AlfalfaGEDB | Msa0428370

M. sativa cultivar zhongmu-4 / Msa0428370

KEGG: K16297
GO: GO:0003674 GO:0003824 GO:0004180 GO:0004185 GO:0005575 GO:0005618 GO:0005623 GO:0005911 GO:0006508 GO:0006807 GO:0008150 GO:0008152 GO:0008233 GO:0008236 GO:0008238 GO:0009056 GO:0009057 GO:0009505 GO:0009506 GO:0009987 GO:0016787 GO:0017171 GO:0019538 GO:0030054 GO:0030163 GO:0030312 GO:0043170 GO:0044237 GO:0044238 GO:0044248 GO:0044257 GO:0044260 GO:0044265 GO:0044267 GO:0044464 GO:0051603 GO:0055044 GO:0070008 GO:0070011 GO:0071704 GO:0071944 GO:0140096 GO:1901564 GO:1901565 GO:1901575
PFAM: PF00450.25

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0428370	XP_013461655.2	92.043	465	10	3	1	439	1	464	0.0	867

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0428370	sp\|Q93Y09\|SCP45_ARATH	74.312	436	86	4	28	439	28	461	0.0	673

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0428370	A0A396J055	92.043	465	10	3	1	439	1	464	0.0	867

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0000050	Msa0428370	0.849511	3.086386e-60	-8.615850e-47
Msa0001940	Msa0428370	0.845019	5.272024e-59	-8.615850e-47
Msa0001960	Msa0428370	0.822088	2.856135e-53	-8.615850e-47
Msa0002580	Msa0428370	0.871074	9.012929e-67	-8.615850e-47
Msa0005890	Msa0428370	0.867575	1.237281e-65	-8.615850e-47
Msa0017670	Msa0428370	0.812889	3.378430e-51	-8.615850e-47
Msa0017930	Msa0428370	0.835782	1.373481e-56	-8.615850e-47
Msa0017950	Msa0428370	0.842364	2.705108e-58	-8.615850e-47
Msa0024000	Msa0428370	0.839557	1.475750e-57	-8.615850e-47
Msa0024550	Msa0428370	0.815360	9.621741e-52	-8.615850e-47
Msa0025160	Msa0428370	0.805950	1.042029e-49	-8.615850e-47
Msa0027820	Msa0428370	0.847632	1.022514e-59	-8.615850e-47
Msa0028420	Msa0428370	0.824026	1.008723e-53	-8.615850e-47
Msa0030370	Msa0428370	0.819560	1.089049e-52	-8.615850e-47
Msa0032920	Msa0428370	-0.834009	3.838919e-56	-8.615850e-47
Msa0032960	Msa0428370	-0.829587	4.735113e-55	-8.615850e-47
Msa0034210	Msa0428370	0.821334	4.267999e-53	-8.615850e-47
Msa0034810	Msa0428370	0.826816	2.203671e-54	-8.615850e-47
Msa0035060	Msa0428370	0.809610	1.737626e-50	-8.615850e-47
Msa0036870	Msa0428370	0.820886	5.411511e-53	-8.615850e-47
Msa0042640	Msa0428370	0.816416	5.593250e-52	-8.615850e-47
Msa0043470	Msa0428370	0.830265	3.237481e-55	-8.615850e-47
Msa0043620	Msa0428370	0.810784	9.702519e-51	-8.615850e-47
Msa0048510	Msa0428370	0.818325	2.078786e-52	-8.615850e-47
Msa0049790	Msa0428370	0.810991	8.751108e-51	-8.615850e-47
Msa0050660	Msa0428370	0.814503	1.490592e-51	-8.615850e-47
Msa0050700	Msa0428370	0.815973	7.026055e-52	-8.615850e-47
Msa0050790	Msa0428370	0.833402	5.444106e-56	-8.615850e-47
Msa0052480	Msa0428370	0.807294	5.422374e-50	-8.615850e-47
Msa0054690	Msa0428370	0.838438	2.876358e-57	-8.615850e-47
Msa0061340	Msa0428370	0.806863	6.689895e-50	-8.615850e-47
Msa0077340	Msa0428370	0.849464	3.180178e-60	-8.615850e-47
Msa0077560	Msa0428370	0.829431	5.167976e-55	-8.615850e-47
Msa0081390	Msa0428370	0.805143	1.539279e-49	-8.615850e-47
Msa0081450	Msa0428370	0.802151	6.426556e-49	-8.615850e-47
Msa0081520	Msa0428370	0.854691	1.040047e-61	-8.615850e-47
Msa0081570	Msa0428370	0.818518	1.880193e-52	-8.615850e-47
Msa0090400	Msa0428370	0.814924	1.202467e-51	-8.615850e-47
Msa0092790	Msa0428370	0.824988	5.989670e-54	-8.615850e-47
Msa0093850	Msa0428370	0.832295	1.025745e-55	-8.615850e-47
Msa0094780	Msa0428370	0.851974	6.255482e-61	-8.615850e-47
Msa0097770	Msa0428370	0.813875	2.051382e-51	-8.615850e-47
Msa0098040	Msa0428370	0.838603	2.607280e-57	-8.615850e-47
Msa0108410	Msa0428370	0.817362	3.430570e-52	-8.615850e-47
Msa0117480	Msa0428370	0.810452	1.144390e-50	-8.615850e-47
Msa0120400	Msa0428370	0.820732	5.872046e-53	-8.615850e-47
Msa0123340	Msa0428370	0.826943	2.055653e-54	-8.615850e-47
Msa0124060	Msa0428370	0.812353	4.425103e-51	-8.615850e-47
Msa0124280	Msa0428370	0.817866	2.639855e-52	-8.615850e-47
Msa0125360	Msa0428370	0.831422	1.684895e-55	-8.615850e-47
Msa0128310	Msa0428370	0.836883	7.207213e-57	-8.615850e-47
Msa0131900	Msa0428370	0.820935	5.273760e-53	-8.615850e-47
Msa0133280	Msa0428370	0.823942	1.055236e-53	-8.615850e-47
Msa0136650	Msa0428370	0.861025	1.370539e-63	-8.615850e-47
Msa0137880	Msa0428370	0.804705	1.900003e-49	-8.615850e-47
Msa0138360	Msa0428370	0.804026	2.632144e-49	-8.615850e-47
Msa0140280	Msa0428370	0.816308	5.913176e-52	-8.615850e-47
Msa0144360	Msa0428370	0.811677	6.211886e-51	-8.615850e-47
Msa0146040	Msa0428370	0.807004	6.247865e-50	-8.615850e-47
Msa0152400	Msa0428370	0.813115	3.013438e-51	-8.615850e-47
Msa0158860	Msa0428370	0.806573	7.703557e-50	-8.615850e-47
Msa0164330	Msa0428370	0.806808	6.870931e-50	-8.615850e-47
Msa0168500	Msa0428370	0.823485	1.350155e-53	-8.615850e-47
Msa0173540	Msa0428370	0.806018	1.008458e-49	-8.615850e-47
Msa0173690	Msa0428370	0.830110	3.531113e-55	-8.615850e-47
Msa0173730	Msa0428370	0.813303	2.740454e-51	-8.615850e-47
Msa0173750	Msa0428370	0.804637	1.963185e-49	-8.615850e-47
Msa0173810	Msa0428370	0.802260	6.102969e-49	-8.615850e-47
Msa0173890	Msa0428370	0.834925	2.260740e-56	-8.615850e-47
Msa0174440	Msa0428370	0.815746	7.894818e-52	-8.615850e-47
Msa0174450	Msa0428370	0.889617	2.063668e-73	-8.615850e-47
Msa0175730	Msa0428370	0.802067	6.690072e-49	-8.615850e-47
Msa0175930	Msa0428370	0.822000	2.992702e-53	-8.615850e-47
Msa0182190	Msa0428370	0.826497	2.627056e-54	-8.615850e-47
Msa0182240	Msa0428370	0.810992	8.749242e-51	-8.615850e-47
Msa0186010	Msa0428370	0.821787	3.352567e-53	-8.615850e-47
Msa0189900	Msa0428370	0.802296	6.002056e-49	-8.615850e-47
Msa0190570	Msa0428370	0.831542	1.573332e-55	-8.615850e-47
Msa0200050	Msa0428370	0.803506	3.375283e-49	-8.615850e-47
