAGATC+TGG	-	chr4_2:39435677-39435696	None:intergenic	45.0%
!!!	TTATTTTCTTAAATTAATAT+TGG	-	chr4_2:39435400-39435419	None:intergenic	5.0%
!!!	TTATTTTCTTAAATTAATAT+TGG	-	chr4_2:39435400-39435419	None:intergenic	5.0%
	ACTCATGCTCAATTGCAGCC+AGG	+	chr4_2:39434033-39434052	Msa0599600:CDS	50.0%
	GCTGCTAGTGATGGTACACT+AGG	-	chr4_2:39434123-39434142	None:intergenic	50.0%
	ATGAGTGCAGCTGCTAGTGA+TGG	-	chr4_2:39434132-39434151	None:intergenic	50.0%
	CAGCACAAGAGACAACACCA+GGG	-	chr4_2:39434569-39434588	None:intergenic	50.0%
	TCAGCACAAGAGACAACACC+AGG	-	chr4_2:39434570-39434589	None:intergenic	50.0%
!	ATTTGCAGGGTGGGCCTTAT+TGG	+	chr4_2:39435057-39435076	Msa0599600:intron	50.0%
	GGAAGGTTCCAACAGGTAGA+AGG	+	chr4_2:39435078-39435097	Msa0599600:CDS	50.0%
	GTTCCAACAGGTAGAAGGGA+TGG	+	chr4_2:39435083-39435102	Msa0599600:CDS	50.0%
	ACTCCATCCCTTCTACCTGT+TGG	-	chr4_2:39435089-39435108	None:intergenic	50.0%
	GGTTGTGAAATGGAGCAGGA+AGG	-	chr4_2:39435142-39435161	None:intergenic	50.0%
	GTGAGGTTGTGAAATGGAGC+AGG	-	chr4_2:39435146-39435165	None:intergenic	50.0%
!	AGAGTGTTAGGAGGACAGTG+AGG	-	chr4_2:39435163-39435182	None:intergenic	50.0%
	GCATACCGGAAAGCAAGACT+AGG	-	chr4_2:39435214-39435233	None:intergenic	50.0%
	ACTCATGCTCAATTGCAGCC+AGG	+	chr4_2:39434033-39434052	Msa0599600:CDS	50.0%
	GCTGCTAGTGATGGTACACT+AGG	-	chr4_2:39434123-39434142	None:intergenic	50.0%
	ATGAGTGCAGCTGCTAGTGA+TGG	-	chr4_2:39434132-39434151	None:intergenic	50.0%
	CAGCACAAGAGACAACACCA+GGG	-	chr4_2:39434569-39434588	None:intergenic	50.0%
	TCAGCACAAGAGACAACACC+AGG	-	chr4_2:39434570-39434589	None:intergenic	50.0%
!	ATTTGCAGGGTGGGCCTTAT+TGG	+	chr4_2:39435057-39435076	Msa0599600:intron	50.0%
	GGAAGGTTCCAACAGGTAGA+AGG	+	chr4_2:39435078-39435097	Msa0599600:CDS	50.0%
	GTTCCAACAGGTAGAAGGGA+TGG	+	chr4_2:39435083-39435102	Msa0599600:CDS	50.0%
	ACTCCATCCCTTCTACCTGT+TGG	-	chr4_2:39435089-39435108	None:intergenic	50.0%
	GGTTGTGAAATGGAGCAGGA+AGG	-	chr4_2:39435142-39435161	None:intergenic	50.0%
	GTGAGGTTGTGAAATGGAGC+AGG	-	chr4_2:39435146-39435165	None:intergenic	50.0%
!	AGAGTGTTAGGAGGACAGTG+AGG	-	chr4_2:39435163-39435182	None:intergenic	50.0%
	GCATACCGGAAAGCAAGACT+AGG	-	chr4_2:39435214-39435233	None:intergenic	50.0%
	TGGGCGTGCGAGAAATTCAC+AGG	+	chr4_2:39434757-39434776	Msa0599600:intron	55.0%
	GGGCGTGCGAGAAATTCACA+GGG	+	chr4_2:39434758-39434777	Msa0599600:intron	55.0%
	TGGGCGTGCGAGAAATTCAC+AGG	+	chr4_2:39434757-39434776	Msa0599600:intron	55.0%
	GGGCGTGCGAGAAATTCACA+GGG	+	chr4_2:39434758-39434777	Msa0599600:intron	55.0%
!!	GCAGGGTGGGCCTTATTGGA+AGG	+	chr4_2:39435061-39435080	Msa0599600:intron	60.0%
!!	GCAGGGTGGGCCTTATTGGA+AGG	+	chr4_2:39435061-39435080	Msa0599600:intron	60.0%

