AlfalfaGEDB | Msa0050790

M. sativa cultivar zhongmu-4 / Msa0050790

KEGG: -
GO: GO:0000325 GO:0000902 GO:0003674 GO:0005215 GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0005773 GO:0005774 GO:0005886 GO:0005887 GO:0005938 GO:0006521 GO:0006810 GO:0007154 GO:0007165 GO:0008150 GO:0009653 GO:0009705 GO:0009719 GO:0009725 GO:0009733 GO:0009734 GO:0009755 GO:0009826 GO:0009832 GO:0009834 GO:0009893 GO:0009914 GO:0009966 GO:0009987 GO:0010033 GO:0010315 GO:0010565 GO:0010646 GO:0010817 GO:0010928 GO:0016020 GO:0016021 GO:0016043 GO:0016049 GO:0019222 GO:0022857 GO:0023051 GO:0023052 GO:0031090 GO:0031224 GO:0031226 GO:0031323 GO:0031325 GO:0032350 GO:0032352 GO:0032502 GO:0032870 GO:0032989 GO:0033238 GO:0033240 GO:0040007 GO:0042221 GO:0042546 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044085 GO:0044422 GO:0044424 GO:0044425 GO:0044437 GO:0044444 GO:0044446 GO:0044459 GO:0044464 GO:0045764 GO:0048518 GO:0048522 GO:0048583 GO:0048589 GO:0048856 GO:0048869 GO:0050789 GO:0050794 GO:0050896 GO:0051171 GO:0051173 GO:0051179 GO:0051234 GO:0051716 GO:0055085 GO:0060560 GO:0060918 GO:0062012 GO:0062013 GO:0065007 GO:0065008 GO:0070887 GO:0071310 GO:0071365 GO:0071495 GO:0071554 GO:0071669 GO:0071840 GO:0071944 GO:0080090 GO:0090354 GO:0090355 GO:0090357 GO:0090358 GO:0098588 GO:0098805 GO:0099568
PFAM: PF00892.23

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050790	XP_003589345.1	96.774	403	2	5	1	395	1	400	0.0	769

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050790	sp\|Q94AP3\|WAT1_ARATH	74.687	399	87	7	1	395	1	389	0.0	589

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050790	G7I5V7	96.774	403	2	5	1	395	1	400	0.0	769