Msa0205110	Msa0428370	0.806239	9.060359e-50	-8.615850e-47
Msa0211150	Msa0428370	0.801104	1.053915e-48	-8.615850e-47
Msa0213030	Msa0428370	0.816296	5.950889e-52	-8.615850e-47
Msa0221000	Msa0428370	0.878800	2.094684e-69	-8.615850e-47
Msa0222560	Msa0428370	0.827515	1.499315e-54	-8.615850e-47
Msa0225100	Msa0428370	0.874005	9.469302e-68	-8.615850e-47
Msa0225460	Msa0428370	0.824346	8.483356e-54	-8.615850e-47
Msa0225480	Msa0428370	0.806777	6.974844e-50	-8.615850e-47
Msa0225680	Msa0428370	0.829581	4.751852e-55	-8.615850e-47
Msa0225860	Msa0428370	0.891471	3.853564e-74	-8.615850e-47
Msa0230750	Msa0428370	0.803909	2.783550e-49	-8.615850e-47
Msa0233730	Msa0428370	0.803208	3.890608e-49	-8.615850e-47
Msa0237210	Msa0428370	0.804060	2.589596e-49	-8.615850e-47
Msa0367870	Msa0428370	0.814093	1.836039e-51	-8.615850e-47
Msa0369790	Msa0428370	0.856499	3.087273e-62	-8.615850e-47
Msa0371030	Msa0428370	0.822473	2.324955e-53	-8.615850e-47
Msa0371170	Msa0428370	0.805763	1.140961e-49	-8.615850e-47
Msa0371270	Msa0428370	0.842024	3.329057e-58	-8.615850e-47
Msa0375640	Msa0428370	0.803476	3.424060e-49	-8.615850e-47
Msa0378720	Msa0428370	0.927648	8.765880e-92	-8.615850e-47
Msa0380620	Msa0428370	0.858342	8.801944e-63	-8.615850e-47
Msa0380670	Msa0428370	0.816727	4.763232e-52	-8.615850e-47
Msa0390970	Msa0428370	0.829726	4.381237e-55	-8.615850e-47
Msa0392380	Msa0428370	0.803083	4.128856e-49	-8.615850e-47
Msa0392510	Msa0428370	0.814138	1.794960e-51	-8.615850e-47
Msa0403640	Msa0428370	0.819270	1.268594e-52	-8.615850e-47
Msa0405130	Msa0428370	0.803479	3.418107e-49	-8.615850e-47
Msa0417880	Msa0428370	0.803920	2.768982e-49	-8.615850e-47
Msa0419540	Msa0428370	0.834647	2.656526e-56	-8.615850e-47
Msa0424160	Msa0428370	0.815805	7.660366e-52	-8.615850e-47
Msa0425170	Msa0428370	0.802214	6.239320e-49	-8.615850e-47
Msa0426530	Msa0428370	0.800501	1.398945e-48	-8.615850e-47
Msa0427100	Msa0428370	0.812929	3.310596e-51	-8.615850e-47
Msa0427120	Msa0428370	0.812900	3.359964e-51	-8.615850e-47
Msa0428370	Msa0428920	0.817966	2.507251e-52	-8.615850e-47
Msa0428370	Msa0430260	0.878047	3.851855e-69	-8.615850e-47
Msa0428370	Msa0430300	0.840961	6.342781e-58	-8.615850e-47
Msa0428370	Msa0436910	0.865343	6.326017e-65	-8.615850e-47
Msa0428370	Msa0450720	0.802433	5.623480e-49	-8.615850e-47
Msa0428370	Msa0464000	0.853401	2.449282e-61	-8.615850e-47
Msa0428370	Msa0465530	0.847788	9.262167e-60	-8.615850e-47
Msa0428370	Msa0467430	0.811087	8.342870e-51	-8.615850e-47
Msa0428370	Msa0467490	0.835554	1.568015e-56	-8.615850e-47
Msa0428370	Msa0472950	0.839225	1.799708e-57	-8.615850e-47
Msa0428370	Msa0474730	0.948071	1.950584e-106	-8.615850e-47
Msa0428370	Msa0476650	0.801873	7.330482e-49	-8.615850e-47
Msa0428370	Msa0479170	0.810951	8.928845e-51	-8.615850e-47
Msa0428370	Msa0479200	0.808340	3.249111e-50	-8.615850e-47
Msa0428370	Msa0481890	0.805530	1.276974e-49	-8.615850e-47
Msa0428370	Msa0483100	0.866615	2.504453e-65	-8.615850e-47
Msa0428370	Msa0484380	0.849170	3.839292e-60	-8.615850e-47
Msa0428370	Msa0498060	0.811534	6.673351e-51	-8.615850e-47
Msa0428370	Msa0500380	0.859952	2.895698e-63	-8.615850e-47
Msa0428370	Msa0509550	0.847390	1.191853e-59	-8.615850e-47
Msa0428370	Msa0513160	0.802063	6.702591e-49	-8.615850e-47
Msa0428370	Msa0515800	0.806984	6.306711e-50	-8.615850e-47
Msa0428370	Msa0517250	0.829046	6.406202e-55	-8.615850e-47
Msa0428370	Msa0519750	0.843945	1.025526e-58	-8.615850e-47
Msa0428370	Msa0519760	0.826490	2.636156e-54	-8.615850e-47
Msa0428370	Msa0519810	0.807173	5.751868e-50	-8.615850e-47
Msa0428370	Msa0519820	0.847690	9.855553e-60	-8.615850e-47
Msa0428370	Msa0519830	0.857425	1.647273e-62	-8.615850e-47
Msa0428370	Msa0519840	0.826833	2.183516e-54	-8.615850e-47
Msa0428370	Msa0527190	0.812476	4.159041e-51	-8.615850e-47
Msa0428370	Msa0527820	0.813358	2.665275e-51	-8.615850e-47
Msa0428370	Msa0527860	0.813814	2.115792e-51	-8.615850e-47
Msa0428370	Msa0528570	0.867561	1.250121e-65	-8.615850e-47
Msa0428370	Msa0529030	0.861670	8.716491e-64	-8.615850e-47
Msa0428370	Msa0530780	0.820394	7.020135e-53	-8.615850e-47
Msa0428370	Msa0534720	0.833602	4.853683e-56	-8.615850e-47
Msa0428370	Msa0546500	0.800104	1.685683e-48	-8.615850e-47
Msa0428370	Msa0548470	0.851440	8.862640e-61	-8.615850e-47
Msa0428370	Msa0549360	0.801225	9.953432e-49	-8.615850e-47
Msa0428370	Msa0555860	-0.804298	2.310198e-49	-8.615850e-47
Msa0428370	Msa0556640	0.811433	7.019621e-51	-8.615850e-47
Msa0428370	Msa0557370	0.817543	3.123515e-52	-8.615850e-47
Msa0428370	Msa0557460	0.859305	4.535893e-63	-8.615850e-47
Msa0428370	Msa0565090	0.810452	1.144531e-50	-8.615850e-47
Msa0428370	Msa0567170	0.831921	1.269267e-55	-8.615850e-47
Msa0428370	Msa0569200	0.802189	6.312350e-49	-8.615850e-47
Msa0428370	Msa0571290	0.843729	1.171465e-58	-8.615850e-47
Msa0428370	Msa0573380	0.809998	1.434098e-50	-8.615850e-47
Msa0428370	Msa0580370	0.885267	9.424191e-72	-8.615850e-47
Msa0428370	Msa0580700	0.801797	7.599087e-49	-8.615850e-47
Msa0428370	Msa0581470	0.846096	2.691087e-59	-8.615850e-47
Msa0428370	Msa0582450	0.816455	5.481448e-52	-8.615850e-47
Msa0428370	Msa0582480	0.841903	3.581802e-58	-8.615850e-47
Msa0428370	Msa0583360	-0.838699	2.461938e-57	-8.615850e-47
Msa0428370	Msa0586190	0.818955	1.496032e-52	-8.615850e-47
Msa0428370	Msa0586220	0.838622	2.577358e-57	-8.615850e-47
Msa0428370	Msa0587620	0.850743	1.394279e-60	-8.615850e-47
Msa0428370	Msa0590830	0.812373	4.380540e-51	-8.615850e-47
Msa0428370	Msa0597270	0.830325	3.130247e-55	-8.615850e-47
Msa0428370	Msa0597790	0.854774	9.836607e-62	-8.615850e-47
Msa0428370	Msa0600930	0.841578	4.365185e-58	-8.615850e-47