Chromosome	Type	Strat	End	Strand	Name
chr4_2	gene	39433952	39436003	39433952	ID=Msa0599600;Name=Msa0599600
chr4_2	mRNA	39433952	39436003	39433952	ID=Msa0599600-mRNA-1;Parent=Msa0599600;Name=Msa0599600-mRNA-1;_AED=0.14;_eAED=0.14;_QI=0\|0\|0\|1\|0.33\|0.25\|4\|0\|277
chr4_2	exon	39433952	39434125	39433952	ID=Msa0599600-mRNA-1:exon:8609;Parent=Msa0599600-mRNA-1
chr4_2	exon	39434438	39434629	39434438	ID=Msa0599600-mRNA-1:exon:8610;Parent=Msa0599600-mRNA-1
chr4_2	exon	39435065	39435190	39435065	ID=Msa0599600-mRNA-1:exon:8611;Parent=Msa0599600-mRNA-1
chr4_2	exon	39435662	39436003	39435662	ID=Msa0599600-mRNA-1:exon:8612;Parent=Msa0599600-mRNA-1
chr4_2	CDS	39433952	39434125	39433952	ID=Msa0599600-mRNA-1:cds;Parent=Msa0599600-mRNA-1
chr4_2	CDS	39434438	39434629	39434438	ID=Msa0599600-mRNA-1:cds;Parent=Msa0599600-mRNA-1
chr4_2	CDS	39435065	39435190	39435065	ID=Msa0599600-mRNA-1:cds;Parent=Msa0599600-mRNA-1
chr4_2	CDS	39435662	39436003	39435662	ID=Msa0599600-mRNA-1:cds;Parent=Msa0599600-mRNA-1

Gene Sequence

>Msa0599600

ATCTCTGCCAATTACATGAAAATGGGAATCCAGAGTTACTTCAAGGTTTTAATTATTTGTCTTATAGCAATAATTGGATCAACTCATGCTCAATTGCAGCCAGGTTTCTATGCTAAAAGCTGCCCCAAAGCTGAACAAATTGTTTTGAAGTATGTTCATGAACACATTCCTAGTGGATGTGATGCATCGGTACTTCTTAACTCAACACAAACCAATCAAGCTGAGAAGGATGCTATTCCAAATCTTACACTTCGAGGCTATGAATTCATTGACACAATAAAGAGCCTTGTTGAAAAAGAATGCCCTGGTGTTGTCTCTTGTGCTGATATTTTGACTTTGACTGCTAGGGATTCTATTCATGCTATTGGTGGGCCTTATTGGAAGGTTCCAACAGGTAGAAGGGATGGAGTCATATCTAAAGCAGCAGATACTTTTACTAGCCTTCCTGCTCCATTTCACAACCTCACTGTCCTCCTAACACTCTTTGGCAATGGTGATCAAGACCCAGATCTAGACGGTGAATATGCTAAAAATTTGAAAACATTTAAATGTAAGAATATCAATGATCAAACCACACTTATTGAAATGGACCCTGGAAGTCGTAATACATTTGATCTTGGCTATTTCAAGCAAGTAGTTAAGAGAAGGGGTTTGTTCCAATCAGATGCTGCATTGCTTAAAAGCTCTACAACAAGATCTATTCTTGCACATCATCTTCAATCAAATGAAAAATTCTTTAATGAATTTGGCAAGTCCATGGAAAAAATGGGGAGAATTAATGTCAAGATTGGGACTGAGGGAGAGATCAGAAAGCATTGTGCATTTATAAATTAA

Protein sequence

>Msa0599600

ISANYMKMGIQSYFKVLIICLIAIIGSTHAQLQPGFYAKSCPKAEQIVLKYVHEHIPSGCDASVLLNSTQTNQAEKDAIPNLTLRGYEFIDTIKSLVEKECPGVVSCADILTLTARDSIHAIGGPYWKVPTGRRDGVISKAADTFTSLPAPFHNLTVLLTLFGNGDQDPDLDGEYAKNLKTFKCKNINDQTTLIEMDPGSRNTFDLGYFKQVVKRRGLFQSDAALLKSSTTRSILAHHLQSNEKFFNEFGKSMEKMGRINVKIGTEGEIRKHCAFIN*