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0000050	Msa0050790	0.818394	2.005995e-52	-8.615850e-47
Msa0002580	Msa0050790	0.849288	3.560547e-60	-8.615850e-47
Msa0003080	Msa0050790	0.899799	1.385999e-77	-8.615850e-47
Msa0005890	Msa0050790	0.809499	1.835961e-50	-8.615850e-47
Msa0008040	Msa0050790	0.853909	1.748852e-61	-8.615850e-47
Msa0015150	Msa0050790	0.828062	1.107739e-54	-8.615850e-47
Msa0016040	Msa0050790	0.811838	5.729189e-51	-8.615850e-47
Msa0017670	Msa0050790	0.850740	1.396697e-60	-8.615850e-47
Msa0017930	Msa0050790	0.805867	1.084775e-49	-8.615850e-47
Msa0019900	Msa0050790	0.825197	5.344218e-54	-8.615850e-47
Msa0025160	Msa0050790	0.886332	3.749942e-72	-8.615850e-47
Msa0025580	Msa0050790	0.868858	4.778207e-66	-8.615850e-47
Msa0027280	Msa0050790	0.834797	2.435340e-56	-8.615850e-47
Msa0029960	Msa0050790	0.823975	1.037023e-53	-8.615850e-47
Msa0029970	Msa0050790	0.805207	1.492387e-49	-8.615850e-47
Msa0032460	Msa0050790	0.823371	1.435855e-53	-8.615850e-47
Msa0034210	Msa0050790	0.885957	5.193847e-72	-8.615850e-47
Msa0035270	Msa0050790	0.824907	6.256871e-54	-8.615850e-47
Msa0035340	Msa0050790	0.853266	2.676732e-61	-8.615850e-47
Msa0035380	Msa0050790	0.842425	2.605832e-58	-8.615850e-47
Msa0036870	Msa0050790	0.803427	3.503800e-49	-8.615850e-47
Msa0042640	Msa0050790	0.828004	1.143692e-54	-8.615850e-47
Msa0048510	Msa0050790	0.849601	2.912938e-60	-8.615850e-47
Msa0050660	Msa0050790	0.990079	5.795456e-181	-8.615850e-47
Msa0050700	Msa0050790	0.990794	2.329434e-184	-8.615850e-47
Msa0050790	Msa0053070	0.803330	3.671120e-49	-8.615850e-47
Msa0050790	Msa0054690	0.835004	2.158928e-56	-8.615850e-47
Msa0050790	Msa0057540	0.814167	1.768142e-51	-8.615850e-47
Msa0050790	Msa0062340	0.800007	1.763925e-48	-8.615850e-47
Msa0050790	Msa0067330	0.832351	9.933252e-56	-8.615850e-47
Msa0050790	Msa0068150	0.803018	4.259473e-49	-8.615850e-47
Msa0050790	Msa0071850	0.841119	5.765213e-58	-8.615850e-47
Msa0050790	Msa0071860	0.852594	4.167867e-61	-8.615850e-47
Msa0050790	Msa0071880	0.829610	4.675793e-55	-8.615850e-47
Msa0050790	Msa0072520	0.865541	5.480916e-65	-8.615850e-47
Msa0050790	Msa0073120	0.850532	1.597720e-60	-8.615850e-47
Msa0050790	Msa0074020	0.810954	8.916859e-51	-8.615850e-47
Msa0050790	Msa0077340	0.826532	2.576899e-54	-8.615850e-47
Msa0050790	Msa0077560	0.834718	2.548467e-56	-8.615850e-47
Msa0050790	Msa0090400	0.852372	4.820394e-61	-8.615850e-47
Msa0050790	Msa0093860	0.802605	5.183689e-49	-8.615850e-47
Msa0050790	Msa0094780	0.833946	3.981345e-56	-8.615850e-47
Msa0050790	Msa0094790	0.843068	1.758274e-58	-8.615850e-47
Msa0050790	Msa0098040	0.842595	2.349035e-58	-8.615850e-47
Msa0050790	Msa0108880	0.865979	3.984093e-65	-8.615850e-47
Msa0050790	Msa0113340	0.823985	1.031352e-53	-8.615850e-47
Msa0050790	Msa0115550	0.818969	1.484954e-52	-8.615850e-47
Msa0050790	Msa0120790	0.833998	3.864384e-56	-8.615850e-47
Msa0050790	Msa0121330	0.853970	1.679673e-61	-8.615850e-47
Msa0050790	Msa0122330	0.823406	1.409461e-53	-8.615850e-47
Msa0050790	Msa0123070	0.829966	3.828136e-55	-8.615850e-47
Msa0050790	Msa0123340	0.806257	8.982816e-50	-8.615850e-47
Msa0050790	Msa0125200	0.825930	3.583444e-54	-8.615850e-47
Msa0050790	Msa0125210	0.844417	7.657701e-59	-8.615850e-47
Msa0050790	Msa0125360	0.825370	4.864458e-54	-8.615850e-47
Msa0050790	Msa0126210	0.806067	9.849070e-50	-8.615850e-47
Msa0050790	Msa0128310	0.883367	4.764975e-71	-8.615850e-47
Msa0050790	Msa0136650	0.837052	6.523924e-57	-8.615850e-47
Msa0050790	Msa0137880	0.846850	1.676570e-59	-8.615850e-47
Msa0050790	Msa0140130	0.836673	8.153055e-57	-8.615850e-47
Msa0050790	Msa0140280	0.878004	3.985865e-69	-8.615850e-47
Msa0050790	Msa0140380	0.809718	1.647226e-50	-8.615850e-47
Msa0050790	Msa0143670	0.817630	2.984292e-52	-8.615850e-47
Msa0050790	Msa0146650	0.912165	2.661347e-83	-8.615850e-47
Msa0050790	Msa0149350	0.872962	2.124859e-67	-8.615850e-47
Msa0050790	Msa0158860	0.848265	6.842698e-60	-8.615850e-47
Msa0050790	Msa0161930	0.856591	2.900110e-62	-8.615850e-47
Msa0050790	Msa0166170	0.832252	1.050780e-55	-8.615850e-47
Msa0050790	Msa0174440	0.879008	1.769290e-69	-8.615850e-47
Msa0050790	Msa0174450	0.843778	1.136340e-58	-8.615850e-47
Msa0050790	Msa0176060	0.842457	2.556213e-58	-8.615850e-47
Msa0050790	Msa0178450	0.800037	1.738823e-48	-8.615850e-47
Msa0050790	Msa0182190	0.810936	8.994503e-51	-8.615850e-47
Msa0050790	Msa0182240	0.815228	1.029489e-51	-8.615850e-47
Msa0050790	Msa0188610	0.863225	2.896864e-64	-8.615850e-47
Msa0050790	Msa0190570	0.857518	1.545864e-62	-8.615850e-47
Msa0050790	Msa0190730	0.811934	5.460735e-51	-8.615850e-47
Msa0050790	Msa0200050	0.839736	1.325379e-57	-8.615850e-47
Msa0050790	Msa0209980	0.805200	1.497491e-49	-8.615850e-47
Msa0050790	Msa0213030	0.838321	3.082472e-57	-8.615850e-47
Msa0050790	Msa0213610	0.818493	1.904363e-52	-8.615850e-47
Msa0050790	Msa0222560	0.822912	1.837385e-53	-8.615850e-47
Msa0050790	Msa0225100	0.833367	5.555231e-56	-8.615850e-47
Msa0050790	Msa0225860	0.837476	5.082151e-57	-8.615850e-47
Msa0050790	Msa0230780	0.812126	4.960074e-51	-8.615850e-47
Msa0050790	Msa0230800	0.864527	1.140582e-64	-8.615850e-47
Msa0050790	Msa0230840	0.828006	1.142423e-54	-8.615850e-47
Msa0050790	Msa0230870	0.866775	2.227645e-65	-8.615850e-47
Msa0050790	Msa0232760	0.831410	1.696354e-55	-8.615850e-47
Msa0050790	Msa0233020	0.814770	1.300496e-51	-8.615850e-47
Msa0050790	Msa0242590	0.842889	1.961941e-58	-8.615850e-47
Msa0050790	Msa0244640	0.815737	7.930148e-52	-8.615850e-47
Msa0050790	Msa0260510	0.817159	3.810469e-52	-8.615850e-47
Msa0050790	Msa0266180	0.805780	1.131554e-49	-8.615850e-47
Msa0050790	Msa0267110	0.831510	1.602768e-55	-8.615850e-47
Msa0050790	Msa0270340	0.855286	6.986659e-62	-8.615850e-47
Msa0050790	Msa0272260	0.822183	2.714888e-53	-8.615850e-47
Msa0050790	Msa0275770	0.805307	1.422209e-49	-8.615850e-47
Msa0050790	Msa0280790	0.842857	2.000918e-58	-8.615850e-47
Msa0050790	Msa0284800	0.846529	2.050654e-59	-8.615850e-47
Msa0050790	Msa0287740	0.831957	1.243417e-55	-8.615850e-47
Msa0050790	Msa0292160	0.821714	3.485520e-53	-8.615850e-47
Msa0050790	Msa0293040	0.816808	4.569969e-52	-8.615850e-47
Msa0050790	Msa0298470	0.841586	4.342966e-58	-8.615850e-47
Msa0050790	Msa0301820	0.812789	3.553430e-51	-8.615850e-47
Msa0050790	Msa0307270	0.835986	1.219304e-56	-8.615850e-47
Msa0050790	Msa0307670	0.856527	3.029434e-62	-8.615850e-47
Msa0050790	Msa0330380	0.808129	3.604762e-50	-8.615850e-47
Msa0050790	Msa0330520	0.851671	7.622746e-61	-8.615850e-47
Msa0050790	Msa0340500	0.809361	1.965267e-50	-8.615850e-47
Msa0050790	Msa0365210	0.816924	4.302473e-52	-8.615850e-47
Msa0050790	Msa0367520	0.841992	3.393021e-58	-8.615850e-47
Msa0050790	Msa0367690	0.858189	9.769194e-63	-8.615850e-47
Msa0050790	Msa0368860	0.808886	2.484906e-50	-8.615850e-47
Msa0050790	Msa0369790	0.859781	3.260617e-63	-8.615850e-47
Msa0050790	Msa0371270	0.818755	1.661182e-52	-8.615850e-47
Msa0050790	Msa0375640	0.812728	3.664343e-51	-8.615850e-47
Msa0050790	Msa0378720	0.803182	3.937881e-49	-8.615850e-47
Msa0050790	Msa0380620	0.834125	3.591642e-56	-8.615850e-47
Msa0050790	Msa0380670	0.881920	1.607197e-70	-8.615850e-47
Msa0050790	Msa0381730	0.824482	7.882991e-54	-8.615850e-47
Msa0050790	Msa0382390	0.830244	3.275407e-55	-8.615850e-47
Msa0050790	Msa0382740	0.812696	3.722752e-51	-8.615850e-47
Msa0050790	Msa0382770	0.819925	8.987911e-53	-8.615850e-47
Msa0050790	Msa0383000	0.818358	2.043869e-52	-8.615850e-47
Msa0050790	Msa0384870	0.849397	3.320710e-60	-8.615850e-47
Msa0050790	Msa0389950	0.821728	3.460241e-53	-8.615850e-47
Msa0050790	Msa0390970	0.836727	7.897786e-57	-8.615850e-47
Msa0050790	Msa0400000	0.816992	4.155339e-52	-8.615850e-47
Msa0050790	Msa0400950	0.817183	3.763299e-52	-8.615850e-47
Msa0050790	Msa0405680	0.809208	2.119823e-50	-8.615850e-47
Msa0050790	Msa0415450	0.840098	1.066586e-57	-8.615850e-47
Msa0050790	Msa0419540	0.838805	2.311920e-57	-8.615850e-47
Msa0050790	Msa0422050	0.816835	4.504689e-52	-8.615850e-47
Msa0050790	Msa0424160	0.815153	1.069533e-51	-8.615850e-47
Msa0050790	Msa0426530	0.869065	4.091372e-66	-8.615850e-47
Msa0050790	Msa0428370	0.833402	5.444106e-56	-8.615850e-47
Msa0050790	Msa0430260	0.837403	5.307302e-57	-8.615850e-47
Msa0050790	Msa0430300	0.876946	9.317034e-69	-8.615850e-47
Msa0050790	Msa0430480	0.811880	5.610920e-51	-8.615850e-47
Msa0050790	Msa0431200	0.838742	2.399820e-57	-8.615850e-47
Msa0050790	Msa0432010	0.848466	6.022516e-60	-8.615850e-47
Msa0050790	Msa0432140	0.833165	6.237798e-56	-8.615850e-47
Msa0050790	Msa0433150	0.820257	7.546088e-53	-8.615850e-47
Msa0050790	Msa0435210	0.870490	1.403486e-66	-8.615850e-47
Msa0050790	Msa0436910	0.853277	2.657941e-61	-8.615850e-47
Msa0050790	Msa0443410	0.802046	6.753847e-49	-8.615850e-47
Msa0050790	Msa0447750	0.811894	5.572341e-51	-8.615850e-47
Msa0050790	Msa0453040	0.800649	1.305383e-48	-8.615850e-47
Msa0050790	Msa0457570	0.832589	8.673891e-56	-8.615850e-47
Msa0050790	Msa0460070	0.833277	5.850727e-56	-8.615850e-47
Msa0050790	Msa0464000	0.858926	5.890943e-63	-8.615850e-47
Msa0050790	Msa0465530	0.840078	1.079463e-57	-8.615850e-47
Msa0050790	Msa0466880	0.800490	1.406465e-48	-8.615850e-47
Msa0050790	Msa0472950	0.878067	3.787932e-69	-8.615850e-47
Msa0050790	Msa0474730	0.825364	4.880469e-54	-8.615850e-47
Msa0050790	Msa0476280	0.827453	1.551598e-54	-8.615850e-47
Msa0050790	Msa0476650	0.813344	2.684011e-51	-8.615850e-47
Msa0050790	Msa0479320	0.868677	5.464809e-66	-8.615850e-47
Msa0050790	Msa0481890	0.846059	2.754226e-59	-8.615850e-47
Msa0050790	Msa0482080	0.814296	1.655832e-51	-8.615850e-47
Msa0050790	Msa0483910	0.804057	2.592519e-49	-8.615850e-47
Msa0050790	Msa0484570	0.819832	9.440887e-53	-8.615850e-47
Msa0050790	Msa0495300	0.800805	1.213177e-48	-8.615850e-47
Msa0050790	Msa0500380	0.819425	1.169314e-52	-8.615850e-47
Msa0050790	Msa0509550	0.855482	6.126335e-62	-8.615850e-47
Msa0050790	Msa0511470	0.813121	3.004076e-51	-8.615850e-47
Msa0050790	Msa0514580	0.802246	6.145814e-49	-8.615850e-47
Msa0050790	Msa0515800	0.802391	5.736809e-49	-8.615850e-47
Msa0050790	Msa0517250	0.897327	1.566000e-76	-8.615850e-47
Msa0050790	Msa0519750	0.815816	7.616958e-52	-8.615850e-47
Msa0050790	Msa0519820	0.806431	8.255183e-50	-8.615850e-47
Msa0050790	Msa0519830	0.821345	4.241464e-53	-8.615850e-47
Msa0050790	Msa0520260	0.841646	4.187940e-58	-8.615850e-47
Msa0050790	Msa0520870	0.829563	4.799905e-55	-8.615850e-47
Msa0050790	Msa0520990	0.840735	7.268472e-58	-8.615850e-47
Msa0050790	Msa0524520	0.812454	4.204862e-51	-8.615850e-47
Msa0050790	Msa0525000	0.815599	8.512059e-52	-8.615850e-47
Msa0050790	Msa0528570	0.897136	1.882563e-76	-8.615850e-47
Msa0050790	Msa0529030	0.861393	1.058946e-63	-8.615850e-47
Msa0050790	Msa0530780	0.828770	7.474171e-55	-8.615850e-47
Msa0050790	Msa0531960	0.836173	1.093021e-56	-8.615850e-47
Msa0050790	Msa0532050	0.805042	1.615956e-49	-8.615850e-47
Msa0050790	Msa0541300	0.890815	7.002378e-74	-8.615850e-47
Msa0050790	Msa0541310	0.887018	2.062226e-72	-8.615850e-47
Msa0050790	Msa0543660	0.819818	9.512540e-53	-8.615850e-47
Msa0050790	Msa0548470	0.878218	3.353628e-69	-8.615850e-47
Msa0050790	Msa0549370	0.804849	1.773124e-49	-8.615850e-47
Msa0050790	Msa0550050	0.836846	7.365918e-57	-8.615850e-47
Msa0050790	Msa0553750	0.805644	1.208567e-49	-8.615850e-47
Msa0050790	Msa0556640	0.802207	6.259640e-49	-8.615850e-47
Msa0050790	Msa0557370	0.824091	9.737665e-54	-8.615850e-47
Msa0050790	Msa0557460	0.878632	2.399895e-69	-8.615850e-47
Msa0050790	Msa0562350	0.846635	1.918847e-59	-8.615850e-47
Msa0050790	Msa0563740	0.802899	4.506234e-49	-8.615850e-47
Msa0050790	Msa0563940	0.826990	2.002961e-54	-8.615850e-47
Msa0050790	Msa0567170	0.845355	4.276540e-59	-8.615850e-47
Msa0050790	Msa0570010	0.832302	1.021463e-55	-8.615850e-47
Msa0050790	Msa0571290	0.825229	5.253623e-54	-8.615850e-47
Msa0050790	Msa0571620	0.806190	9.276087e-50	-8.615850e-47
Msa0050790	Msa0573810	0.823305	1.487658e-53	-8.615850e-47
Msa0050790	Msa0574300	0.804602	1.996504e-49	-8.615850e-47
Msa0050790	Msa0580370	0.846625	1.930863e-59	-8.615850e-47
Msa0050790	Msa0580810	0.827926	1.194598e-54	-8.615850e-47
Msa0050790	Msa0584420	0.835843	1.325542e-56	-8.615850e-47