Msa0428370	Msa0601950	0.815203	1.042418e-51	-8.615850e-47
Msa0428370	Msa0611210	0.864705	1.003028e-64	-8.615850e-47
Msa0428370	Msa0614000	0.815613	8.450540e-52	-8.615850e-47
Msa0428370	Msa0623330	0.818458	1.939923e-52	-8.615850e-47
Msa0428370	Msa0624420	0.810514	1.109697e-50	-8.615850e-47
Msa0428370	Msa0624900	0.835471	1.646534e-56	-8.615850e-47
Msa0428370	Msa0625630	0.809522	1.815386e-50	-8.615850e-47
Msa0428370	Msa0626450	0.894502	2.320992e-75	-8.615850e-47
Msa0428370	Msa0626490	0.892924	1.012791e-74	-8.615850e-47
Msa0428370	Msa0626510	0.833269	5.875489e-56	-8.615850e-47
Msa0428370	Msa0637560	0.817315	3.515150e-52	-8.615850e-47
Msa0428370	Msa0637580	0.816051	6.747616e-52	-8.615850e-47
Msa0428370	Msa0638480	0.837915	3.920310e-57	-8.615850e-47
Msa0428370	Msa0644410	0.842187	3.014475e-58	-8.615850e-47
Msa0428370	Msa0651550	0.862323	5.495729e-64	-8.615850e-47
Msa0428370	Msa0652000	0.811082	8.364636e-51	-8.615850e-47
Msa0428370	Msa0652170	0.831519	1.593993e-55	-8.615850e-47
Msa0428370	Msa0652770	0.850278	1.882780e-60	-8.615850e-47
Msa0428370	Msa0658590	0.814590	1.426151e-51	-8.615850e-47
Msa0428370	Msa0658640	0.841265	5.276453e-58	-8.615850e-47
Msa0428370	Msa0660370	0.824767	6.752189e-54	-8.615850e-47
Msa0428370	Msa0661150	0.824410	8.195094e-54	-8.615850e-47
Msa0428370	Msa0662240	0.816916	4.319860e-52	-8.615850e-47
Msa0428370	Msa0663300	0.803526	3.342799e-49	-8.615850e-47
Msa0428370	Msa0664060	0.806568	7.722468e-50	-8.615850e-47
Msa0428370	Msa0664090	0.840526	8.245734e-58	-8.615850e-47
Msa0428370	Msa0664150	0.809000	2.348720e-50	-8.615850e-47
Msa0428370	Msa0664600	0.892769	1.169067e-74	-8.615850e-47
Msa0428370	Msa0664910	0.805564	1.255966e-49	-8.615850e-47
Msa0428370	Msa0666700	0.803111	4.074766e-49	-8.615850e-47
Msa0428370	Msa0674480	0.818802	1.620317e-52	-8.615850e-47
Msa0428370	Msa0675330	0.802131	6.488144e-49	-8.615850e-47
Msa0428370	Msa0683490	0.818969	1.485269e-52	-8.615850e-47
Msa0428370	Msa0683570	0.811378	7.213077e-51	-8.615850e-47
Msa0428370	Msa0693070	0.805056	1.604808e-49	-8.615850e-47
Msa0428370	Msa0693890	0.811832	5.747248e-51	-8.615850e-47
Msa0428370	Msa0695270	0.839229	1.795228e-57	-8.615850e-47
Msa0428370	Msa0697160	0.834291	3.262316e-56	-8.615850e-47
Msa0428370	Msa0698640	0.808130	3.602666e-50	-8.615850e-47
Msa0428370	Msa0698910	0.808068	3.713435e-50	-8.615850e-47
Msa0428370	Msa0700460	0.810920	9.065601e-51	-8.615850e-47
Msa0428370	Msa0701360	0.813601	2.356657e-51	-8.615850e-47
Msa0428370	Msa0701700	0.829133	6.105874e-55	-8.615850e-47
Msa0428370	Msa0702720	0.802468	5.531317e-49	-8.615850e-47
Msa0428370	Msa0703600	0.824151	9.426193e-54	-8.615850e-47
Msa0428370	Msa0706760	0.801575	8.438704e-49	-8.615850e-47
Msa0428370	Msa0709200	0.821910	3.141065e-53	-8.615850e-47
Msa0428370	Msa0709440	0.807731	4.380671e-50	-8.615850e-47
Msa0428370	Msa0711400	0.824183	9.264927e-54	-8.615850e-47
Msa0428370	Msa0711430	0.830582	2.707477e-55	-8.615850e-47
Msa0428370	Msa0715060	0.838598	2.614700e-57	-8.615850e-47
Msa0428370	Msa0716890	0.808603	2.856367e-50	-8.615850e-47
Msa0428370	Msa0721080	0.872298	3.541472e-67	-8.615850e-47
Msa0428370	Msa0725000	0.803407	3.538151e-49	-8.615850e-47
Msa0428370	Msa0725770	0.840911	6.538919e-58	-8.615850e-47
Msa0428370	Msa0727640	0.817940	2.540490e-52	-8.615850e-47
Msa0428370	Msa0733390	0.817062	4.005750e-52	-8.615850e-47
Msa0428370	Msa0735780	0.848331	6.561322e-60	-8.615850e-47
Msa0428370	Msa0736960	0.855104	7.889137e-62	-8.615850e-47
Msa0428370	Msa0738700	0.819868	9.264874e-53	-8.615850e-47
Msa0428370	Msa0741220	0.844481	7.361766e-59	-8.615850e-47
Msa0428370	Msa0756490	0.802087	6.624314e-49	-8.615850e-47
Msa0428370	Msa0761670	0.843199	1.623281e-58	-8.615850e-47
Msa0428370	Msa0762910	0.810688	1.018098e-50	-8.615850e-47
Msa0428370	Msa0768990	0.837237	5.853393e-57	-8.615850e-47
Msa0428370	Msa0769180	0.826563	2.532781e-54	-8.615850e-47
Msa0428370	Msa0770330	0.803378	3.587421e-49	-8.615850e-47
Msa0428370	Msa0778590	0.846187	2.542788e-59	-8.615850e-47
Msa0428370	Msa0780270	0.811943	5.435148e-51	-8.615850e-47
Msa0428370	Msa0783530	0.804389	2.212009e-49	-8.615850e-47
Msa0428370	Msa0792370	0.829477	5.036643e-55	-8.615850e-47
Msa0428370	Msa0795870	0.885682	6.589863e-72	-8.615850e-47
Msa0428370	Msa0805330	0.837776	4.256639e-57	-8.615850e-47
Msa0428370	Msa0807260	0.811590	6.489190e-51	-8.615850e-47
Msa0428370	Msa0807280	0.811536	6.666548e-51	-8.615850e-47
Msa0428370	Msa0807820	0.808064	3.721432e-50	-8.615850e-47
Msa0428370	Msa0815960	0.854444	1.226263e-61	-8.615850e-47
Msa0428370	Msa0819170	0.825617	4.251195e-54	-8.615850e-47
Msa0428370	Msa0820390	0.813172	2.927969e-51	-8.615850e-47
Msa0428370	Msa0821780	0.819167	1.338844e-52	-8.615850e-47
Msa0428370	Msa0822730	0.809572	1.771123e-50	-8.615850e-47
Msa0428370	Msa0823820	0.808909	2.456952e-50	-8.615850e-47
Msa0428370	Msa0824450	0.831090	2.032704e-55	-8.615850e-47
Msa0428370	Msa0828560	0.820155	7.963191e-53	-8.615850e-47
Msa0428370	Msa0829300	0.839526	1.503110e-57	-8.615850e-47
Msa0428370	Msa0829330	0.835258	1.863030e-56	-8.615850e-47
Msa0428370	Msa0830130	0.806884	6.622790e-50	-8.615850e-47
Msa0428370	Msa0830460	0.812274	4.604817e-51	-8.615850e-47
Msa0428370	Msa0832120	0.821842	3.256842e-53	-8.615850e-47
Msa0428370	Msa0833530	0.843596	1.271160e-58	-8.615850e-47
Msa0428370	Msa0833650	0.883161	5.670225e-71	-8.615850e-47
Msa0428370	Msa0835490	0.832811	7.638395e-56	-8.615850e-47
Msa0428370	Msa0842680	0.810801	9.621180e-51	-8.615850e-47
Msa0428370	Msa0859290	0.817170	3.788328e-52	-8.615850e-47
Msa0428370	Msa0861510	0.854458	1.214635e-61	-8.615850e-47
Msa0428370	Msa0861530	0.834974	2.197888e-56	-8.615850e-47
Msa0428370	Msa0861600	0.870015	2.007650e-66	-8.615850e-47
Msa0428370	Msa0863010	0.807536	4.819010e-50	-8.615850e-47
Msa0428370	Msa0866520	0.848717	5.128895e-60	-8.615850e-47
Msa0428370	Msa0868880	0.815029	1.139589e-51	-8.615850e-47
Msa0428370	Msa0871880	0.809235	2.091915e-50	-8.615850e-47
Msa0428370	Msa0875290	0.801873	7.332170e-49	-8.615850e-47
Msa0428370	Msa0876310	0.811147	8.096448e-51	-8.615850e-47
Msa0428370	Msa0878280	0.824201	9.176968e-54	-8.615850e-47
Msa0428370	Msa0880270	0.821153	4.696638e-53	-8.615850e-47
Msa0428370	Msa0894790	0.817810	2.718580e-52	-8.615850e-47
Msa0428370	Msa0902510	0.815477	9.061350e-52	-8.615850e-47
Msa0428370	Msa0926470	0.800931	1.143144e-48	-8.615850e-47
Msa0428370	Msa0945110	0.824051	9.950748e-54	-8.615850e-47
Msa0428370	Msa0945190	0.860926	1.469479e-63	-8.615850e-47
Msa0428370	Msa0967380	0.840946	6.400187e-58	-8.615850e-47
Msa0428370	Msa0967870	0.868908	4.603195e-66	-8.615850e-47
Msa0428370	Msa0974520	0.814769	1.301658e-51	-8.615850e-47
Msa0428370	Msa0979180	0.816332	5.839778e-52	-8.615850e-47
Msa0428370	Msa0981320	0.828081	1.096094e-54	-8.615850e-47
Msa0428370	Msa0982650	0.813871	2.054789e-51	-8.615850e-47
Msa0428370	Msa1000920	0.801671	8.064917e-49	-8.615850e-47
Msa0428370	Msa1011530	0.812806	3.522843e-51	-8.615850e-47
Msa0428370	Msa1019430	0.830873	2.298150e-55	-8.615850e-47
Msa0428370	Msa1019470	0.847020	1.505623e-59	-8.615850e-47
Msa0428370	Msa1020480	0.845765	3.311407e-59	-8.615850e-47
Msa0428370	Msa1020510	0.843998	9.924816e-59	-8.615850e-47
Msa0428370	Msa1020670	0.803885	2.815215e-49	-8.615850e-47
Msa0428370	Msa1027990	0.829144	6.068386e-55	-8.615850e-47
Msa0428370	Msa1028280	0.809679	1.679518e-50	-8.615850e-47
Msa0428370	Msa1028510	0.810331	1.215610e-50	-8.615850e-47
Msa0428370	Msa1031930	0.802183	6.330819e-49	-8.615850e-47
Msa0428370	Msa1034500	0.809214	2.113566e-50	-8.615850e-47
Msa0428370	Msa1042160	0.830644	2.614518e-55	-8.615850e-47
Msa0428370	Msa1042190	0.831164	1.949685e-55	-8.615850e-47
Msa0428370	Msa1043370	0.819217	1.304125e-52	-8.615850e-47
Msa0428370	Msa1044470	0.824091	9.740155e-54	-8.615850e-47
Msa0428370	Msa1044680	0.828761	7.512005e-55	-8.615850e-47
Msa0428370	Msa1045140	0.812673	3.766676e-51	-8.615850e-47
Msa0428370	Msa1048920	0.811844	5.714278e-51	-8.615850e-47
Msa0428370	Msa1050910	0.807525	4.844544e-50	-8.615850e-47
Msa0428370	Msa1051900	0.824546	7.611740e-54	-8.615850e-47
Msa0428370	Msa1066670	0.810306	1.231086e-50	-8.615850e-47
Msa0428370	Msa1072940	0.870601	1.289821e-66	-8.615850e-47
Msa0428370	Msa1078170	0.807410	5.125267e-50	-8.615850e-47
Msa0428370	Msa1084530	0.808202	3.476860e-50	-8.615850e-47
Msa0428370	Msa1084950	0.802146	6.441827e-49	-8.615850e-47
Msa0428370	Msa1085330	0.849266	3.611205e-60	-8.615850e-47
Msa0428370	Msa1087650	0.823107	1.654639e-53	-8.615850e-47
Msa0428370	Msa1089450	0.806572	7.707629e-50	-8.615850e-47
Msa0428370	Msa1094010	0.811181	7.958763e-51	-8.615850e-47
Msa0428370	Msa1096960	0.830381	3.031906e-55	-8.615850e-47
Msa0428370	Msa1099710	0.811643	6.317241e-51	-8.615850e-47
Msa0428370	Msa1101090	0.825420	4.733573e-54	-8.615850e-47
Msa0428370	Msa1105640	0.803406	3.539529e-49	-8.615850e-47
Msa0428370	Msa1111380	0.809519	1.817921e-50	-8.615850e-47
Msa0428370	Msa1112380	0.807163	5.780221e-50	-8.615850e-47
Msa0428370	Msa1113340	0.839554	1.478370e-57	-8.615850e-47
Msa0428370	Msa1123210	0.821269	4.416241e-53	-8.615850e-47
Msa0428370	Msa1123380	0.805546	1.267334e-49	-8.615850e-47
Msa0428370	Msa1124950	0.817860	2.649193e-52	-8.615850e-47
Msa0428370	Msa1125820	0.802042	6.768677e-49	-8.615850e-47
Msa0428370	Msa1125990	0.807691	4.466069e-50	-8.615850e-47
Msa0428370	Msa1132530	0.800935	1.141182e-48	-8.615850e-47
Msa0428370	Msa1132840	0.884549	1.744536e-71	-8.615850e-47
Msa0428370	Msa1140210	0.808192	3.494024e-50	-8.615850e-47
Msa0428370	Msa1140220	0.811441	6.989634e-51	-8.615850e-47
Msa0428370	Msa1145580	0.800007	1.763920e-48	-8.615850e-47
Msa0428370	Msa1145810	0.836285	1.023204e-56	-8.615850e-47
Msa0428370	Msa1155170	-0.843925	1.037885e-58	-8.615850e-47
Msa0428370	Msa1160920	0.873342	1.584159e-67	-8.615850e-47
Msa0428370	Msa1162770	0.840973	6.295749e-58	-8.615850e-47
Msa0428370	Msa1163100	0.854987	8.531433e-62	-8.615850e-47
Msa0428370	Msa1167470	0.818471	1.926729e-52	-8.615850e-47
Msa0428370	Msa1171290	0.807712	4.420300e-50	-8.615850e-47
Msa0428370	Msa1175180	0.820533	6.522733e-53	-8.615850e-47
Msa0428370	Msa1184330	0.807666	4.522634e-50	-8.615850e-47
Msa0428370	Msa1186020	0.861880	7.514769e-64	-8.615850e-47
Msa0428370	Msa1192570	0.834034	3.784798e-56	-8.615850e-47
Msa0428370	Msa1193170	0.814167	1.768805e-51	-8.615850e-47
Msa0428370	Msa1198250	0.807545	4.798118e-50	-8.615850e-47
Msa0428370	Msa1199570	0.809055	2.285819e-50	-8.615850e-47
Msa0428370	Msa1200890	0.837028	6.619048e-57	-8.615850e-47
Msa0428370	Msa1205280	0.831297	1.807991e-55	-8.615850e-47
Msa0428370	Msa1208160	0.814609	1.411841e-51	-8.615850e-47
Msa0428370	Msa1208430	0.817044	4.043975e-52	-8.615850e-47
Msa0428370	Msa1208950	0.861841	7.724962e-64	-8.615850e-47
Msa0428370	Msa1209420	0.818664	1.741508e-52	-8.615850e-47
Msa0428370	Msa1209450	0.809726	1.641316e-50	-8.615850e-47
Msa0428370	Msa1215870	0.827185	1.798505e-54	-8.615850e-47
Msa0428370	Msa1217210	0.817791	2.744792e-52	-8.615850e-47
Msa0428370	Msa1223570	0.818888	1.549448e-52	-8.615850e-47
Msa0428370	Msa1224930	0.807031	6.163349e-50	-8.615850e-47
Msa0428370	Msa1225860	-0.842671	2.242516e-58	-8.615850e-47
Msa0428370	Msa1226520	0.842501	2.487549e-58	-8.615850e-47
Msa0428370	Msa1228200	0.851077	1.122643e-60	-8.615850e-47
Msa0428370	Msa1234710	0.814500	1.492404e-51	-8.615850e-47