Msa0050790	Msa0585020	0.883235	5.328788e-71	-8.615850e-47
Msa0050790	Msa0587620	0.857541	1.521865e-62	-8.615850e-47
Msa0050790	Msa0588920	0.805026	1.627969e-49	-8.615850e-47
Msa0050790	Msa0590200	0.821136	4.739027e-53	-8.615850e-47
Msa0050790	Msa0591170	0.825041	5.817124e-54	-8.615850e-47
Msa0050790	Msa0597270	0.892756	1.183671e-74	-8.615850e-47
Msa0050790	Msa0605560	0.841312	5.129936e-58	-8.615850e-47
Msa0050790	Msa0606100	0.812652	3.806422e-51	-8.615850e-47
Msa0050790	Msa0607800	0.823129	1.635601e-53	-8.615850e-47
Msa0050790	Msa0611210	0.802555	5.308087e-49	-8.615850e-47
Msa0050790	Msa0616210	0.868040	8.769699e-66	-8.615850e-47
Msa0050790	Msa0619710	0.813488	2.495225e-51	-8.615850e-47
Msa0050790	Msa0620980	0.809507	1.828288e-50	-8.615850e-47
Msa0050790	Msa0621710	0.851891	6.602681e-61	-8.615850e-47
Msa0050790	Msa0626450	0.810002	1.431162e-50	-8.615850e-47
Msa0050790	Msa0626490	0.803563	3.283394e-49	-8.615850e-47
Msa0050790	Msa0640200	0.814138	1.794315e-51	-8.615850e-47
Msa0050790	Msa0644410	0.884532	1.769195e-71	-8.615850e-47
Msa0050790	Msa0646510	0.819545	1.097894e-52	-8.615850e-47
Msa0050790	Msa0648040	0.805243	1.466261e-49	-8.615850e-47
Msa0050790	Msa0651550	0.805063	1.599328e-49	-8.615850e-47
Msa0050790	Msa0652170	0.802113	6.544467e-49	-8.615850e-47
Msa0050790	Msa0652650	0.818757	1.659705e-52	-8.615850e-47
Msa0050790	Msa0655700	0.876526	1.301882e-68	-8.615850e-47
Msa0050790	Msa0657440	0.827371	1.623592e-54	-8.615850e-47
Msa0050790	Msa0657700	0.829065	6.339262e-55	-8.615850e-47
Msa0050790	Msa0658640	0.839170	1.859731e-57	-8.615850e-47
Msa0050790	Msa0661150	0.832527	8.986048e-56	-8.615850e-47
Msa0050790	Msa0662110	0.819186	1.325778e-52	-8.615850e-47
Msa0050790	Msa0664600	0.805129	1.549659e-49	-8.615850e-47
Msa0050790	Msa0665620	0.833032	6.732625e-56	-8.615850e-47
Msa0050790	Msa0666700	0.836956	6.903576e-57	-8.615850e-47
Msa0050790	Msa0668900	0.811920	5.500240e-51	-8.615850e-47
Msa0050790	Msa0670100	0.810581	1.073274e-50	-8.615850e-47
Msa0050790	Msa0674480	0.806094	9.719475e-50	-8.615850e-47
Msa0050790	Msa0675330	0.886538	3.135820e-72	-8.615850e-47
Msa0050790	Msa0678490	0.813494	2.487583e-51	-8.615850e-47
Msa0050790	Msa0682770	0.821156	4.688763e-53	-8.615850e-47
Msa0050790	Msa0684220	0.824090	9.745844e-54	-8.615850e-47
Msa0050790	Msa0687090	0.845012	5.295461e-59	-8.615850e-47
Msa0050790	Msa0693890	0.836022	1.193349e-56	-8.615850e-47
Msa0050790	Msa0699540	0.872199	3.821266e-67	-8.615850e-47
Msa0050790	Msa0700460	0.852921	3.360934e-61	-8.615850e-47
Msa0050790	Msa0701720	0.821918	3.126906e-53	-8.615850e-47
Msa0050790	Msa0702810	0.826963	2.032982e-54	-8.615850e-47
Msa0050790	Msa0703600	0.833097	6.485784e-56	-8.615850e-47
Msa0050790	Msa0706150	0.824984	6.001206e-54	-8.615850e-47
Msa0050790	Msa0707670	0.803550	3.304950e-49	-8.615850e-47
Msa0050790	Msa0709200	0.832739	7.961570e-56	-8.615850e-47
Msa0050790	Msa0709440	0.847681	9.917803e-60	-8.615850e-47
Msa0050790	Msa0709630	0.811707	6.118730e-51	-8.615850e-47
Msa0050790	Msa0713700	0.846547	2.027854e-59	-8.615850e-47
Msa0050790	Msa0714520	0.823106	1.655428e-53	-8.615850e-47
Msa0050790	Msa0716480	0.802546	5.329948e-49	-8.615850e-47
Msa0050790	Msa0716890	0.804386	2.214348e-49	-8.615850e-47
Msa0050790	Msa0720410	0.854165	1.476417e-61	-8.615850e-47
Msa0050790	Msa0722220	0.830266	3.234612e-55	-8.615850e-47
Msa0050790	Msa0723090	0.818499	1.898509e-52	-8.615850e-47
Msa0050790	Msa0725750	0.827115	1.869970e-54	-8.615850e-47
Msa0050790	Msa0725770	0.800678	1.287462e-48	-8.615850e-47
Msa0050790	Msa0735780	0.845859	3.121422e-59	-8.615850e-47
Msa0050790	Msa0736890	0.805978	1.028276e-49	-8.615850e-47
Msa0050790	Msa0737990	0.820453	6.806546e-53	-8.615850e-47
Msa0050790	Msa0738700	0.878796	2.100361e-69	-8.615850e-47
Msa0050790	Msa0741220	0.854567	1.129312e-61	-8.615850e-47
Msa0050790	Msa0743440	0.842023	3.329626e-58	-8.615850e-47
Msa0050790	Msa0745720	0.804056	2.594818e-49	-8.615850e-47
Msa0050790	Msa0747000	0.803476	3.423664e-49	-8.615850e-47
Msa0050790	Msa0747740	0.800986	1.113828e-48	-8.615850e-47
Msa0050790	Msa0755930	0.838184	3.344329e-57	-8.615850e-47
Msa0050790	Msa0756490	0.873182	1.792566e-67	-8.615850e-47
Msa0050790	Msa0758650	0.828657	7.958914e-55	-8.615850e-47
Msa0050790	Msa0760970	0.850708	1.425812e-60	-8.615850e-47
Msa0050790	Msa0761670	0.850405	1.734687e-60	-8.615850e-47
Msa0050790	Msa0773630	0.848125	7.481190e-60	-8.615850e-47
Msa0050790	Msa0773670	0.811829	5.755173e-51	-8.615850e-47
Msa0050790	Msa0778550	0.851035	1.153719e-60	-8.615850e-47
Msa0050790	Msa0780910	0.818246	2.167078e-52	-8.615850e-47
Msa0050790	Msa0783930	0.810877	9.263271e-51	-8.615850e-47
Msa0050790	Msa0792370	0.865763	4.663760e-65	-8.615850e-47
Msa0050790	Msa0795870	0.847561	1.070011e-59	-8.615850e-47
Msa0050790	Msa0803250	0.834280	3.283752e-56	-8.615850e-47
Msa0050790	Msa0805680	0.833593	4.879664e-56	-8.615850e-47
Msa0050790	Msa0811020	0.821773	3.378194e-53	-8.615850e-47
Msa0050790	Msa0811690	0.802206	6.261132e-49	-8.615850e-47
Msa0050790	Msa0815920	0.831579	1.541211e-55	-8.615850e-47
Msa0050790	Msa0815970	0.801031	1.090774e-48	-8.615850e-47
Msa0050790	Msa0818880	0.801365	9.317576e-49	-8.615850e-47
Msa0050790	Msa0819170	0.839836	1.248678e-57	-8.615850e-47
Msa0050790	Msa0821160	0.810216	1.287345e-50	-8.615850e-47
Msa0050790	Msa0824450	0.852987	3.216752e-61	-8.615850e-47
Msa0050790	Msa0828970	0.829797	4.210265e-55	-8.615850e-47
Msa0050790	Msa0829300	0.804476	2.121269e-49	-8.615850e-47
Msa0050790	Msa0829330	0.806240	9.054481e-50	-8.615850e-47
Msa0050790	Msa0833650	0.840361	9.110346e-58	-8.615850e-47
Msa0050790	Msa0835160	0.804833	1.786872e-49	-8.615850e-47
Msa0050790	Msa0835490	0.858295	9.085452e-63	-8.615850e-47
Msa0050790	Msa0837460	0.803897	2.799484e-49	-8.615850e-47
Msa0050790	Msa0841590	0.850656	1.475092e-60	-8.615850e-47
Msa0050790	Msa0843050	0.843780	1.135302e-58	-8.615850e-47
Msa0050790	Msa0851850	0.803447	3.471474e-49	-8.615850e-47
Msa0050790	Msa0859290	0.873333	1.594725e-67	-8.615850e-47
Msa0050790	Msa0863620	0.834938	2.243505e-56	-8.615850e-47
Msa0050790	Msa0867110	0.806386	8.436790e-50	-8.615850e-47
Msa0050790	Msa0871880	0.811001	8.706814e-51	-8.615850e-47
Msa0050790	Msa0876940	0.811685	6.185959e-51	-8.615850e-47
Msa0050790	Msa0878280	0.801583	8.409373e-49	-8.615850e-47
Msa0050790	Msa0888790	0.801007	1.103257e-48	-8.615850e-47
Msa0050790	Msa0894790	0.821437	4.039410e-53	-8.615850e-47
Msa0050790	Msa0905240	0.825144	5.501662e-54	-8.615850e-47
Msa0050790	Msa0909760	0.813651	2.297521e-51	-8.615850e-47
Msa0050790	Msa0915520	0.812688	3.738360e-51	-8.615850e-47
Msa0050790	Msa0921590	0.824333	8.541925e-54	-8.615850e-47
Msa0050790	Msa0931590	0.831890	1.291852e-55	-8.615850e-47
Msa0050790	Msa0945110	0.802964	4.370368e-49	-8.615850e-47
Msa0050790	Msa0945190	0.800117	1.675473e-48	-8.615850e-47
Msa0050790	Msa0945260	0.807239	5.569250e-50	-8.615850e-47
Msa0050790	Msa0956350	0.817287	3.565812e-52	-8.615850e-47
Msa0050790	Msa0966320	0.828435	9.002632e-55	-8.615850e-47
Msa0050790	Msa0966480	0.829320	5.498815e-55	-8.615850e-47
Msa0050790	Msa0967870	0.821254	4.453036e-53	-8.615850e-47
Msa0050790	Msa0974520	0.819842	9.389964e-53	-8.615850e-47
Msa0050790	Msa0980290	0.805951	1.041550e-49	-8.615850e-47
Msa0050790	Msa0981320	0.844316	8.150630e-59	-8.615850e-47
Msa0050790	Msa0989500	0.815147	1.072811e-51	-8.615850e-47
Msa0050790	Msa1001740	0.805769	1.137644e-49	-8.615850e-47
Msa0050790	Msa1003800	0.802563	5.287499e-49	-8.615850e-47
Msa0050790	Msa1009950	0.871254	7.859263e-67	-8.615850e-47
Msa0050790	Msa1020480	0.827511	1.502223e-54	-8.615850e-47
Msa0050790	Msa1021590	0.875711	2.484659e-68	-8.615850e-47
Msa0050790	Msa1029530	0.809495	1.839516e-50	-8.615850e-47
Msa0050790	Msa1029800	0.811651	6.294628e-51	-8.615850e-47
Msa0050790	Msa1034600	0.820447	6.826023e-53	-8.615850e-47
Msa0050790	Msa1035570	0.834285	3.274633e-56	-8.615850e-47
Msa0050790	Msa1035610	0.843661	1.221661e-58	-8.615850e-47
Msa0050790	Msa1037540	0.812377	4.372193e-51	-8.615850e-47
Msa0050790	Msa1039220	0.825619	4.246226e-54	-8.615850e-47
Msa0050790	Msa1042160	0.917655	4.072820e-86	-8.615850e-47
Msa0050790	Msa1042190	0.918057	2.488921e-86	-8.615850e-47
Msa0050790	Msa1042880	0.804444	2.153892e-49	-8.615850e-47
Msa0050790	Msa1044680	0.858228	9.511625e-63	-8.615850e-47
Msa0050790	Msa1045140	0.802301	5.985765e-49	-8.615850e-47
Msa0050790	Msa1049280	0.815257	1.014081e-51	-8.615850e-47
Msa0050790	Msa1051420	0.820492	6.665776e-53	-8.615850e-47
Msa0050790	Msa1051900	0.812913	3.337974e-51	-8.615850e-47
Msa0050790	Msa1059020	0.836284	1.024303e-56	-8.615850e-47
Msa0050790	Msa1068920	0.806171	9.363979e-50	-8.615850e-47
Msa0050790	Msa1072940	0.849155	3.875924e-60	-8.615850e-47
Msa0050790	Msa1074370	0.813899	2.026688e-51	-8.615850e-47
Msa0050790	Msa1074600	0.851862	6.728575e-61	-8.615850e-47
Msa0050790	Msa1074860	0.804897	1.732574e-49	-8.615850e-47
Msa0050790	Msa1077990	0.803965	2.710413e-49	-8.615850e-47
Msa0050790	Msa1078820	0.853882	1.781206e-61	-8.615850e-47
Msa0050790	Msa1078880	0.844910	5.642512e-59	-8.615850e-47
Msa0050790	Msa1078970	0.851413	9.019623e-61	-8.615850e-47
Msa0050790	Msa1080000	0.863391	2.574563e-64	-8.615850e-47
Msa0050790	Msa1081390	0.838962	2.105882e-57	-8.615850e-47
Msa0050790	Msa1081690	0.866039	3.814185e-65	-8.615850e-47
Msa0050790	Msa1082200	0.810305	1.231386e-50	-8.615850e-47
Msa0050790	Msa1084530	0.850323	1.828704e-60	-8.615850e-47
Msa0050790	Msa1094010	0.808113	3.632338e-50	-8.615850e-47
Msa0050790	Msa1096960	0.817120	3.888081e-52	-8.615850e-47
Msa0050790	Msa1104220	0.804771	1.841185e-49	-8.615850e-47
Msa0050790	Msa1105640	0.861594	9.195018e-64	-8.615850e-47
Msa0050790	Msa1105780	0.819347	1.218222e-52	-8.615850e-47
Msa0050790	Msa1116220	0.847618	1.032198e-59	-8.615850e-47
Msa0050790	Msa1116660	0.835954	1.241835e-56	-8.615850e-47
Msa0050790	Msa1121310	0.802000	6.902514e-49	-8.615850e-47
Msa0050790	Msa1123210	0.860276	2.311638e-63	-8.615850e-47
Msa0050790	Msa1123970	0.860334	2.220179e-63	-8.615850e-47
Msa0050790	Msa1125250	0.803018	4.259198e-49	-8.615850e-47
Msa0050790	Msa1125820	0.854760	9.929326e-62	-8.615850e-47
Msa0050790	Msa1125990	0.854604	1.102017e-61	-8.615850e-47
Msa0050790	Msa1132530	0.848652	5.348204e-60	-8.615850e-47
Msa0050790	Msa1132840	0.845058	5.144233e-59	-8.615850e-47
Msa0050790	Msa1147910	0.800311	1.529498e-48	-8.615850e-47
Msa0050790	Msa1148960	0.848580	5.597076e-60	-8.615850e-47
Msa0050790	Msa1156520	0.802887	4.533178e-49	-8.615850e-47
Msa0050790	Msa1160920	0.841017	6.130276e-58	-8.615850e-47
Msa0050790	Msa1162180	0.823178	1.593172e-53	-8.615850e-47
Msa0050790	Msa1162880	0.803659	3.136698e-49	-8.615850e-47
Msa0050790	Msa1166190	0.843176	1.645506e-58	-8.615850e-47
Msa0050790	Msa1166290	0.836241	1.050162e-56	-8.615850e-47
Msa0050790	Msa1167470	0.905899	2.633803e-80	-8.615850e-47
Msa0050790	Msa1169190	0.843464	1.379293e-58	-8.615850e-47
Msa0050790	Msa1169650	0.855822	4.873171e-62	-8.615850e-47
Msa0050790	Msa1171290	0.842077	3.222222e-58	-8.615850e-47
Msa0050790	Msa1176260	0.813412	2.594058e-51	-8.615850e-47
Msa0050790	Msa1186520	0.802473	5.516911e-49	-8.615850e-47
Msa0050790	Msa1187760	0.802472	5.519085e-49	-8.615850e-47
Msa0050790	Msa1192560	0.837246	5.819162e-57	-8.615850e-47
Msa0050790	Msa1192570	0.816624	5.024559e-52	-8.615850e-47
Msa0050790	Msa1192590	0.836634	8.343147e-57	-8.615850e-47
Msa0050790	Msa1194240	0.832054	1.176419e-55	-8.615850e-47
Msa0050790	Msa1198540	0.810603	1.061700e-50	-8.615850e-47
Msa0050790	Msa1200890	0.812560	3.986849e-51	-8.615850e-47
Msa0050790	Msa1203300	0.825215	5.293425e-54	-8.615850e-47
Msa0050790	Msa1208950	0.850321	1.831483e-60	-8.615850e-47
Msa0050790	Msa1211240	0.814940	1.192473e-51	-8.615850e-47
Msa0050790	Msa1213830	0.806128	9.561277e-50	-8.615850e-47
Msa0050790	Msa1214350	0.826135	3.203568e-54	-8.615850e-47
Msa0050790	Msa1215870	0.848637	5.399367e-60	-8.615850e-47
Msa0050790	Msa1216090	0.801263	9.777510e-49	-8.615850e-47
Msa0050790	Msa1216110	0.830446	2.924065e-55	-8.615850e-47
Msa0050790	Msa1217230	0.843484	1.362375e-58	-8.615850e-47