Msa0428370	Msa1238820	0.819098	1.388094e-52	-8.615850e-47
Msa0428370	Msa1251930	0.812099	5.026676e-51	-8.615850e-47
Msa0428370	Msa1252780	0.805161	1.525430e-49	-8.615850e-47
Msa0428370	Msa1253550	0.809336	1.990258e-50	-8.615850e-47
Msa0428370	Msa1258340	0.808935	2.425488e-50	-8.615850e-47
Msa0428370	Msa1263490	0.835627	1.503531e-56	-8.615850e-47
Msa0428370	Msa1265650	0.870254	1.676346e-66	-8.615850e-47
Msa0428370	Msa1267770	0.837404	5.304644e-57	-8.615850e-47
Msa0428370	Msa1268240	0.808146	3.574805e-50	-8.615850e-47
Msa0428370	Msa1269480	0.804657	1.944251e-49	-8.615850e-47
Msa0428370	Msa1271270	0.821503	3.900681e-53	-8.615850e-47
Msa0428370	Msa1276660	0.819555	1.092182e-52	-8.615850e-47
Msa0428370	Msa1277150	0.832017	1.201215e-55	-8.615850e-47
Msa0428370	Msa1277220	0.860505	1.970986e-63	-8.615850e-47
Msa0428370	Msa1277640	0.804517	2.080200e-49	-8.615850e-47
Msa0428370	Msa1292590	0.812811	3.512706e-51	-8.615850e-47
Msa0428370	Msa1296410	0.832530	8.970066e-56	-8.615850e-47
Msa0428370	Msa1297230	0.862724	4.137708e-64	-8.615850e-47
Msa0428370	Msa1298370	0.830659	2.593090e-55	-8.615850e-47
Msa0428370	Msa1298810	0.807566	4.747394e-50	-8.615850e-47
Msa0428370	Msa1303560	0.873082	1.937150e-67	-8.615850e-47
Msa0428370	Msa1303650	0.870178	1.774949e-66	-8.615850e-47
Msa0428370	Msa1306640	0.812282	4.585543e-51	-8.615850e-47
Msa0428370	Msa1307630	0.844441	7.543754e-59	-8.615850e-47
Msa0428370	Msa1314650	0.827174	1.809932e-54	-8.615850e-47
Msa0428370	Msa1315590	0.822942	1.808186e-53	-8.615850e-47
Msa0428370	Msa1316330	0.820980	5.149022e-53	-8.615850e-47
Msa0428370	Msa1320670	0.863877	1.818518e-64	-8.615850e-47
Msa0428370	Msa1328710	0.801703	7.946288e-49	-8.615850e-47
Msa0428370	Msa1330420	0.835301	1.816752e-56	-8.615850e-47
Msa0428370	Msa1330450	0.803591	3.240945e-49	-8.615850e-47
Msa0428370	Msa1332760	0.806752	7.060313e-50	-8.615850e-47
Msa0428370	Msa1341840	0.813897	2.028668e-51	-8.615850e-47
Msa0428370	Msa1343170	0.819872	9.245815e-53	-8.615850e-47
Msa0428370	Msa1343180	0.831126	1.992241e-55	-8.615850e-47
Msa0428370	Msa1343430	0.865760	4.675143e-65	-8.615850e-47
Msa0428370	Msa1346560	0.833566	4.953676e-56	-8.615850e-47
Msa0428370	Msa1348090	0.873532	1.367409e-67	-8.615850e-47
Msa0428370	Msa1355450	0.816524	5.290741e-52	-8.615850e-47
Msa0428370	Msa1356830	0.853146	2.898022e-61	-8.615850e-47
Msa0428370	Msa1357790	0.814506	1.488199e-51	-8.615850e-47
Msa0428370	Msa1359690	0.834391	3.079556e-56	-8.615850e-47
Msa0428370	Msa1366340	0.802427	5.638853e-49	-8.615850e-47
Msa0428370	Msa1369150	0.813050	3.114862e-51	-8.615850e-47
Msa0428370	Msa1371520	0.812310	4.522067e-51	-8.615850e-47
Msa0428370	Msa1371910	0.830633	2.631893e-55	-8.615850e-47
Msa0428370	Msa1372040	0.838055	3.610181e-57	-8.615850e-47
Msa0428370	Msa1373100	0.809810	1.574025e-50	-8.615850e-47
Msa0428370	Msa1375280	0.822425	2.385166e-53	-8.615850e-47
Msa0428370	Msa1382300	0.832026	1.195066e-55	-8.615850e-47
Msa0428370	Msa1387620	0.825835	3.773211e-54	-8.615850e-47
Msa0428370	Msa1392580	0.870218	1.722580e-66	-8.615850e-47
Msa0428370	Msa1393780	0.825736	3.983020e-54	-8.615850e-47
Msa0428370	Msa1395190	0.825728	4.000511e-54	-8.615850e-47
Msa0428370	Msa1397400	0.866736	2.292482e-65	-8.615850e-47
Msa0428370	Msa1403710	0.800068	1.714174e-48	-8.615850e-47
Msa0428370	Msa1405460	0.861191	1.220459e-63	-8.615850e-47
Msa0428370	Msa1412000	0.849087	4.049414e-60	-8.615850e-47
Msa0428370	Msa1415540	0.858290	9.119466e-63	-8.615850e-47
Msa0428370	Msa1418240	0.804737	1.871437e-49	-8.615850e-47
Msa0428370	Msa1420950	0.861469	1.003525e-63	-8.615850e-47
Msa0428370	Msa1422420	0.806727	7.148028e-50	-8.615850e-47
Msa0428370	Msa1422950	0.809806	1.577008e-50	-8.615850e-47
Msa0428370	Msa1425880	0.837024	6.633088e-57	-8.615850e-47
Msa0428370	Msa1427100	0.832296	1.024792e-55	-8.615850e-47
Msa0428370	Msa1427110	0.821656	3.595020e-53	-8.615850e-47
Msa0428370	Msa1427200	0.803299	3.724373e-49	-8.615850e-47
Msa0428370	Msa1432500	0.849129	3.942996e-60	-8.615850e-47
Msa0428370	Msa1433810	0.832746	7.928322e-56	-8.615850e-47
Msa0428370	Msa1437940	0.832329	1.005718e-55	-8.615850e-47
Msa0428370	Msa1439610	0.807310	5.381618e-50	-8.615850e-47
Msa0428370	Msa1440310	0.830875	2.294756e-55	-8.615850e-47
Msa0428370	Msa1440630	0.831601	1.521535e-55	-8.615850e-47
Msa0428370	Msa1440880	0.814063	1.864162e-51	-8.615850e-47
Msa0428370	Msa1440960	0.890959	6.143324e-74	-8.615850e-47
Msa0428370	Msa1444510	0.802056	6.724030e-49	-8.615850e-47
Msa0428370	Msa1445190	0.804326	2.279498e-49	-8.615850e-47
Msa0428370	Msa1446810	0.817650	2.953370e-52	-8.615850e-47
Msa0428370	Msa1449480	0.835847	1.322115e-56	-8.615850e-47
Msa0428370	Msa1450100	0.811289	7.542691e-51	-8.615850e-47
Msa0428370	Msa1451160	0.807533	4.825007e-50	-8.615850e-47
Msa0428370	Msa1452140	0.810999	8.718081e-51	-8.615850e-47
Msa0428370	Msa1454140	0.816453	5.487593e-52	-8.615850e-47
Msa0428370	Msa1459460	0.824047	9.971103e-54	-8.615850e-47
Msa0428370	Msa1461370	0.800905	1.157465e-48	-8.615850e-47
Msa0240900	Msa0428370	0.823166	1.603045e-53	-8.615850e-47
Msa0242590	Msa0428370	0.842456	2.557731e-58	-8.615850e-47
Msa0244640	Msa0428370	0.853217	2.765356e-61	-8.615850e-47
Msa0247890	Msa0428370	0.814838	1.256269e-51	-8.615850e-47
Msa0247940	Msa0428370	0.822881	1.868494e-53	-8.615850e-47
Msa0251710	Msa0428370	0.801611	8.299266e-49	-8.615850e-47
Msa0258310	Msa0428370	0.804460	2.137501e-49	-8.615850e-47
Msa0260510	Msa0428370	0.861262	1.160502e-63	-8.615850e-47
Msa0261340	Msa0428370	0.818138	2.292205e-52	-8.615850e-47
Msa0263290	Msa0428370	0.801605	8.323130e-49	-8.615850e-47