Msa0050790	Msa1223390	0.808417	3.129745e-50	-8.615850e-47
Msa0050790	Msa1223570	0.823656	1.231360e-53	-8.615850e-47
Msa0050790	Msa1224930	0.806647	7.431338e-50	-8.615850e-47
Msa0050790	Msa1226520	0.840631	7.742619e-58	-8.615850e-47
Msa0050790	Msa1228630	0.826963	2.033196e-54	-8.615850e-47
Msa0050790	Msa1231700	0.822556	2.223731e-53	-8.615850e-47
Msa0050790	Msa1240770	0.848285	6.756228e-60	-8.615850e-47
Msa0050790	Msa1244240	0.815316	9.838734e-52	-8.615850e-47
Msa0050790	Msa1254540	0.829268	5.660116e-55	-8.615850e-47
Msa0050790	Msa1261050	0.814836	1.257597e-51	-8.615850e-47
Msa0050790	Msa1262570	0.805391	1.365370e-49	-8.615850e-47
Msa0050790	Msa1263490	0.814079	1.849376e-51	-8.615850e-47
Msa0050790	Msa1263740	0.815679	8.169917e-52	-8.615850e-47
Msa0050790	Msa1263780	0.853485	2.316227e-61	-8.615850e-47
Msa0050790	Msa1265650	0.847753	9.471741e-60	-8.615850e-47
Msa0050790	Msa1268630	0.822279	2.578402e-53	-8.615850e-47
Msa0050790	Msa1277640	0.878895	1.939516e-69	-8.615850e-47
Msa0050790	Msa1282260	0.825602	4.287312e-54	-8.615850e-47
Msa0050790	Msa1290380	0.802313	5.953380e-49	-8.615850e-47
Msa0050790	Msa1292840	0.824953	6.105053e-54	-8.615850e-47
Msa0050790	Msa1296950	0.819783	9.687805e-53	-8.615850e-47
Msa0050790	Msa1298220	0.804157	2.471776e-49	-8.615850e-47
Msa0050790	Msa1300460	0.828532	8.533660e-55	-8.615850e-47
Msa0050790	Msa1301700	0.802883	4.541889e-49	-8.615850e-47
Msa0050790	Msa1303560	0.843138	1.684926e-58	-8.615850e-47
Msa0050790	Msa1303650	0.848664	5.306991e-60	-8.615850e-47
Msa0050790	Msa1307630	0.807664	4.525160e-50	-8.615850e-47
Msa0050790	Msa1308850	0.807986	3.865694e-50	-8.615850e-47
Msa0050790	Msa1314980	0.803158	3.984595e-49	-8.615850e-47
Msa0050790	Msa1315130	0.812966	3.248778e-51	-8.615850e-47
Msa0050790	Msa1315160	0.845119	4.953109e-59	-8.615850e-47
Msa0050790	Msa1316330	0.861705	8.504331e-64	-8.615850e-47
Msa0050790	Msa1321340	0.838440	2.872508e-57	-8.615850e-47
Msa0050790	Msa1327800	0.812271	4.610127e-51	-8.615850e-47
Msa0050790	Msa1332630	0.835422	1.693351e-56	-8.615850e-47
Msa0050790	Msa1332950	0.812349	4.432732e-51	-8.615850e-47
Msa0050790	Msa1342810	0.818997	1.463158e-52	-8.615850e-47
Msa0050790	Msa1343170	0.852513	4.393587e-61	-8.615850e-47
Msa0050790	Msa1343180	0.850265	1.898791e-60	-8.615850e-47
Msa0050790	Msa1352310	0.825034	5.841501e-54	-8.615850e-47
Msa0050790	Msa1359690	0.829978	3.804164e-55	-8.615850e-47
Msa0050790	Msa1362620	0.832936	7.111005e-56	-8.615850e-47
Msa0050790	Msa1364410	0.822450	2.353240e-53	-8.615850e-47
Msa0050790	Msa1364680	0.812843	3.457378e-51	-8.615850e-47
Msa0050790	Msa1368750	0.850397	1.743926e-60	-8.615850e-47
Msa0050790	Msa1372040	0.837307	5.614452e-57	-8.615850e-47
Msa0050790	Msa1374790	0.855318	6.835881e-62	-8.615850e-47
Msa0050790	Msa1375350	0.801595	8.360708e-49	-8.615850e-47
Msa0050790	Msa1381180	0.828744	7.584816e-55	-8.615850e-47
Msa0050790	Msa1382300	0.815574	8.623037e-52	-8.615850e-47
Msa0050790	Msa1383310	0.831982	1.225718e-55	-8.615850e-47
Msa0050790	Msa1384150	0.835648	1.484553e-56	-8.615850e-47
Msa0050790	Msa1384460	0.869548	2.850958e-66	-8.615850e-47
Msa0050790	Msa1387620	0.819327	1.231020e-52	-8.615850e-47
Msa0050790	Msa1393780	0.890627	8.301666e-74	-8.615850e-47
Msa0050790	Msa1397400	0.818393	2.006782e-52	-8.615850e-47
Msa0050790	Msa1400010	0.811835	5.739073e-51	-8.615850e-47
Msa0050790	Msa1405460	0.857931	1.165839e-62	-8.615850e-47
Msa0050790	Msa1406720	0.807092	5.982721e-50	-8.615850e-47
Msa0050790	Msa1409410	0.894921	1.564254e-75	-8.615850e-47
Msa0050790	Msa1410160	0.850031	2.207689e-60	-8.615850e-47
Msa0050790	Msa1411790	0.841340	5.043398e-58	-8.615850e-47
Msa0050790	Msa1413940	0.801724	7.865037e-49	-8.615850e-47
Msa0050790	Msa1414170	0.842724	2.171258e-58	-8.615850e-47
Msa0050790	Msa1415540	0.891199	4.937543e-74	-8.615850e-47
Msa0050790	Msa1417370	0.839409	1.611832e-57	-8.615850e-47
Msa0050790	Msa1420950	0.812432	4.253065e-51	-8.615850e-47
Msa0050790	Msa1427100	0.826956	2.041021e-54	-8.615850e-47
Msa0050790	Msa1429070	0.801276	9.717290e-49	-8.615850e-47
Msa0050790	Msa1431480	0.861353	1.089291e-63	-8.615850e-47
Msa0050790	Msa1433790	0.824101	9.687849e-54	-8.615850e-47
Msa0050790	Msa1433860	0.805818	1.110716e-49	-8.615850e-47
Msa0050790	Msa1437930	0.810572	1.078340e-50	-8.615850e-47
Msa0050790	Msa1440630	0.997919	5.155139e-252	-8.615850e-47
Msa0050790	Msa1440960	0.809173	2.156870e-50	-8.615850e-47
Msa0050790	Msa1445120	0.812664	3.783201e-51	-8.615850e-47
Msa0050790	Msa1449480	0.813258	2.802872e-51	-8.615850e-47
Msa0050790	Msa1450190	0.819403	1.183104e-52	-8.615850e-47
Msa0050790	Msa1451820	0.858801	6.419674e-63	-8.615850e-47
Msa0050790	Msa1452140	0.883407	4.605187e-71	-8.615850e-47
Msa0050790	Msa1454140	0.801226	9.952089e-49	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050790	MtrunA17_Chr1g0155761	96.774	403	2	5	1	395	1	400	0.0	769
Msa0050790	MtrunA17_Chr3g0142131	82.663	398	62	6	1	395	1	394	0.0	636
Msa0050790	MtrunA17_Chr6g0483401	57.808	365	122	4	30	394	19	351	1.78e-141	407
Msa0050790	MtrunA17_Chr5g0407971	41.003	339	199	1	18	356	8	345	3.63e-85	264
Msa0050790	MtrunA17_Chr5g0407991	37.958	382	198	4	18	382	6	365	2.60e-84	262
Msa0050790	MtrunA17_Chr5g0408001	37.403	385	204	4	18	383	7	373	8.47e-84	260
Msa0050790	MtrunA17_Chr5g0408041	40.331	362	209	3	23	382	13	369	5.08e-83	259
Msa0050790	MtrunA17_Chr5g0408031	39.888	356	205	3	18	371	7	355	2.36e-82	256
Msa0050790	MtrunA17_Chr1g0160171	38.764	356	194	3	1	354	1	334	6.78e-80	250
Msa0050790	MtrunA17_Chr7g0255561	38.551	345	189	2	18	356	11	338	2.59e-79	249
Msa0050790	MtrunA17_Chr7g0255581	38.551	345	189	2	18	356	11	338	2.59e-79	249
Msa0050790	MtrunA17_Chr8g0369841	38.596	342	203	4	18	356	6	343	3.97e-79	248
Msa0050790	MtrunA17_Chr8g0354121	38.643	339	196	2	18	355	10	337	3.90e-77	244
Msa0050790	MtrunA17_Chr3g0114691	36.047	344	207	2	18	361	17	347	8.95e-77	243
Msa0050790	MtrunA17_Chr1g0160181	39.003	341	194	2	23	362	20	347	1.09e-76	242
Msa0050790	MtrunA17_Chr1g0186641	36.338	355	207	5	18	370	10	347	5.44e-76	239
Msa0050790	MtrunA17_Chr5g0404811	47.348	264	113	4	129	387	1	243	1.09e-75	235
Msa0050790	MtrunA17_Chr1g0186601	35.754	358	210	4	18	373	13	352	1.68e-75	238
Msa0050790	MtrunA17_Chr1g0186611	34.734	357	213	3	18	372	13	351	3.64e-75	237
Msa0050790	MtrunA17_Chr1g0171301	34.454	357	216	4	9	362	2	343	4.76e-75	237
Msa0050790	MtrunA17_Chr3g0081421	38.841	345	194	4	14	354	9	340	2.12e-74	236
Msa0050790	MtrunA17_Chr2g0284261	35.398	339	202	2	18	356	5	326	1.02e-73	234
Msa0050790	MtrunA17_Chr6g0463971	35.795	352	205	4	15	362	10	344	1.27e-72	231
Msa0050790	MtrunA17_Chr3g0081511	38.551	345	185	4	18	355	14	338	1.79e-72	231
Msa0050790	MtrunA17_Chr8g0334761	38.081	344	197	4	12	354	1	329	3.65e-72	230
Msa0050790	MtrunA17_Chr1g0164831	34.930	355	210	5	24	378	6	339	8.56e-72	228
Msa0050790	MtrunA17_Chr1g0186561	36.857	350	202	4	18	365	13	345	3.09e-71	227
Msa0050790	MtrunA17_Chr1g0186571	34.770	348	207	5	18	363	10	339	1.28e-70	226
Msa0050790	MtrunA17_Chr3g0114731	37.952	332	189	2	23	354	20	334	1.82e-70	226
Msa0050790	MtrunA17_Chr7g0271561	35.045	331	207	1	24	354	10	332	9.61e-69	221
Msa0050790	MtrunA17_Chr1g0182291	36.364	341	193	3	18	354	12	332	2.13e-68	220
Msa0050790	MtrunA17_Chr2g0310441	36.461	373	213	8	24	388	13	369	6.82e-68	219
Msa0050790	MtrunA17_Chr4g0059311	34.024	338	207	4	25	361	15	337	7.71e-68	218
Msa0050790	MtrunA17_Chr3g0114711	34.492	374	192	4	18	354	11	368	1.47e-67	219
Msa0050790	MtrunA17_Chr3g0129601	33.511	376	212	4	6	368	14	364	5.05e-66	214
Msa0050790	MtrunA17_Chr1g0184221	32.133	361	206	4	18	361	13	351	1.24e-65	213
Msa0050790	MtrunA17_Chr7g0263101	35.988	339	187	4	24	354	16	332	1.59e-65	213
Msa0050790	MtrunA17_Chr3g0114701	37.612	335	195	2	23	356	11	332	1.12e-64	211
Msa0050790	MtrunA17_Chr2g0278561	33.938	386	227	4	10	385	4	371	1.69e-64	211
Msa0050790	MtrunA17_Chr8g0383731	35.329	334	205	2	23	355	7	330	9.65e-64	207
Msa0050790	MtrunA17_Chr1g0160111	32.923	325	209	2	30	354	16	331	2.35e-63	207
Msa0050790	MtrunA17_Chr3g0126101	35.220	318	186	4	38	354	23	321	7.04e-62	202
Msa0050790	MtrunA17_Chr3g0129571	33.134	335	209	5	23	354	9	331	5.56e-61	201
Msa0050790	MtrunA17_Chr8g0334771	36.337	344	203	3	12	354	1	329	3.48e-60	199
Msa0050790	MtrunA17_Chr3g0129591	33.832	334	208	3	23	354	7	329	4.42e-60	198
Msa0050790	MtrunA17_Chr4g0073241	32.984	382	216	9	24	395	11	362	3.80e-59	196
Msa0050790	MtrunA17_Chr8g0334751	35.676	370	212	6	24	392	14	358	1.78e-58	194
Msa0050790	MtrunA17_Chr5g0413961	35.530	349	204	3	11	357	2	331	3.78e-58	193
Msa0050790	MtrunA17_Chr2g0290611	35.952	331	199	3	26	356	17	334	4.52e-57	191
Msa0050790	MtrunA17_Chr2g0278541	35.362	345	200	4	24	360	15	344	1.71e-55	187
Msa0050790	MtrunA17_Chr2g0278551	34.294	347	213	3	26	372	17	348	4.40e-55	186
Msa0050790	MtrunA17_Chr5g0413941	31.579	342	217	4	16	356	2	327	1.65e-54	184
Msa0050790	MtrunA17_Chr5g0413921	30.347	346	224	3	18	362	4	333	9.99e-53	179
Msa0050790	MtrunA17_Chr4g0050891	32.081	346	213	3	10	349	2	331	5.91e-52	177
Msa0050790	MtrunA17_Chr3g0129581	32.036	334	214	3	23	354	7	329	6.57e-52	177
Msa0050790	MtrunA17_Chr1g0150151	33.828	337	199	5	25	355	15	333	5.11e-51	175
Msa0050790	MtrunA17_Chr4g0051021	30.270	370	244	3	26	394	19	375	8.97e-51	174
Msa0050790	MtrunA17_Chr5g0404801	68.908	119	37	0	16	134	2	120	2.57e-50	165
Msa0050790	MtrunA17_Chr2g0332001	32.440	336	202	4	26	356	43	358	4.15e-50	173
Msa0050790	MtrunA17_Chr5g0413951	30.514	331	213	5	26	355	12	326	9.72e-50	171
Msa0050790	MtrunA17_Chr5g0428881	29.101	378	247	4	15	383	9	374	2.43e-49	171
Msa0050790	MtrunA17_Chr1g0177221	34.629	283	165	4	1	282	1	264	2.61e-48	165
Msa0050790	MtrunA17_Chr5g0413931	30.514	331	213	5	26	355	11	325	1.70e-46	162
Msa0050790	MtrunA17_Chr4g0050941	31.746	378	241	4	24	395	15	381	1.73e-46	163
Msa0050790	MtrunA17_Chr4g0056081	31.054	351	212	10	25	365	18	348	3.32e-43	154
Msa0050790	MtrunA17_Chr4g0050881	29.679	374	224	8	15	375	3	350	7.64e-43	153
Msa0050790	MtrunA17_Chr7g0227921	31.548	336	204	5	25	355	15	329	8.78e-43	153
Msa0050790	MtrunA17_Chr4g0050931	29.598	348	188	3	14	356	5	300	2.22e-41	148
Msa0050790	MtrunA17_Chr1g0211801	32.685	257	157	3	26	282	16	256	1.29e-40	145
Msa0050790	MtrunA17_Chr5g0441761	27.576	330	219	2	25	354	18	327	1.38e-39	144
Msa0050790	MtrunA17_Chr5g0399281	30.792	341	215	8	18	354	5	328	4.64e-39	143
Msa0050790	MtrunA17_Chr5g0429001	29.126	309	207	3	88	395	18	315	6.62e-38	139
Msa0050790	MtrunA17_Chr3g0084091	31.752	274	169	3	101	373	10	266	2.23e-37	137
Msa0050790	MtrunA17_Chr4g0051001	29.217	332	218	4	5	332	12	330	3.71e-37	137
Msa0050790	MtrunA17_Chr6g0451211	28.704	324	198	7	41	355	32	331	7.70e-37	137
Msa0050790	MtrunA17_Chr6g0451201	29.859	355	224	6	41	395	32	361	4.20e-34	130
Msa0050790	MtrunA17_Chr6g0451251	30.321	343	217	6	41	380	32	355	2.15e-32	125
Msa0050790	MtrunA17_Chr3g0126091	25.723	346	233	8	24	362	14	342	1.15e-31	123
Msa0050790	MtrunA17_Chr6g0451171	28.354	328	213	7	30	355	21	328	2.17e-31	122
Msa0050790	MtrunA17_Chr2g0278021	35.586	222	135	2	135	356	1	214	4.65e-31	119
Msa0050790	MtrunA17_Chr6g0451261	27.124	306	198	5	35	335	25	310	2.17e-30	123
Msa0050790	MtrunA17_Chr8g0334721	38.194	144	84	2	247	390	2	140	7.36e-29	110
Msa0050790	MtrunA17_Chr8g0334711	34.272	213	123	4	18	229	7	203	6.80e-28	109
Msa0050790	MtrunA17_Chr6g0451191	28.054	221	141	3	135	355	1	203	6.06e-21	90.9
Msa0050790	MtrunA17_Chr8g0334731	29.224	219	119	5	13	229	3	187	5.46e-19	84.7
Msa0050790	MtrunA17_Chr1g0177231	38.947	95	57	1	268	362	15	108	4.33e-16	74.3
Msa0050790	MtrunA17_Chr2g0278031	39.815	108	65	0	26	133	19	126	9.99e-15	70.5
Msa0050790	MtrunA17_Chr4g0050911	35.938	128	76	1	106	233	16	137	2.27e-14	70.5
Msa0050790	MtrunA17_Chr1g0182261	33.077	130	84	3	230	356	83	212	2.27e-14	72.0
Msa0050790	MtrunA17_Chr1g0172891	40.541	74	44	0	289	362	13	86	3.01e-14	68.9
Msa0050790	MtrunA17_Chr1g0211811	42.254	71	41	0	284	354	1	71	5.00e-14	67.4
Msa0050790	MtrunA17_Chr4g0050921	33.333	102	68	0	234	335	3	104	6.81e-14	68.2
Msa0050790	MtrunA17_Chr1g0172881	28.667	150	83	4	134	282	23	149	1.08e-11	62.8
Msa0050790	MtrunA17_Chr8g0334741	28.571	140	71	3	247	382	2	116	7.10e-11	59.7