Msa0264400	Msa0428370	0.801643	8.172052e-49	-8.615850e-47
Msa0265850	Msa0428370	0.837449	5.164533e-57	-8.615850e-47
Msa0266180	Msa0428370	0.871726	5.484335e-67	-8.615850e-47
Msa0266350	Msa0428370	0.800404	1.464111e-48	-8.615850e-47
Msa0267110	Msa0428370	0.827165	1.819188e-54	-8.615850e-47
Msa0269210	Msa0428370	0.809680	1.678604e-50	-8.615850e-47
Msa0275770	Msa0428370	0.801480	8.828634e-49	-8.615850e-47
Msa0279690	Msa0428370	0.802683	4.994124e-49	-8.615850e-47
Msa0280790	Msa0428370	0.810423	1.161388e-50	-8.615850e-47
Msa0283330	Msa0428370	0.834421	3.026570e-56	-8.615850e-47
Msa0287740	Msa0428370	0.876326	1.525830e-68	-8.615850e-47
Msa0290720	Msa0428370	0.823930	1.062293e-53	-8.615850e-47
Msa0292160	Msa0428370	0.812399	4.322772e-51	-8.615850e-47
Msa0292400	Msa0428370	0.823048	1.708464e-53	-8.615850e-47
Msa0298470	Msa0428370	0.853214	2.770843e-61	-8.615850e-47
Msa0298500	Msa0428370	0.815635	8.357691e-52	-8.615850e-47
Msa0300270	Msa0428370	0.879762	9.560382e-70	-8.615850e-47
Msa0300320	Msa0428370	0.882661	8.639440e-71	-8.615850e-47
Msa0301820	Msa0428370	0.805913	1.061156e-49	-8.615850e-47
Msa0302290	Msa0428370	0.801611	8.297972e-49	-8.615850e-47
Msa0307270	Msa0428370	0.878304	3.129321e-69	-8.615850e-47
Msa0307670	Msa0428370	0.827122	1.862573e-54	-8.615850e-47
Msa0315690	Msa0428370	0.805411	1.352362e-49	-8.615850e-47
Msa0317970	Msa0428370	0.805274	1.445045e-49	-8.615850e-47
Msa0320660	Msa0428370	0.836944	6.953107e-57	-8.615850e-47
Msa0321620	Msa0428370	0.870546	1.344482e-66	-8.615850e-47
Msa0330380	Msa0428370	0.831479	1.631149e-55	-8.615850e-47
Msa0337700	Msa0428370	0.872783	2.438832e-67	-8.615850e-47
Msa0339500	Msa0428370	0.820269	7.500975e-53	-8.615850e-47
Msa0339650	Msa0428370	0.810806	9.598275e-51	-8.615850e-47
Msa0340500	Msa0428370	0.870347	1.563066e-66	-8.615850e-47
Msa0341690	Msa0428370	0.838409	2.924972e-57	-8.615850e-47
Msa0344930	Msa0428370	0.809180	2.149363e-50	-8.615850e-47
Msa0358890	Msa0428370	0.804283	2.326514e-49	-8.615850e-47
Msa0361910	Msa0428370	0.828532	8.530377e-55	-8.615850e-47
Msa0363070	Msa0428370	0.802865	4.580260e-49	-8.615850e-47
Msa0363200	Msa0428370	0.813178	2.919447e-51	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0428370	MtrunA17_Chr3g0131731	92.043	465	10	3	1	439	1	464	0.0	867
Msa0428370	MtrunA17_Chr8g0385871	75.271	461	83	6	5	439	10	465	0.0	698
Msa0428370	MtrunA17_Chr7g0221551	68.035	463	113	5	1	439	9	460	0.0	645
Msa0428370	MtrunA17_Chr3g0094811	58.636	440	153	5	24	439	23	457	0.0	551
Msa0428370	MtrunA17_Chr2g0304931	57.407	432	155	6	29	436	36	462	2.22e-177	504
Msa0428370	MtrunA17_Chr3g0126051	44.091	440	207	7	30	437	32	464	2.45e-132	389
Msa0428370	MtrunA17_Chr1g0204191	47.018	436	173	10	27	436	87	490	1.03e-131	389
Msa0428370	MtrunA17_Chr3g0126031	44.064	438	206	8	30	436	27	456	8.37e-129	380
Msa0428370	MtrunA17_Chr5g0431301	44.545	440	205	9	30	436	28	461	2.32e-128	379
Msa0428370	MtrunA17_Chr3g0118851	45.070	426	198	10	29	432	75	486	7.91e-115	345
Msa0428370	MtrunA17_Chr3g0118841	44.706	425	200	11	29	432	76	486	1.13e-111	337
Msa0428370	MtrunA17_Chr7g0219051	40.333	481	229	10	3	439	1	467	3.24e-111	335
Msa0428370	MtrunA17_Chr3g0118881	42.694	438	207	12	29	436	75	498	5.04e-108	328
Msa0428370	MtrunA17_Chr1g0199991	38.095	462	239	12	9	436	8	456	2.77e-107	325
Msa0428370	MtrunA17_Chr4g0020241	41.860	430	213	10	30	436	72	487	8.04e-107	325
Msa0428370	MtrunA17_Chr3g0090331	42.494	433	208	13	30	436	73	490	8.48e-107	325
Msa0428370	MtrunA17_Chr3g0118831	41.387	447	201	10	9	436	55	459	3.79e-102	312
Msa0428370	MtrunA17_Chr2g0309521	37.204	465	248	10	5	438	13	464	8.04e-102	311
Msa0428370	MtrunA17_Chr4g0068841	39.693	456	213	11	29	436	36	477	1.03e-101	311
Msa0428370	MtrunA17_Chr1g0199971	38.412	466	240	13	5	436	4	456	1.23e-101	310
Msa0428370	MtrunA17_Chr3g0118891	41.608	423	184	11	29	432	75	453	1.36e-101	310
Msa0428370	MtrunA17_Chr1g0153881	40.141	426	224	9	30	438	88	499	2.09e-101	311
Msa0428370	MtrunA17_Chr2g0309511	37.849	465	245	11	5	438	13	464	4.87e-101	309
Msa0428370	MtrunA17_Chr4g0038311	38.739	444	224	13	30	437	33	464	9.24e-99	303
Msa0428370	MtrunA17_Chr1g0153941	38.106	454	223	10	29	438	75	514	6.19e-98	303
Msa0428370	MtrunA17_Chr2g0309541	38.303	436	225	10	35	438	42	465	7.60e-98	301
Msa0428370	MtrunA17_Chr1g0165811	52.768	271	122	4	4	274	3	267	2.60e-97	293
Msa0428370	MtrunA17_Chr4g0047861	38.496	452	221	12	29	438	51	487	3.89e-95	295
Msa0428370	MtrunA17_Chr3g0118861	40.509	432	191	13	28	432	72	464	4.23e-95	294
Msa0428370	MtrunA17_Chr2g0281621	37.580	471	240	12	6	436	9	465	1.81e-94	292
Msa0428370	MtrunA17_Chr2g0318911	36.774	465	240	14	3	432	14	459	7.45e-92	286
Msa0428370	MtrunA17_Chr4g0068861	35.854	410	203	10	28	391	81	476	2.76e-81	258
Msa0428370	MtrunA17_Chr2g0281641	36.709	395	198	11	84	438	7	389	1.19e-77	246
Msa0428370	MtrunA17_Chr1g0153931	55.914	186	76	3	29	209	73	257	5.60e-67	215
Msa0428370	MtrunA17_Chr8g0338461	31.384	513	256	16	1	435	1	495	7.92e-64	213
Msa0428370	MtrunA17_Chr1g0165821	61.146	157	52	2	285	437	28	179	5.14e-60	193
Msa0428370	MtrunA17_Chr7g0234051	30.178	507	265	16	3	435	4	495	1.30e-57	197
Msa0428370	MtrunA17_Chr4g0009701	29.333	450	263	14	27	435	35	470	1.49e-55	191
Msa0428370	MtrunA17_Chr4g0009661	28.634	454	261	15	27	435	35	470	3.11e-53	184
Msa0428370	MtrunA17_Chr4g0009651	27.753	454	265	14	27	435	35	470	3.27e-53	184
Msa0428370	MtrunA17_Chr7g0249431	31.458	480	244	18	32	435	28	498	9.98e-53	184
Msa0428370	MtrunA17_Chr2g0285371	27.887	459	275	13	21	435	23	469	4.41e-52	181
Msa0428370	MtrunA17_Chr4g0009681	28.664	464	277	14	13	435	17	467	8.57e-52	181
Msa0428370	MtrunA17_Chr4g0009671	29.263	434	254	13	42	435	15	435	7.33e-51	177