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050790	AT1G75500.1	74.687	399	87	7	1	395	1	389	0.0	589
Msa0050790	AT1G75500.2	74.687	399	87	7	1	395	1	389	0.0	589
Msa0050790	AT3G53210.1	52.632	380	161	3	16	390	4	369	6.50e-142	409
Msa0050790	AT3G18200.2	56.131	367	144	2	16	382	29	378	4.10e-141	407
Msa0050790	AT3G53210.3	57.143	266	100	2	16	281	4	255	1.85e-105	312
Msa0050790	AT3G53210.2	50.333	300	130	3	96	390	27	312	4.88e-102	305
Msa0050790	AT3G18200.1	50.943	265	113	2	118	382	1	248	1.07e-85	261
Msa0050790	AT3G45870.1	42.169	332	187	3	18	349	8	334	1.44e-77	245
Msa0050790	AT4G30420.2	37.371	388	217	7	18	395	5	376	2.54e-77	244
Msa0050790	AT5G45370.2	37.326	359	222	3	18	375	16	372	2.58e-77	244
Msa0050790	AT5G45370.4	37.326	359	222	3	18	375	16	372	2.58e-77	244
Msa0050790	AT5G45370.1	37.709	358	198	3	18	375	16	348	7.16e-77	242
Msa0050790	AT4G30420.1	36.911	382	215	6	24	395	1	366	1.02e-76	242
Msa0050790	AT5G07050.1	38.136	354	196	3	23	368	19	357	2.42e-74	237
Msa0050790	AT2G39510.1	37.838	333	191	2	24	355	10	327	7.48e-73	232
Msa0050790	AT3G45870.8	41.587	315	179	3	18	332	8	317	1.78e-71	227
Msa0050790	AT1G09380.1	38.602	329	191	1	24	352	10	327	3.06e-71	228
Msa0050790	AT4G08290.1	35.733	375	228	2	18	392	9	370	3.41e-71	228
Msa0050790	AT1G21890.1	34.262	359	230	1	23	381	12	364	5.70e-71	228
Msa0050790	AT1G44800.1	34.188	351	210	2	18	362	7	342	8.25e-71	227
Msa0050790	AT4G08300.1	34.384	349	215	3	18	365	7	342	2.54e-70	226
Msa0050790	AT4G19185.1	39.169	337	198	4	23	356	22	354	6.48e-70	225
Msa0050790	AT3G30340.1	33.828	337	209	3	26	362	15	337	2.64e-68	220
Msa0050790	AT2G40900.1	36.522	345	199	3	12	356	1	325	2.88e-68	221
Msa0050790	AT2G37460.1	35.674	356	205	6	18	369	11	346	3.63e-66	215
Msa0050790	AT1G43650.1	33.144	353	216	2	23	373	8	342	5.31e-63	206
Msa0050790	AT5G13670.1	33.628	339	211	3	18	355	4	329	3.49e-62	205
Msa0050790	AT4G01440.1	35.294	323	194	3	41	363	29	336	2.70e-61	202
Msa0050790	AT4G01430.1	33.934	333	205	4	24	354	11	330	1.52e-60	200
Msa0050790	AT1G01070.1	33.626	342	212	3	16	356	10	337	8.08e-60	198
Msa0050790	AT1G11450.3	35.030	334	200	4	24	356	18	335	1.17e-59	197
Msa0050790	AT3G45870.9	42.264	265	148	3	18	282	8	267	2.35e-59	194
Msa0050790	AT1G21890.2	35.161	310	195	1	23	332	12	315	4.05e-59	196
Msa0050790	AT3G56620.1	33.721	344	203	3	12	352	1	322	3.57e-58	194
Msa0050790	AT4G01440.3	35.959	292	172	3	41	332	29	305	7.71e-56	186
Msa0050790	AT1G11450.5	36.156	307	179	4	51	356	1	291	1.32e-55	186
Msa0050790	AT5G64700.1	31.686	344	227	3	29	372	15	350	1.24e-54	184
Msa0050790	AT1G11460.1	33.234	334	207	3	24	356	18	336	3.44e-54	182
Msa0050790	AT1G11450.2	36.577	298	172	4	60	356	3	284	3.69e-54	181
Msa0050790	AT4G28040.1	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050790	AT4G28040.5	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050790	AT4G28040.3	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050790	AT4G28040.4	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050790	AT4G28040.2	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050790	AT4G01430.2	33.119	311	193	4	24	332	11	308	8.13e-52	176
Msa0050790	AT1G11450.4	34.194	310	187	4	24	332	18	311	8.54e-51	173
Msa0050790	AT4G19185.2	36.604	265	161	4	95	356	16	276	3.55e-50	172
Msa0050790	AT2G37450.2	33.140	344	185	8	24	363	11	313	5.29e-50	172
Msa0050790	AT5G45370.6	34.926	272	174	3	105	375	1	270	2.09e-49	168
Msa0050790	AT5G45370.5	34.926	272	174	3	105	375	1	270	2.09e-49	168
Msa0050790	AT1G25270.1	32.934	334	209	2	24	356	5	324	7.68e-49	169
Msa0050790	AT1G68170.2	30.607	379	243	4	14	391	5	364	3.18e-48	168
Msa0050790	AT1G01070.2	33.793	290	177	3	68	356	15	290	3.45e-48	166
Msa0050790	AT4G08290.2	36.604	265	153	3	18	281	9	259	5.22e-48	165
Msa0050790	AT1G68170.1	31.250	368	233	4	25	391	6	354	1.84e-47	166
Msa0050790	AT5G40210.1	31.953	338	189	10	25	357	16	317	5.86e-47	164
Msa0050790	AT3G28130.2	32.653	343	202	10	22	356	13	334	5.96e-47	164
Msa0050790	AT4G01450.2	35.238	315	183	2	41	354	29	323	1.02e-46	164
Msa0050790	AT3G30340.2	32.685	257	159	3	26	282	15	257	1.11e-45	159
Msa0050790	AT1G11450.1	36.822	258	146	4	100	356	2	243	4.07e-45	157
Msa0050790	AT4G01450.1	34.471	293	171	2	41	332	29	301	5.09e-45	159
Msa0050790	AT5G40240.2	28.846	364	233	4	1	357	13	357	9.22e-45	159
Msa0050790	AT5G40240.1	30.000	340	212	4	25	357	23	343	1.04e-44	159
Msa0050790	AT5G40240.3	30.000	340	212	4	25	357	23	343	1.04e-44	159
Msa0050790	AT3G28050.1	31.267	371	223	10	25	387	15	361	1.20e-44	158
Msa0050790	AT4G01440.4	36.777	242	138	3	41	282	29	255	4.09e-44	154
Msa0050790	AT3G28100.1	30.286	350	219	8	25	370	17	345	1.19e-43	155
Msa0050790	AT5G40230.1	29.223	373	223	7	25	384	24	368	1.79e-43	155
Msa0050790	AT3G28130.5	33.594	256	149	6	105	356	10	248	2.42e-42	149
Msa0050790	AT3G28130.1	33.594	256	149	6	105	356	10	248	2.42e-42	149
Msa0050790	AT1G70260.1	29.462	353	233	5	24	370	14	356	8.18e-41	148
Msa0050790	AT3G28080.1	30.473	338	210	6	25	356	17	335	9.99e-41	148
Msa0050790	AT3G28070.2	29.740	269	168	5	105	371	8	257	2.55e-40	144
Msa0050790	AT3G28080.5	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050790	AT3G28080.7	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050790	AT3G28080.8	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050790	AT3G28080.6	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050790	AT3G45870.5	38.426	216	128	3	134	349	49	259	1.92e-39	143
Msa0050790	AT3G28070.1	29.740	269	168	5	105	371	100	349	2.64e-39	144
Msa0050790	AT3G28080.2	31.621	253	158	3	105	356	89	327	2.74e-39	144
Msa0050790	AT4G01450.4	34.156	243	139	2	41	282	29	251	2.67e-38	139
Msa0050790	AT4G01440.5	32.365	241	148	3	123	363	3	228	3.92e-38	138
Msa0050790	AT4G01440.2	32.365	241	148	3	123	363	3	228	3.92e-38	138
Msa0050790	AT5G47470.1	27.920	351	225	7	9	354	17	344	2.60e-37	139
Msa0050790	AT5G47470.2	27.920	351	225	7	9	354	45	372	3.34e-37	139
Msa0050790	AT5G47470.3	27.920	351	225	7	9	354	45	372	4.26e-37	139
Msa0050790	AT2G37450.3	34.100	261	148	6	107	363	1	241	5.97e-37	135
Msa0050790	AT5G45370.3	32.780	241	159	3	136	375	74	312	8.77e-37	136
Msa0050790	AT1G43650.2	31.274	259	160	1	23	281	8	248	9.42e-36	132
Msa0050790	AT4G15540.1	28.011	357	224	5	25	380	20	344	1.79e-34	130
Msa0050790	AT4G15540.2	28.011	357	224	5	25	380	20	344	1.79e-34	130
Msa0050790	AT4G16620.1	27.966	354	230	6	30	375	20	356	8.57e-34	129
Msa0050790	AT3G45870.6	37.186	199	120	3	134	332	49	242	1.40e-33	126
Msa0050790	AT3G45870.7	37.186	199	120	3	134	332	49	242	1.40e-33	126
Msa0050790	AT4G01450.3	35.071	211	116	2	41	250	29	219	4.15e-33	124
Msa0050790	AT5G64700.2	32.500	240	154	3	29	268	15	246	3.07e-32	122
Msa0050790	AT3G45870.2	37.234	188	113	3	162	349	1	183	1.24e-30	117
Msa0050790	AT1G60050.1	27.554	323	221	3	38	356	29	342	1.28e-30	121
Msa0050790	AT3G28130.3	30.973	226	135	6	135	356	1	209	3.62e-30	116
Msa0050790	AT3G28070.3	28.261	230	148	4	105	332	100	314	6.77e-29	115
Msa0050790	AT4G01430.3	31.220	205	127	3	151	354	2	193	1.60e-28	112
Msa0050790	AT3G28070.5	26.778	239	154	5	135	371	1	220	1.30e-27	109
Msa0050790	AT3G28080.9	28.251	223	145	3	135	356	1	209	1.64e-27	109
Msa0050790	AT2G37450.1	32.479	234	134	6	134	363	61	274	6.42e-27	109
Msa0050790	AT4G24980.1	28.302	318	147	8	38	355	3	239	8.75e-26	105
Msa0050790	AT3G28130.4	31.783	258	148	9	22	271	13	250	2.20e-24	101
Msa0050790	AT3G28100.3	31.076	251	153	6	25	271	17	251	1.01e-23	99.8
Msa0050790	AT4G16620.4	27.536	276	176	5	107	375	1	259	1.71e-23	99.0
Msa0050790	AT4G16620.2	27.536	276	176	5	107	375	1	259	1.71e-23	99.0
Msa0050790	AT3G45870.3	36.913	149	89	3	134	282	49	192	1.94e-21	92.0
Msa0050790	AT3G45870.4	36.735	147	88	3	136	282	4	145	2.03e-21	90.5
Msa0050790	AT3G28100.2	37.342	158	95	3	25	180	17	172	4.35e-21	92.0
Msa0050790	AT3G28130.6	36.943	157	91	4	22	174	13	165	2.10e-20	89.4
Msa0050790	AT4G16620.3	29.279	222	139	4	30	250	20	224	5.79e-20	89.4
Msa0050790	AT3G28080.3	36.025	161	93	3	25	180	17	172	7.97e-17	80.9
Msa0050790	AT3G28080.3	33.784	74	48	1	283	356	209	281	8.84e-11	62.8
Msa0050790	AT3G28080.4	46.053	76	41	0	105	180	8	83	4.90e-16	77.0
Msa0050790	AT3G28080.4	33.784	74	48	1	283	356	120	192	5.13e-11	62.4

Find 113 sgRNAs with CRISPR-Local

Find 193 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ACAACACCAATGATTGATTT+TGG	0.075897	1_2:-4784324	Msa0050790:CDS
CAAACTAGTGTTGGTTAATT+AGG	0.160697	1_2:+4785739	None:intergenic
CTTGGATGTCTTTATCTAAT+TGG	0.160867	1_2:-4784261	Msa0050790:CDS
TTTGCTAGGCTTCAATTATT+TGG	0.186662	1_2:-4785713	Msa0050790:five_prime_UTR
TCTTCCATTTGCTTATTTCT+TGG	0.199338	1_2:-4785435	Msa0050790:CDS
TATTCTACAATGGCTGATTT+AGG	0.205011	1_2:-4785638	Msa0050790:exon
TTTCTTTATGGTTTGATTTA+CGG	0.229174	1_2:-4782904	Msa0050790:three_prime_UTR
TATGTTAGTTAATTTCTTTA+TGG	0.244766	1_2:-4782916	Msa0050790:three_prime_UTR
CTTAAACGGGGTCATCATTT+TGG	0.252308	1_2:-4782736	Msa0050790:three_prime_UTR
ACTTCCTATACATGTTTCTT+TGG	0.256420	1_2:-4784162	Msa0050790:CDS
ATCAGTGATTACATTATATC+AGG	0.276969	1_2:-4784412	Msa0050790:CDS
TTGCATTTGCAGTACAAATA+TGG	0.283549	1_2:-4783937	Msa0050790:CDS
GCAATTTCTTCTTATTGCTT+TGG	0.291149	1_2:-4784133	Msa0050790:CDS
TGGGAGTGGTTTCAAAAGTA+TGG	0.304445	1_2:-4782803	Msa0050790:three_prime_UTR
AAATTTCTCAAGATTAGAAT+TGG	0.317880	1_2:-4782823	Msa0050790:three_prime_UTR
ATCATGGCTTCTATTGCTTT+AGG	0.322920	1_2:-4783848	Msa0050790:CDS
CTAATTAACCAACACTAGTT+TGG	0.326664	1_2:-4785738	Msa0050790:five_prime_UTR
GATGCTTTAGCGTGGCTTGC+GGG	0.332227	1_2:+4783189	None:intergenic
CAGAGGAAGTTTAAATTAAT+CGG	0.338959	1_2:+4784965	None:intergenic
CTAACTAACCGCGTATAAAA+TGG	0.340348	1_2:+4784056	None:intergenic
GGTTTCAAAAGTATGGTAAT+TGG	0.340685	1_2:-4782796	Msa0050790:three_prime_UTR
CCTTTATATTACAGGATCAT+TGG	0.349819	1_2:-4783327	Msa0050790:intron
CCACTATTTAAGTGACTACT+TGG	0.366846	1_2:+4784366	None:intergenic
CACAAATTGTGACTCTTAAA+CGG	0.370000	1_2:-4782750	Msa0050790:three_prime_UTR
ATCAAGGTTTCTACTTGCTT+GGG	0.374867	1_2:-4784682	Msa0050790:CDS
AATCAAGGTTTCTACTTGCT+TGG	0.382223	1_2:-4784683	Msa0050790:CDS
TCTTAGTAGATTATTTAGAT+TGG	0.388213	1_2:-4783043	Msa0050790:three_prime_UTR
CACACAAGCATGGTACTATA+AGG	0.389716	1_2:+4783098	None:intergenic
ATTGTTTGTCTTGGTCTGCT+TGG	0.391168	1_2:-4784236	Msa0050790:CDS
CTTAGTAGATTATTTAGATT+GGG	0.394466	1_2:-4783042	Msa0050790:three_prime_UTR
TTGCAGGGAGTGGTGGCATC+TGG	0.399814	1_2:-4783962	Msa0050790:intron
GCCCTGCAGTTTGGTTATGC+TGG	0.404103	1_2:-4785548	Msa0050790:CDS
TAATTGGACATTGTTTGTCT+TGG	0.407693	1_2:-4784245	Msa0050790:CDS
GCCATGTTGGCCCTGCAGTT+TGG	0.410120	1_2:-4785557	Msa0050790:CDS
ACAAATTGTGACTCTTAAAC+GGG	0.414592	1_2:-4782749	Msa0050790:three_prime_UTR
GCTACAACAAAAGTTTGAAC+AGG	0.438205	1_2:+4783872	None:intergenic
AACAGGATTACAGCAAATCA+AGG	0.453990	1_2:-4784698	Msa0050790:intron
GCAATGATGTTCCTATAGAC+AGG	0.454821	1_2:+4785470	None:intergenic
TTGAAAGAAATGCTCAGGCT+TGG	0.458050	1_2:-4784107	Msa0050790:CDS
ATGGGAACATGTTGTAATAG+TGG	0.458354	1_2:-4783001	Msa0050790:three_prime_UTR
GGACTTGGACTATATATAGT+TGG	0.461139	1_2:+4784387	None:intergenic
CCCTGCCATTACATTTCTCA+TGG	0.470693	1_2:-4784612	Msa0050790:CDS
AATTTCTCAAGATTAGAATT+GGG	0.471413	1_2:-4782822	Msa0050790:three_prime_UTR
CCAAGTAGTCACTTAAATAG+TGG	0.472865	1_2:-4784366	Msa0050790:CDS
ATTGTCCCAAAATCAATCAT+TGG	0.475219	1_2:+4784318	None:intergenic
TTCAAGAGCTGCACTTAACA+TGG	0.475828	1_2:-4785513	Msa0050790:CDS
TTAATTACTAAAGCTAATAG+TGG	0.477006	1_2:-4782619	Msa0050790:three_prime_UTR
AAGTCCAAAGAAACATGTAT+AGG	0.477885	1_2:+4784158	None:intergenic
CAAATATGGTGCATTGATAG+AGG	0.486474	1_2:-4783923	Msa0050790:CDS
GACGAGCAGGATACTTCTTA+AGG	0.487109	1_2:+4784193	None:intergenic
GATGGAATTGCTAAAGTAGC+AGG	0.489379	1_2:-4784459	Msa0050790:CDS
TTGGTTAATTAGGAAAAGAA+AGG	0.496181	1_2:+4785749	None:intergenic
TTTAAGTGACTACTTGGACT+TGG	0.498895	1_2:+4784372	None:intergenic
AGAAATAAGCAAATGGAAGA+AGG	0.501047	1_2:+4785438	None:intergenic
TGGACTATACTTTGTGCTGT+GGG	0.502383	1_2:-4783286	Msa0050790:CDS
TTCTCATGGCAGTCATACTA+AGG	0.503575	1_2:-4784598	Msa0050790:intron
TTTAGGAGAAGAGTTCTACT+TGG	0.503735	1_2:-4783831	Msa0050790:CDS
GCCATGAGAAATGTAATGGC+AGG	0.506658	1_2:+4784611	None:intergenic
GTTAATTAGGAAAAGAAAGG+TGG	0.513729	1_2:+4785752	None:intergenic
AGGTTTCTACTTGCTTGGGT+TGG	0.514004	1_2:-4784678	Msa0050790:CDS
ATAGTGGATGTCACTAAAAG+TGG	0.518080	1_2:-4782985	Msa0050790:three_prime_UTR
AGGAAAAGAAAGGTGGGAAG+TGG	0.518388	1_2:+4785759	None:intergenic
AACCAGCATAACCAAACTGC+AGG	0.522465	1_2:+4785546	None:intergenic
AGTATGGTAATTGGCAAGCA+TGG	0.522694	1_2:-4782787	Msa0050790:three_prime_UTR
GAGAAGAGTTCTACTTGGGC+GGG	0.532422	1_2:-4783826	Msa0050790:intron
ATGTCACTTGGTGATGCAAA+GGG	0.532729	1_2:-4784297	Msa0050790:CDS
GTGAGATTGAATCGAAAGGA+TGG	0.534056	1_2:-4784477	Msa0050790:CDS
TGTATTGCTGATGCAAAGGT+AGG	0.537203	1_2:+4784644	None:intergenic
CTCAAGATTAGAATTGGGAG+TGG	0.539135	1_2:-4782817	Msa0050790:three_prime_UTR
CTGGACTATACTTTGTGCTG+TGG	0.541801	1_2:-4783287	Msa0050790:CDS
GAAGTGACAGAAAGACGAGC+AGG	0.543364	1_2:+4784180	None:intergenic
TGATACACTGCAACAAACAC+TGG	0.547318	1_2:+4783896	None:intergenic
TTAATTCAATTATTCTACAA+TGG	0.548981	1_2:-4785648	Msa0050790:exon
CATCATTATCATGACATGGA+AGG	0.551192	1_2:-4782850	Msa0050790:three_prime_UTR
TATTAATTTGCAGGGAGTGG+TGG	0.551473	1_2:-4783969	Msa0050790:intron
GTATTGCTGATGCAAAGGTA+GGG	0.556287	1_2:+4784645	None:intergenic
TTAGGAGAAGAGTTCTACTT+GGG	0.557775	1_2:-4783830	Msa0050790:CDS
GCAGGATACTTCTTAAGGAC+AGG	0.559573	1_2:+4784198	None:intergenic
ATCATTATCATGACATGGAA+GGG	0.562114	1_2:-4782849	Msa0050790:three_prime_UTR
AGAGAAGAAATTATTTGCAA+AGG	0.564376	1_2:-4783253	Msa0050790:CDS
TAAAGCAATAGAAGCCATGA+TGG	0.564411	1_2:+4783850	None:intergenic
TCAGCTGCATGTGGCCATGT+TGG	0.564609	1_2:-4785570	Msa0050790:CDS
ACCAAACTGCAGGGCCAACA+TGG	0.565314	1_2:+4785556	None:intergenic
CAGCTTCTTCTAAGAGAATG+TGG	0.569037	1_2:-4785613	Msa0050790:CDS
AATGTCACTTGGTGATGCAA+AGG	0.570694	1_2:-4784298	Msa0050790:CDS
GGTGCAGTGTTGATAGTAGC+TGG	0.570883	1_2:-4783306	Msa0050790:CDS
TAGTGGATGTCACTAAAAGT+GGG	0.571839	1_2:-4782984	Msa0050790:three_prime_UTR
TCTGTTGAAGAAGATAGGAA+TGG	0.578628	1_2:+4783156	None:intergenic
TTAATTAGGAAAAGAAAGGT+GGG	0.579788	1_2:+4785753	None:intergenic
TCAGTGATTACATTATATCA+GGG	0.580478	1_2:-4784411	Msa0050790:CDS
TAATTACTAAAGCTAATAGT+GGG	0.588040	1_2:-4782618	Msa0050790:three_prime_UTR
TGATGCTTTAGCGTGGCTTG+CGG	0.596033	1_2:+4783188	None:intergenic
CAATGATGTTCCTATAGACA+GGG	0.596068	1_2:+4785471	None:intergenic
ATATATATATAAAAGCATAT+GGG	0.599668	1_2:+4782938	None:intergenic
GACTGCCATGAGAAATGTAA+TGG	0.601131	1_2:+4784607	None:intergenic
GTTCTGTATTGCTGATGCAA+AGG	0.604446	1_2:+4784640	None:intergenic
ATAATGACCTAGATGCATGC+TGG	0.606908	1_2:-4782669	Msa0050790:three_prime_UTR
GGAGAAGAGTTCTACTTGGG+CGG	0.607421	1_2:-4783827	Msa0050790:CDS
GTGCAGCTCTTGAAACAACA+TGG	0.618096	1_2:+4785522	None:intergenic
AGGAAGTTTAAATTAATCGG+TGG	0.623492	1_2:+4784968	None:intergenic
GCAAGTGAGATTGAATCGAA+AGG	0.625916	1_2:-4784481	Msa0050790:CDS
TCAAGAGCTGCACTTAACAT+GGG	0.631283	1_2:-4785512	Msa0050790:CDS
CCATGAGAAATGTAATGGCA+GGG	0.635566	1_2:+4784612	None:intergenic
TATCACAACACACACAAGCA+TGG	0.644681	1_2:+4783088	None:intergenic
TAGTCATCATTATCATGACA+TGG	0.647380	1_2:-4782854	Msa0050790:three_prime_UTR
CATATGGGACTAATTTCACA+AGG	0.653189	1_2:+4782953	None:intergenic
TATTGCTGATGCAAAGGTAG+GGG	0.668908	1_2:+4784646	None:intergenic
ATATGGTGCATTGATAGAGG+AGG	0.677817	1_2:-4783920	Msa0050790:CDS
ACCAGCATAACCAAACTGCA+GGG	0.678569	1_2:+4785547	None:intergenic
GGACTATACTTTGTGCTGTG+GGG	0.683443	1_2:-4783285	Msa0050790:CDS
GAGTGAGTGATGCTTTAGCG+TGG	0.695699	1_2:+4783181	None:intergenic
AGTGGATGTCACTAAAAGTG+GGG	0.697940	1_2:-4782983	Msa0050790:three_prime_UTR
CAAATTGTGACTCTTAAACG+GGG	0.725158	1_2:-4782748	Msa0050790:three_prime_UTR