Msa0428370	MtrunA17_Chr4g0009711	27.660	470	284	16	7	435	16	470	1.63e-50	177
Msa0428370	MtrunA17_Chr2g0285351	28.662	471	276	16	9	435	15	469	3.86e-49	174
Msa0428370	MtrunA17_Chr4g0028271	31.204	407	246	15	48	432	99	493	3.09e-48	172
Msa0428370	MtrunA17_Chr2g0285381	27.468	466	261	14	21	435	26	465	1.32e-47	169
Msa0428370	MtrunA17_Chr4g0028241	30.456	417	240	15	49	433	92	490	1.88e-47	169
Msa0428370	MtrunA17_Chr7g0229651	42.574	202	90	3	209	384	1	202	1.89e-47	162
Msa0428370	MtrunA17_Chr3g0133011	27.926	487	279	13	9	435	22	496	2.05e-47	169
Msa0428370	MtrunA17_Chr2g0327401	28.501	407	260	14	48	433	102	498	3.37e-47	169
Msa0428370	MtrunA17_Chr1g0171411	28.404	426	242	14	44	432	81	480	6.21e-47	168
Msa0428370	MtrunA17_Chr1g0199171	29.340	409	251	15	48	432	92	486	2.17e-46	167
Msa0428370	MtrunA17_Chr4g0009641	27.056	462	273	13	7	435	16	446	9.98e-46	164
Msa0428370	MtrunA17_Chr4g0028261	29.762	420	260	15	37	433	109	516	1.04e-45	166
Msa0428370	MtrunA17_Chr7g0234041	30.213	470	224	18	3	394	1	444	1.70e-45	164
Msa0428370	MtrunA17_Chr4g0028281	29.224	438	265	16	19	433	77	492	6.55e-45	163
Msa0428370	MtrunA17_Chr2g0327371	25.280	447	253	15	49	433	86	513	5.88e-36	139
Msa0428370	MtrunA17_Chr3g0093971	24.943	437	276	13	32	430	27	449	9.51e-36	137
Msa0428370	MtrunA17_Chr4g0009721	26.517	445	231	16	29	435	33	419	1.17e-34	133
Msa0428370	MtrunA17_Chr5g0447441	27.416	445	279	16	9	430	9	432	1.41e-34	134
Msa0428370	MtrunA17_Chr7g0229631	65.909	88	28	2	30	117	32	117	1.84e-33	123
Msa0428370	MtrunA17_Chr2g0327381	25.000	452	263	16	48	433	96	537	2.50e-33	131
Msa0428370	MtrunA17_Chr4g0044051	26.941	438	281	16	17	430	14	436	3.81e-31	124
Msa0428370	MtrunA17_Chr7g0229611	64.865	74	24	2	31	104	25	96	2.62e-26	102
Msa0428370	MtrunA17_Chr7g0229621	64.000	75	25	2	30	104	24	96	5.86e-26	101
Msa0428370	MtrunA17_Chr4g0027731	26.464	427	262	13	49	431	36	454	1.02e-25	108
Msa0428370	MtrunA17_Chr2g0279371	32.787	183	98	5	29	204	25	189	1.37e-24	100
Msa0428370	MtrunA17_Chr1g0153921	28.879	232	131	7	225	438	3	218	2.33e-24	100
Msa0428370	MtrunA17_Chr7g0264221	48.889	90	44	2	351	439	13	101	2.21e-20	86.3
Msa0428370	MtrunA17_Chr2g0320571	36.129	155	92	3	49	201	36	185	1.32e-14	75.5
Msa0428370	MtrunA17_Chr4g0006541	39.506	81	46	1	186	266	7	84	3.07e-14	68.6
Msa0428370	MtrunA17_Chr2g0281631	51.786	56	26	1	29	84	43	97	6.66e-13	65.5
Msa0428370	MtrunA17_Chr7g0229641	61.765	34	13	0	161	194	45	78	8.48e-11	58.5

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0428370	AT1G28110.1	74.312	436	86	4	28	439	28	461	0.0	673
Msa0428370	AT1G28110.2	74.312	436	86	4	28	439	28	461	0.0	673
Msa0428370	AT2G33530.1	71.071	439	99	4	27	439	29	465	0.0	653
Msa0428370	AT1G43780.1	47.727	440	194	8	30	437	36	471	4.01e-137	402
Msa0428370	AT2G12480.4	45.067	446	219	9	3	436	2	433	1.91e-131	386
Msa0428370	AT5G42240.1	46.591	440	196	9	30	436	31	464	1.43e-130	385
Msa0428370	AT2G12480.1	44.843	446	218	9	3	436	2	431	4.05e-130	383
Msa0428370	AT2G12480.3	43.777	466	220	10	3	436	2	457	8.07e-130	383
Msa0428370	AT5G42230.1	43.656	465	226	9	3	436	1	460	2.72e-129	382
Msa0428370	AT5G42230.2	43.656	465	226	9	3	436	1	460	2.72e-129	382
Msa0428370	AT2G12480.2	44.743	447	218	10	3	436	2	432	2.00e-128	379
Msa0428370	AT2G24010.1	41.723	441	211	10	30	439	29	454	4.89e-110	332
Msa0428370	AT4G30610.1	38.854	471	235	10	8	439	9	465	1.91e-109	331
Msa0428370	AT3G02110.1	41.319	455	210	11	27	438	33	473	1.02e-108	329
Msa0428370	AT2G35780.1	39.374	447	224	11	22	436	20	451	3.84e-108	327
Msa0428370	AT3G07990.1	40.455	440	215	10	30	436	32	457	1.29e-107	326
Msa0428370	AT2G24000.1	40.355	451	213	13	30	439	29	464	7.30e-105	319
Msa0428370	AT2G24010.2	40.132	456	212	11	30	439	29	469	1.59e-104	318
Msa0428370	AT2G05850.1	38.549	441	223	10	30	438	62	486	2.16e-104	318
Msa0428370	AT2G35770.1	39.220	436	223	11	30	436	36	458	1.49e-102	313
Msa0428370	AT3G17180.1	40.044	457	210	10	28	436	35	475	4.47e-102	312
Msa0428370	AT1G61130.1	39.286	476	232	16	1	436	2	460	1.00e-101	311
Msa0428370	AT5G08260.1	38.689	473	213	13	19	436	26	476	1.95e-101	311
Msa0428370	AT2G24010.3	37.996	479	211	12	32	439	2	465	1.16e-98	303
Msa0428370	AT3G63470.1	39.588	437	219	11	30	438	80	499	1.06e-97	302
Msa0428370	AT3G52000.1	38.813	438	221	12	30	438	62	481	6.46e-97	299
Msa0428370	AT4G15100.1	37.267	483	235	15	6	435	13	480	1.29e-96	299
Msa0428370	AT4G30810.1	35.699	465	243	13	10	435	14	461	9.32e-96	296
Msa0428370	AT5G23210.1	36.575	473	227	14	22	436	38	495	9.90e-95	294
Msa0428370	AT1G11080.1	38.816	456	215	14	30	436	49	489	1.22e-94	294
Msa0428370	AT1G11080.2	38.816	456	215	14	30	436	49	489	1.44e-94	294
Msa0428370	AT3G52010.1	37.923	443	232	12	25	438	58	486	2.38e-94	293
Msa0428370	AT3G52020.1	36.927	436	231	12	30	436	78	498	6.64e-88	276
Msa0428370	AT3G17180.2	38.278	418	194	10	28	397	35	436	4.19e-85	267
Msa0428370	AT5G23210.3	35.748	428	203	12	22	391	38	451	9.73e-81	257
Msa0428370	AT5G23210.5	34.878	410	199	12	81	436	5	400	2.86e-72	233
Msa0428370	AT2G24010.4	37.808	365	171	9	32	350	2	356	2.82e-71	229
Msa0428370	AT5G23210.2	34.729	406	197	12	85	436	8	399	4.91e-71	230
Msa0428370	AT2G22990.1	31.455	426	249	11	35	435	26	433	4.36e-64	213
Msa0428370	AT3G25420.1	31.762	488	251	14	21	435	16	494	2.70e-62	209
Msa0428370	AT2G22980.1	31.163	430	262	14	24	435	17	430	6.02e-62	207
Msa0428370	AT3G10450.1	31.395	430	254	13	29	435	26	437	1.30e-60	204
Msa0428370	AT4G12910.1	30.724	511	258	15	1	432	1	494	1.86e-60	205
Msa0428370	AT1G73300.1	31.250	432	259	14	26	435	26	441	9.75e-60	201
Msa0428370	AT1G73300.2	31.250	432	259	14	26	435	26	441	9.75e-60	201
Msa0428370	AT1G73290.1	31.481	432	256	16	26	435	25	438	1.16e-58	199