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	AAATTAATTTTATAAATTAA+AGG	-	chr1_2:4783469-4783488	Msa0050790:intron	0.0%
!!!	AAAAATTATTAAAGGTATAA+AGG	+	chr1_2:4783564-4783583	None:intergenic	10.0%
!!	TCAACATAAAAAATTATTAA+AGG	+	chr1_2:4783572-4783591	None:intergenic	10.0%
!!!	ATTTTTTTTTATTAATTTGC+AGG	-	chr1_2:4784316-4784335	Msa0050790:CDS	10.0%
!!!	TTTTTTTTTATTAATTTGCA+GGG	-	chr1_2:4784317-4784336	Msa0050790:CDS	10.0%
!!!	GAGTTTTTTTTTTTTTTTTA+TGG	-	chr1_2:4785274-4785293	Msa0050790:intron	10.0%
!!!	ATATATATATAAAAGCATAT+GGG	+	chr1_2:4785359-4785378	None:intergenic	10.0%
!!!	TATATATATATAAAAGCATA+TGG	+	chr1_2:4785360-4785379	None:intergenic	10.0%
!!	TTAATTCAATTATTCTACAA+TGG	-	chr1_2:4782646-4782665	Msa0050790:three_prime_UTR	15.0%
!!	AATATTAATGAAATTGTTAG+AGG	+	chr1_2:4782901-4782920	None:intergenic	15.0%
!!	ATAATGTACAAAAATTTCAT+AGG	+	chr1_2:4782929-4782948	None:intergenic	15.0%
!!	AATCCAATATAAAAAAACTT+TGG	+	chr1_2:4782966-4782985	None:intergenic	15.0%
!!!	TTTTTTATGTTGAATTAAAC+AGG	-	chr1_2:4783579-4783598	Msa0050790:intron	15.0%
!!!	AAATTTTGCATGAATTTTTT+TGG	+	chr1_2:4783778-4783797	None:intergenic	15.0%
!!	TATCATAAACATTTGAATTA+AGG	+	chr1_2:4784517-4784536	None:intergenic	15.0%
!!!	AAGTTTTTGTTACTAATTTA+GGG	-	chr1_2:4784799-4784818	Msa0050790:intron	15.0%
!!	TGAATAAAGTAAAATCAAAA+GGG	+	chr1_2:4784935-4784954	None:intergenic	15.0%
!!	ATGAATAAAGTAAAATCAAA+AGG	+	chr1_2:4784936-4784955	None:intergenic	15.0%
!!	TATGTTAGTTAATTTCTTTA+TGG	-	chr1_2:4785378-4785397	Msa0050790:intron	15.0%
!!!	CAACCAAAGTTTTTTTATAT+TGG	-	chr1_2:4782960-4782979	Msa0050790:three_prime_UTR	20.0%
!!!	AACGTGTCAATTTTTATAAA+AGG	+	chr1_2:4783081-4783100	None:intergenic	20.0%
!!!	GAACAATATTTTGTGTAATT+GGG	-	chr1_2:4783857-4783876	Msa0050790:CDS	20.0%
!!!	AACAATATTTTGTGTAATTG+GGG	-	chr1_2:4783858-4783877	Msa0050790:CDS	20.0%
!!	GTATTTACTAAACAACTTAT+CGG	-	chr1_2:4784675-4784694	Msa0050790:CDS	20.0%
!!!	TTTGATTGCGATTTTATTTT+TGG	-	chr1_2:4784709-4784728	Msa0050790:intron	20.0%
!!!	CAAGTTTTTGTTACTAATTT+AGG	-	chr1_2:4784798-4784817	Msa0050790:intron	20.0%
!!	TCTTAGTAGATTATTTAGAT+TGG	-	chr1_2:4785251-4785270	Msa0050790:intron	20.0%
!!	CTTAGTAGATTATTTAGATT+GGG	-	chr1_2:4785252-4785271	Msa0050790:intron	20.0%
!!!	TTTCTTTATGGTTTGATTTA+CGG	-	chr1_2:4785390-4785409	Msa0050790:intron	20.0%
!!	AAATTTCTCAAGATTAGAAT+TGG	-	chr1_2:4785471-4785490	Msa0050790:CDS	20.0%
!!	AATTTCTCAAGATTAGAATT+GGG	-	chr1_2:4785472-4785491	Msa0050790:CDS	20.0%
!!	TTAATTACTAAAGCTAATAG+TGG	-	chr1_2:4785675-4785694	Msa0050790:five_prime_UTR	20.0%
!!	TAATTACTAAAGCTAATAGT+GGG	-	chr1_2:4785676-4785695	Msa0050790:five_prime_UTR	20.0%
!	TTAATTAGGAAAAGAAAGGT+GGG	+	chr1_2:4782544-4782563	None:intergenic	25.0%
!	TTGGTTAATTAGGAAAAGAA+AGG	+	chr1_2:4782548-4782567	None:intergenic	25.0%
!!	TTTTCCAAGAAATAAGCAAA+TGG	+	chr1_2:4782866-4782885	None:intergenic	25.0%
!	TAATGAAATTGTTAGAGGAA+TGG	+	chr1_2:4782896-4782915	None:intergenic	25.0%
!!	TATTTAGTTCCCGTTAAAAT+GGG	+	chr1_2:4783109-4783128	None:intergenic	25.0%
!!	ATATTTAGTTCCCGTTAAAA+TGG	+	chr1_2:4783110-4783129	None:intergenic	25.0%
!	CAGAGGAAGTTTAAATTAAT+CGG	+	chr1_2:4783332-4783351	None:intergenic	25.0%
!!	GGAACAATATTTTGTGTAAT+TGG	-	chr1_2:4783856-4783875	Msa0050790:CDS	25.0%
!	ATCAGTGATTACATTATATC+AGG	-	chr1_2:4783882-4783901	Msa0050790:CDS	25.0%
!	TCAGTGATTACATTATATCA+GGG	-	chr1_2:4783883-4783902	Msa0050790:CDS	25.0%
!	TAATTTAAACCTAATAGTCG+TGG	+	chr1_2:4784264-4784283	None:intergenic	25.0%
!	TTGAATTAAGGATCGTAATT+AGG	+	chr1_2:4784505-4784524	None:intergenic	25.0%
!	GTAACAAAAACTTGATCATA+GGG	+	chr1_2:4784792-4784811	None:intergenic	25.0%
!	AGTAACAAAAACTTGATCAT+AGG	+	chr1_2:4784793-4784812	None:intergenic	25.0%
!	TTGAAGCAAAAAATCATCAT+AGG	-	chr1_2:4784838-4784857	Msa0050790:intron	25.0%
!	TAGGATATACTACTATTGAA+TGG	-	chr1_2:4784857-4784876	Msa0050790:intron	25.0%
!	ATAATACCCCTTTATATTAC+AGG	-	chr1_2:4784959-4784978	Msa0050790:CDS	25.0%
!	AATGATCCTGTAATATAAAG+GGG	+	chr1_2:4784968-4784987	None:intergenic	25.0%
!	CAATGATCCTGTAATATAAA+GGG	+	chr1_2:4784969-4784988	None:intergenic	25.0%
!	AGAGAAGAAATTATTTGCAA+AGG	-	chr1_2:4785041-4785060	Msa0050790:intron	25.0%
	GTTAATTAGGAAAAGAAAGG+TGG	+	chr1_2:4782545-4782564	None:intergenic	30.0%
!!	CAAACTAGTGTTGGTTAATT+AGG	+	chr1_2:4782558-4782577	None:intergenic	30.0%
	CTAATTAACCAACACTAGTT+TGG	-	chr1_2:4782556-4782575	Msa0050790:three_prime_UTR	30.0%
	TTTGCTAGGCTTCAATTATT+TGG	-	chr1_2:4782581-4782600	Msa0050790:three_prime_UTR	30.0%
!	TATTCTACAATGGCTGATTT+AGG	-	chr1_2:4782656-4782675	Msa0050790:three_prime_UTR	30.0%
	AGAAATAAGCAAATGGAAGA+AGG	+	chr1_2:4782859-4782878	None:intergenic	30.0%
!	TCTTCCATTTGCTTATTTCT+TGG	-	chr1_2:4782859-4782878	Msa0050790:three_prime_UTR	30.0%
	TTCCTTAGCATATTCTCTTA+AGG	-	chr1_2:4782984-4783003	Msa0050790:three_prime_UTR	30.0%
!!	ACGTTTAGTTCCCATTTTAA+CGG	-	chr1_2:4783096-4783115	Msa0050790:three_prime_UTR	30.0%
!	TGTTTCTTTTCCTTTTGTTC+AGG	-	chr1_2:4783294-4783313	Msa0050790:CDS	30.0%
	AGGAAGTTTAAATTAATCGG+TGG	+	chr1_2:4783329-4783348	None:intergenic	30.0%
!!!	TTCTTTTTTCTCGCACTTAT+TGG	-	chr1_2:4783356-4783375	Msa0050790:intron	30.0%
!!!	TCTTTTTTCTCGCACTTATT+GGG	-	chr1_2:4783357-4783376	Msa0050790:intron	30.0%
	TCATGCAAAATTTCATCAAC+AGG	-	chr1_2:4783785-4783804	Msa0050790:intron	30.0%
!!	ACAACACCAATGATTGATTT+TGG	-	chr1_2:4783970-4783989	Msa0050790:intron	30.0%
!!	CAACACCAATGATTGATTTT+GGG	-	chr1_2:4783971-4783990	Msa0050790:intron	30.0%
	ATTGTCCCAAAATCAATCAT+TGG	+	chr1_2:4783979-4783998	None:intergenic	30.0%
	CTTGGATGTCTTTATCTAAT+TGG	-	chr1_2:4784033-4784052	Msa0050790:intron	30.0%
	TAATTGGACATTGTTTGTCT+TGG	-	chr1_2:4784049-4784068	Msa0050790:intron	30.0%
	ACTTCCTATACATGTTTCTT+TGG	-	chr1_2:4784132-4784151	Msa0050790:CDS	30.0%
	AAGTCCAAAGAAACATGTAT+AGG	+	chr1_2:4784139-4784158	None:intergenic	30.0%
	GCAATTTCTTCTTATTGCTT+TGG	-	chr1_2:4784161-4784180	Msa0050790:CDS	30.0%
!!!	TTTTATTAATTTGCAGGGAG+TGG	-	chr1_2:4784322-4784341	Msa0050790:CDS	30.0%
	TTGCATTTGCAGTACAAATA+TGG	-	chr1_2:4784357-4784376	Msa0050790:CDS	30.0%
	TAAGGATCGTAATTAGGATT+AGG	+	chr1_2:4784499-4784518	None:intergenic	30.0%
	GTATCATTACATAAGATACG+TGG	+	chr1_2:4784604-4784623	None:intergenic	30.0%
	AATGACCTAAAGTGAGATAA+AGG	-	chr1_2:4784633-4784652	Msa0050790:CDS	30.0%
	ATGACCTAAAGTGAGATAAA+GGG	-	chr1_2:4784634-4784653	Msa0050790:CDS	30.0%
	AATACCCTTTATCTCACTTT+AGG	+	chr1_2:4784641-4784660	None:intergenic	30.0%
	CCAATGATCCTGTAATATAA+AGG	+	chr1_2:4784970-4784989	None:intergenic	30.0%
	CCTTTATATTACAGGATCAT+TGG	-	chr1_2:4784967-4784986	Msa0050790:CDS	30.0%
!	CATTTTCTGTTGAAGAAGAT+AGG	+	chr1_2:4785146-4785165	None:intergenic	30.0%
	TAGTCATCATTATCATGACA+TGG	-	chr1_2:4785440-4785459	Msa0050790:CDS	30.0%
	ATCATTATCATGACATGGAA+GGG	-	chr1_2:4785445-4785464	Msa0050790:CDS	30.0%
!	GGTTTCAAAAGTATGGTAAT+TGG	-	chr1_2:4785498-4785517	Msa0050790:CDS	30.0%
	CACAAATTGTGACTCTTAAA+CGG	-	chr1_2:4785544-4785563	Msa0050790:CDS	30.0%
	ACAAATTGTGACTCTTAAAC+GGG	-	chr1_2:4785545-4785564	Msa0050790:CDS	30.0%
	AGCAAAAACCAAACTAGTGT+TGG	+	chr1_2:4782567-4782586	None:intergenic	35.0%
!!!	ACACTAGTTTGGTTTTTGCT+AGG	-	chr1_2:4782567-4782586	Msa0050790:three_prime_UTR	35.0%
!	CATGCAGCTGAAATTTTTCA+GGG	+	chr1_2:4782715-4782734	None:intergenic	35.0%
!	ACATGCAGCTGAAATTTTTC+AGG	+	chr1_2:4782716-4782735	None:intergenic	35.0%
	TGAAAAATTTCAGCTGCATG+TGG	-	chr1_2:4782715-4782734	Msa0050790:three_prime_UTR	35.0%
!!	AACTTGTTTTCCCTGTCTAT+AGG	-	chr1_2:4782813-4782832	Msa0050790:three_prime_UTR	35.0%
	CAATGATGTTCCTATAGACA+GGG	+	chr1_2:4782826-4782845	None:intergenic	35.0%
	TGCCTTAAGAGAATATGCTA+AGG	+	chr1_2:4782989-4783008	None:intergenic	35.0%
!!	CGTTTAGTTCCCATTTTAAC+GGG	-	chr1_2:4783097-4783116	Msa0050790:three_prime_UTR	35.0%
!	TCTTTTCCTTTTGTTCAGGA+AGG	-	chr1_2:4783298-4783317	Msa0050790:CDS	35.0%
	TAAGTGCGAGAAAAAAGAAC+TGG	+	chr1_2:4783355-4783374	None:intergenic	35.0%
	AACAGGATTACAGCAAATCA+AGG	-	chr1_2:4783596-4783615	Msa0050790:intron	35.0%
	AATCAAGGTTTCTACTTGCT+TGG	-	chr1_2:4783611-4783630	Msa0050790:intron	35.0%
	ATCAAGGTTTCTACTTGCTT+GGG	-	chr1_2:4783612-4783631	Msa0050790:intron	35.0%
	GGACTTGGACTATATATAGT+TGG	+	chr1_2:4783910-4783929	None:intergenic	35.0%
	TTTAAGTGACTACTTGGACT+TGG	+	chr1_2:4783925-4783944	None:intergenic	35.0%
	CCACTATTTAAGTGACTACT+TGG	+	chr1_2:4783931-4783950	None:intergenic	35.0%
	CCAAGTAGTCACTTAAATAG+TGG	-	chr1_2:4783928-4783947	Msa0050790:CDS	35.0%
	GTGATGCAAAGGGAAAAAAT+TGG	-	chr1_2:4784007-4784026	Msa0050790:intron	35.0%
	AAGGGAAAAAATTGGACACT+TGG	-	chr1_2:4784015-4784034	Msa0050790:intron	35.0%
!!	GGTTTTTGAAAGAAATGCTC+AGG	-	chr1_2:4784182-4784201	Msa0050790:CDS	35.0%
!	AGCTTTCACCATTTTATACG+CGG	-	chr1_2:4784230-4784249	Msa0050790:CDS	35.0%
	CTAACTAACCGCGTATAAAA+TGG	+	chr1_2:4784241-4784260	None:intergenic	35.0%
!	CAAATATGGTGCATTGATAG+AGG	-	chr1_2:4784371-4784390	Msa0050790:CDS	35.0%
	GCTACAACAAAAGTTTGAAC+AGG	+	chr1_2:4784425-4784444	None:intergenic	35.0%
!!	AACTTTTGTTGTAGCCATCA+TGG	-	chr1_2:4784430-4784449	Msa0050790:CDS	35.0%
	TAAAGCAATAGAAGCCATGA+TGG	+	chr1_2:4784447-4784466	None:intergenic	35.0%
	ATCATGGCTTCTATTGCTTT+AGG	-	chr1_2:4784446-4784465	Msa0050790:CDS	35.0%
	TTTAGGAGAAGAGTTCTACT+TGG	-	chr1_2:4784463-4784482	Msa0050790:CDS	35.0%
	TTAGGAGAAGAGTTCTACTT+GGG	-	chr1_2:4784464-4784483	Msa0050790:CDS	35.0%
	TAATTGCTTTGCGAGTGTTT+AGG	+	chr1_2:4784552-4784571	None:intergenic	35.0%
	TTATGTAATGATACCGCCTT+CGG	-	chr1_2:4784610-4784629	Msa0050790:CDS	35.0%
	TCTGTTGAAGAAGATAGGAA+TGG	+	chr1_2:4785141-4785160	None:intergenic	35.0%
	ATGGGAACATGTTGTAATAG+TGG	-	chr1_2:4785293-4785312	Msa0050790:intron	35.0%
!!	ATAGTGGATGTCACTAAAAG+TGG	-	chr1_2:4785309-4785328	Msa0050790:intron	35.0%
!	TAGTGGATGTCACTAAAAGT+GGG	-	chr1_2:4785310-4785329	Msa0050790:intron	35.0%
	CATATGGGACTAATTTCACA+AGG	+	chr1_2:4785344-4785363	None:intergenic	35.0%
	CATCATTATCATGACATGGA+AGG	-	chr1_2:4785444-4785463	Msa0050790:CDS	35.0%
	CAAATTGTGACTCTTAAACG+GGG	-	chr1_2:4785546-4785565	Msa0050790:CDS	35.0%
!	ATTTTTACCAGCATGCATCT+AGG	+	chr1_2:4785635-4785654	None:intergenic	35.0%
!	CAGCTTCTTCTAAGAGAATG+TGG	-	chr1_2:4782681-4782700	Msa0050790:three_prime_UTR	40.0%
	TTCAAGAGCTGCACTTAACA+TGG	-	chr1_2:4782781-4782800	Msa0050790:three_prime_UTR	40.0%
	TCAAGAGCTGCACTTAACAT+GGG	-	chr1_2:4782782-4782801	Msa0050790:three_prime_UTR	40.0%
	GCAATGATGTTCCTATAGAC+AGG	+	chr1_2:4782827-4782846	None:intergenic	40.0%
	TATTGCTGATGCAAAGGTAG+GGG	+	chr1_2:4783651-4783670	None:intergenic	40.0%
	GTATTGCTGATGCAAAGGTA+GGG	+	chr1_2:4783652-4783671	None:intergenic	40.0%
	TGTATTGCTGATGCAAAGGT+AGG	+	chr1_2:4783653-4783672	None:intergenic	40.0%
	GTTCTGTATTGCTGATGCAA+AGG	+	chr1_2:4783657-4783676	None:intergenic	40.0%
	CCATGAGAAATGTAATGGCA+GGG	+	chr1_2:4783685-4783704	None:intergenic	40.0%
	GACTGCCATGAGAAATGTAA+TGG	+	chr1_2:4783690-4783709	None:intergenic	40.0%
	TTCTCATGGCAGTCATACTA+AGG	-	chr1_2:4783696-4783715	Msa0050790:intron	40.0%
	GCAAGTGAGATTGAATCGAA+AGG	-	chr1_2:4783813-4783832	Msa0050790:intron	40.0%
	GTGAGATTGAATCGAAAGGA+TGG	-	chr1_2:4783817-4783836	Msa0050790:intron	40.0%
	GATGGAATTGCTAAAGTAGC+AGG	-	chr1_2:4783835-4783854	Msa0050790:CDS	40.0%
!!!	GATTTTGGGACAATGTCACT+TGG	-	chr1_2:4783985-4784004	Msa0050790:intron	40.0%
!!	AATGTCACTTGGTGATGCAA+AGG	-	chr1_2:4783996-4784015	Msa0050790:intron	40.0%
!!	ATGTCACTTGGTGATGCAAA+GGG	-	chr1_2:4783997-4784016	Msa0050790:intron	40.0%
	ATTGTTTGTCTTGGTCTGCT+TGG	-	chr1_2:4784058-4784077	Msa0050790:intron	40.0%
	TTGAAAGAAATGCTCAGGCT+TGG	-	chr1_2:4784187-4784206	Msa0050790:CDS	40.0%
	GTTAGTTAGCCACGACTATT+AGG	-	chr1_2:4784252-4784271	Msa0050790:CDS	40.0%
!!	TATTAATTTGCAGGGAGTGG+TGG	-	chr1_2:4784325-4784344	Msa0050790:CDS	40.0%
!	ATATGGTGCATTGATAGAGG+AGG	-	chr1_2:4784374-4784393	Msa0050790:CDS	40.0%
	TGATACACTGCAACAAACAC+TGG	+	chr1_2:4784401-4784420	None:intergenic	40.0%
	TGGACTATACTTTGTGCTGT+GGG	-	chr1_2:4785008-4785027	Msa0050790:intron	40.0%
	CACACAAGCATGGTACTATA+AGG	+	chr1_2:4785199-4785218	None:intergenic	40.0%
	TATCACAACACACACAAGCA+TGG	+	chr1_2:4785209-4785228	None:intergenic	40.0%
	AGTGGATGTCACTAAAAGTG+GGG	-	chr1_2:4785311-4785330	Msa0050790:intron	40.0%
	CTCAAGATTAGAATTGGGAG+TGG	-	chr1_2:4785477-4785496	Msa0050790:CDS	40.0%
	TGGGAGTGGTTTCAAAAGTA+TGG	-	chr1_2:4785491-4785510	Msa0050790:CDS	40.0%
	AGTATGGTAATTGGCAAGCA+TGG	-	chr1_2:4785507-4785526	Msa0050790:CDS	40.0%
!	CTTAAACGGGGTCATCATTT+TGG	-	chr1_2:4785558-4785577	Msa0050790:CDS	40.0%
	ATAATGACCTAGATGCATGC+TGG	-	chr1_2:4785625-4785644	Msa0050790:CDS	40.0%
	AGGAAAAGAAAGGTGGGAAG+TGG	+	chr1_2:4782538-4782557	None:intergenic	45.0%
	ACCAGCATAACCAAACTGCA+GGG	+	chr1_2:4782750-4782769	None:intergenic	45.0%
	AACCAGCATAACCAAACTGC+AGG	+	chr1_2:4782751-4782770	None:intergenic	45.0%
	GTGCAGCTCTTGAAACAACA+TGG	+	chr1_2:4782775-4782794	None:intergenic	45.0%
	GTCTGTCCTTCCTGAACAAA+AGG	+	chr1_2:4783307-4783326	None:intergenic	45.0%
	CGAGAAAAAAGAACTGGCAG+AGG	+	chr1_2:4783349-4783368	None:intergenic	45.0%
	AGGTTTCTACTTGCTTGGGT+TGG	-	chr1_2:4783616-4783635	Msa0050790:intron	45.0%
	CCCTGCCATTACATTTCTCA+TGG	-	chr1_2:4783682-4783701	Msa0050790:intron	45.0%
	GCCATGAGAAATGTAATGGC+AGG	+	chr1_2:4783686-4783705	None:intergenic	45.0%
	GCAGGATACTTCTTAAGGAC+AGG	+	chr1_2:4784099-4784118	None:intergenic	45.0%
	GACGAGCAGGATACTTCTTA+AGG	+	chr1_2:4784104-4784123	None:intergenic	45.0%
!	CAGGCTTGGATTTTTCACTC+TGG	-	chr1_2:4784201-4784220	Msa0050790:CDS	45.0%
!	GCTTGGATTTTTCACTCTGG+TGG	-	chr1_2:4784204-4784223	Msa0050790:CDS	45.0%
	ACTTTAGGTCATTCCGAAGG+CGG	+	chr1_2:4784626-4784645	None:intergenic	45.0%
	CTCACTTTAGGTCATTCCGA+AGG	+	chr1_2:4784629-4784648	None:intergenic	45.0%
	CTGGACTATACTTTGTGCTG+TGG	-	chr1_2:4785007-4785026	Msa0050790:intron	45.0%
	GGACTATACTTTGTGCTGTG+GGG	-	chr1_2:4785009-4785028	Msa0050790:intron	45.0%
!!	AACGGGGTCATCATTTTGGT+CGG	-	chr1_2:4785562-4785581	Msa0050790:CDS	45.0%
!!!	AGTTTTTTTTTTTTTTTTAT+GGG	-	chr1_2:4785275-4785294	Msa0050790:intron	5.0%
	GAAGTGACAGAAAGACGAGC+AGG	+	chr1_2:4784117-4784136	None:intergenic	50.0%
	GGAGAAGAGTTCTACTTGGG+CGG	-	chr1_2:4784467-4784486	Msa0050790:CDS	50.0%
	GAGAAGAGTTCTACTTGGGC+GGG	-	chr1_2:4784468-4784487	Msa0050790:CDS	50.0%
!!	GGTGCAGTGTTGATAGTAGC+TGG	-	chr1_2:4784988-4785007	Msa0050790:intron	50.0%
	TGATGCTTTAGCGTGGCTTG+CGG	+	chr1_2:4785109-4785128	None:intergenic	50.0%
	GAGTGAGTGATGCTTTAGCG+TGG	+	chr1_2:4785116-4785135	None:intergenic	50.0%
	TCAGCTGCATGTGGCCATGT+TGG	-	chr1_2:4782724-4782743	Msa0050790:three_prime_UTR	55.0%
	ACCAAACTGCAGGGCCAACA+TGG	+	chr1_2:4782741-4782760	None:intergenic	55.0%
	GCCCTGCAGTTTGGTTATGC+TGG	-	chr1_2:4782746-4782765	Msa0050790:three_prime_UTR	55.0%
!	GATGCTTTAGCGTGGCTTGC+GGG	+	chr1_2:4785108-4785127	None:intergenic	55.0%
	GCCATGTTGGCCCTGCAGTT+TGG	-	chr1_2:4782737-4782756	Msa0050790:three_prime_UTR	60.0%
	TTGCAGGGAGTGGTGGCATC+TGG	-	chr1_2:4784332-4784351	Msa0050790:CDS	60.0%

Chromosome	Type	Strat	End	Strand	Name
chr1_2	gene	4782534	4785782	4782534	ID=Msa0050790;Name=Msa0050790
chr1_2	mRNA	4782534	4785782	4782534	ID=Msa0050790-mRNA-1;Parent=Msa0050790;Name=Msa0050790-mRNA-1;_AED=0.05;_eAED=0.05;_QI=131\|1\|1\|1\|1\|1\|6\|612\|395
chr1_2	exon	4782534	4783335	4782534	ID=Msa0050790-mRNA-1:exon:1290;Parent=Msa0050790-mRNA-1
chr1_2	exon	4783827	4783978	4783827	ID=Msa0050790-mRNA-1:exon:1289;Parent=Msa0050790-mRNA-1
chr1_2	exon	4784065	4784509	4784065	ID=Msa0050790-mRNA-1:exon:1288;Parent=Msa0050790-mRNA-1
chr1_2	exon	4784599	4784715	4784599	ID=Msa0050790-mRNA-1:exon:1287;Parent=Msa0050790-mRNA-1
chr1_2	exon	4784938	4785000	4784938	ID=Msa0050790-mRNA-1:exon:1286;Parent=Msa0050790-mRNA-1
chr1_2	exon	4785431	4785782	4785431	ID=Msa0050790-mRNA-1:exon:1285;Parent=Msa0050790-mRNA-1
chr1_2	five_prime_UTR	4785652	4785782	4785652	ID=Msa0050790-mRNA-1:five_prime_utr;Parent=Msa0050790-mRNA-1
chr1_2	CDS	4785431	4785651	4785431	ID=Msa0050790-mRNA-1:cds;Parent=Msa0050790-mRNA-1
chr1_2	CDS	4784938	4785000	4784938	ID=Msa0050790-mRNA-1:cds;Parent=Msa0050790-mRNA-1
chr1_2	CDS	4784599	4784715	4784599	ID=Msa0050790-mRNA-1:cds;Parent=Msa0050790-mRNA-1
chr1_2	CDS	4784065	4784509	4784065	ID=Msa0050790-mRNA-1:cds;Parent=Msa0050790-mRNA-1
chr1_2	CDS	4783827	4783978	4783827	ID=Msa0050790-mRNA-1:cds;Parent=Msa0050790-mRNA-1
chr1_2	CDS	4783146	4783335	4783146	ID=Msa0050790-mRNA-1:cds;Parent=Msa0050790-mRNA-1
chr1_2	three_prime_UTR	4782534	4783145	4782534	ID=Msa0050790-mRNA-1:three_prime_utr;Parent=Msa0050790-mRNA-1

Gene Sequence

>Msa0050790

ATGGCTGATTTAGGTTCAGCTTCTTCTAAGAGAATGTGGTGTTCTATCCCTGAAAAATTTCAGCTGCATGTGGCCATGTTGGCCCTGCAGTTTGGTTATGCTGGTTTCCATGTTGTTTCAAGAGCTGCACTTAACATGGGAGTTAGCAAACTTGTTTTCCCTGTCTATAGGAACATCATTGCTTTGCTTCTCCTTCTTCCATTTGCTTATTTCTTGGAAAAGAAGGACAGACCACCGATTAATTTAAACTTCCTCTGCCAGTTCTTTTTTCTCGCACTTATTGGGATTACAGCAAATCAAGGTTTCTACTTGCTTGGGTTGGATAACACATCCCCTACCTTTGCATCAGCAATACAGAACTCTGTCCCTGCCATTACATTTCTCATGGCAGTCATACTAAGGATAGAGCAAGTGAGATTGAATCGAAAGGATGGAATTGCTAAAGTAGCAGGAACAATATTTTGTGTAATTGGGGCATCAGTGATTACATTATATCAGGGACCAACTATATATAGTCCAAGTCCAAGTAGTCACTTAAATAGTGGCATAACAGAAGTAACAACAACAACACCAATGATTGATTTTGGGACAATGTCACTTGGTGATGCAAAGGGAAAAAATTGGACACTTGGATGTCTTTATCTAATTGGACATTGTTTGTCTTGGTCTGCTTGGCTTGTGTTTCAAGCACCTGTCCTTAAGAAGTATCCTGCTCGTCTTTCTGTCACTTCCTATACATGTTTCTTTGGACTTTTGCAATTTCTTCTTATTGCTTTGGTTTTTGAAAGAAATGCTCAGGCTTGGATTTTTCACTCTGGTGGTGAAGCTTTCACCATTTTATACGCGGGAGTGGTGGCATCTGGAATTGCATTTGCAGTACAAATATGGTGCATTGATAGAGGAGGTCCAGTGTTTGTTGCAGTGTATCAACCTGTTCAAACTTTTGTTGTAGCCATCATGGCTTCTATTGCTTTAGGAGAAGAGTTCTACTTGGGCGGGATCATTGGTGCAGTGTTGATAGTAGCTGGACTATACTTTGTGCTGTGGGGTAAAAGTGAAGAGAAGAAATTATTTGCAAAGGAACAGCTTGCAATTGCATCAACAGAACATAGCATCATTAGACCCGCAAGCCACGCTAAAGCATCACTCACTCAACCATTCCTATCTTCTTCAACAGAAAATGTTTGA

Protein sequence

>Msa0050790

MADLGSASSKRMWCSIPEKFQLHVAMLALQFGYAGFHVVSRAALNMGVSKLVFPVYRNIIALLLLLPFAYFLEKKDRPPINLNFLCQFFFLALIGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAVILRIEQVRLNRKDGIAKVAGTIFCVIGASVITLYQGPTIYSPSPSSHLNSGITEVTTTTPMIDFGTMSLGDAKGKNWTLGCLYLIGHCLSWSAWLVFQAPVLKKYPARLSVTSYTCFFGLLQFLLIALVFERNAQAWIFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIMASIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEEKKLFAKEQLAIASTEHSIIRPASHAKASLTQPFLSSSTENV*