Msa0428370	AT2G23000.1	30.752	439	249	13	29	435	22	437	1.57e-58	198
Msa0428370	AT2G23000.2	30.752	439	249	13	29	435	22	437	1.57e-58	198
Msa0428370	AT3G12203.3	30.806	422	254	12	35	435	12	416	1.86e-58	197
Msa0428370	AT2G22970.1	31.616	427	245	14	35	435	28	433	2.80e-58	197
Msa0428370	AT3G12203.1	30.806	422	254	12	35	435	33	437	4.13e-58	197
Msa0428370	AT2G22990.5	30.516	426	244	12	35	435	26	424	7.43e-58	196
Msa0428370	AT2G22920.2	30.337	445	258	16	21	435	13	435	9.24e-58	196
Msa0428370	AT3G10450.2	31.540	409	239	13	50	435	4	394	1.35e-57	194
Msa0428370	AT5G36180.1	30.986	426	261	13	29	435	30	441	2.31e-57	195
Msa0428370	AT2G23010.1	30.197	457	265	14	11	435	3	437	3.56e-57	194
Msa0428370	AT1G73280.1	29.095	464	277	16	1	435	1	441	5.30e-57	194
Msa0428370	AT5G23210.4	33.518	361	173	11	85	391	8	355	5.43e-57	192
Msa0428370	AT2G22990.4	31.500	400	232	10	35	409	26	408	8.52e-57	193
Msa0428370	AT2G22990.3	31.421	401	233	10	35	410	26	409	1.56e-56	193
Msa0428370	AT2G23010.2	29.978	457	266	14	11	435	3	437	1.70e-56	193
Msa0428370	AT3G12240.1	32.339	436	247	15	28	435	21	436	6.24e-56	191
Msa0428370	AT3G12220.1	32.648	438	243	16	28	435	20	435	9.78e-56	191
Msa0428370	AT3G12230.1	31.494	435	252	13	28	435	20	435	1.29e-55	191
Msa0428370	AT2G22980.2	31.111	405	246	13	24	410	17	406	3.19e-55	189
Msa0428370	AT2G22980.4	30.751	413	253	13	24	418	17	414	6.04e-55	189
Msa0428370	AT3G12203.2	31.061	396	235	12	61	435	1	379	1.13e-54	186
Msa0428370	AT1G73310.1	29.861	432	265	14	26	435	26	441	2.19e-54	187
Msa0428370	AT1G33540.1	29.890	455	255	14	29	435	26	464	4.29e-54	187
Msa0428370	AT1G73270.2	29.099	433	260	13	29	435	30	441	4.18e-53	184
Msa0428370	AT1G73270.1	29.099	433	260	13	29	435	30	441	6.96e-53	184
Msa0428370	AT3G10450.4	30.864	405	240	12	29	410	26	413	1.08e-52	182
Msa0428370	AT3G12220.2	32.446	413	230	15	50	435	15	405	2.21e-52	181
Msa0428370	AT3G45010.1	30.660	424	251	16	37	433	92	499	4.05e-52	183
Msa0428370	AT5G09640.1	28.256	453	262	13	32	435	27	465	6.55e-52	181
Msa0428370	AT1G33540.2	29.724	434	241	14	50	435	4	421	1.29e-51	179
Msa0428370	AT2G22970.4	31.343	402	230	13	35	410	28	409	6.44e-51	177
Msa0428370	AT3G12220.3	31.148	427	212	17	28	435	20	383	7.04e-51	176
Msa0428370	AT2G22970.3	30.806	422	245	14	35	430	28	428	1.74e-50	177
Msa0428370	AT4G12910.2	40.755	265	142	6	1	253	1	262	4.44e-50	176
Msa0428370	AT5G22980.1	29.904	418	256	17	39	433	91	494	7.12e-50	177
Msa0428370	AT3G10450.3	30.990	384	225	12	50	410	4	370	1.02e-49	173
Msa0428370	AT3G56540.1	53.165	158	69	4	30	185	78	232	7.24e-49	167
Msa0428370	AT2G22920.1	29.950	404	232	15	21	394	13	395	5.81e-46	164
Msa0428370	AT1G73290.3	30.691	391	232	15	26	394	25	398	1.70e-45	163
Msa0428370	AT3G10410.1	29.691	421	253	17	37	431	90	493	5.10e-44	161
Msa0428370	AT1G73310.2	28.861	395	244	13	26	398	26	405	1.86e-43	158
Msa0428370	AT2G22980.3	33.443	305	177	11	24	313	17	310	6.02e-42	152
Msa0428370	AT2G24000.2	31.922	307	157	10	172	439	108	401	2.40e-41	151
Msa0428370	AT2G24000.2	55.556	90	36	3	30	116	29	117	1.22e-21	96.7
Msa0428370	AT1G73290.2	33.447	293	171	11	26	304	25	307	3.86e-41	149
Msa0428370	AT2G22990.6	29.254	335	202	9	119	435	2	319	5.37e-41	149
Msa0428370	AT2G22920.4	32.907	313	177	11	21	313	13	312	1.39e-40	147
Msa0428370	AT2G22990.2	28.955	335	203	9	119	435	2	319	2.34e-40	147
Msa0428370	AT2G22970.2	33.007	306	173	10	35	321	28	320	8.19e-40	145
Msa0428370	AT1G73280.2	34.118	255	155	6	1	245	1	252	1.84e-38	143
Msa0428370	AT5G36180.5	28.824	340	217	10	108	435	13	339	3.14e-37	139
Msa0428370	AT5G36180.3	28.824	340	217	10	108	435	13	339	3.14e-37	139
Msa0428370	AT1G73280.4	27.353	340	222	11	108	435	13	339	4.02e-36	136
Msa0428370	AT1G73280.3	27.217	327	213	11	121	435	1	314	9.36e-33	126
Msa0428370	AT1G15000.1	27.764	407	258	16	48	435	37	426	1.84e-31	125
Msa0428370	AT2G22980.5	27.815	302	194	10	119	410	2	289	1.08e-29	117
Msa0428370	AT5G36180.2	27.937	315	203	9	108	410	13	315	1.59e-29	117
Msa0428370	AT2G27920.1	27.014	422	244	15	49	419	37	445	3.91e-28	116
Msa0428370	AT1G73310.3	25.902	305	198	9	108	398	13	303	1.31e-24	103
Msa0428370	AT5G22960.1	34.302	172	88	6	37	205	25	174	4.40e-24	99.4
Msa0428370	AT5G36180.4	27.517	298	192	9	108	393	13	298	2.47e-23	100
Msa0428370	AT2G22920.3	26.740	273	159	11	185	435	3	256	4.46e-20	89.7
Msa0428370	AT2G27920.2	25.587	383	223	14	86	419	4	373	2.55e-19	89.7

Find 97 sgRNAs with CRISPR-Local

Find 237 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
CTTCAAAACCTCTTGTTCTT+TGG	0.209048	3_2:-79208056	Msa0428370:CDS
TACTGATTATTAGATATTAA+AGG	0.220981	3_2:+79204837	None:intergenic
ACCTCTTTGTTCAAAGGTTA+TGG	0.222269	3_2:-79206911	Msa0428370:CDS
AGAGGCAAACATGCTTTATT+TGG	0.233598	3_2:-79207834	Msa0428370:CDS
CGTGCTATTCAAATCATTCT+TGG	0.238356	3_2:-79204953	Msa0428370:CDS
AATTCACCATTTGGTCTAAA+TGG	0.239444	3_2:+79207976	None:intergenic
AGAGAAACAAAACACTTTAA+AGG	0.246230	3_2:+79208224	None:intergenic
GGTGGGTGGACTCAAGTTTA+TGG	0.246369	3_2:-79205048	Msa0428370:CDS
AACAAGATATTCAATCTTAA+AGG	0.249651	3_2:-79207179	Msa0428370:CDS
GACAAAATTGTTACCCTTCC+TGG	0.252638	3_2:-79208186	Msa0428370:CDS
ACACTTCCTACCTGTAAATT+AGG	0.255971	3_2:+79206030	None:intergenic
AACAGAGATTTGTTTCTAAC+TGG	0.261748	3_2:-79207347	Msa0428370:CDS
CAACAGTTCCTTACAGAGTA+TGG	0.262408	3_2:-79205817	Msa0428370:CDS
AATAGCACGAGTGATCTTTC+AGG	0.286784	3_2:+79204967	None:intergenic
ATACAAGGTCATTACTCTTT+AGG	0.287449	3_2:-79204576	Msa0428370:three_prime_UTR
CCTCTTGTTCTTTGGCTCAA+TGG	0.297305	3_2:-79208048	Msa0428370:CDS
CCTCTTTGTTCAAAGGTTAT+GGG	0.297500	3_2:-79206910	Msa0428370:CDS
GAGTTAAGGTCCTAATTTAC+AGG	0.298396	3_2:-79206040	Msa0428370:intron
ATTCAAGGGCTGAATTCTTT+TGG	0.305209	3_2:-79207029	Msa0428370:CDS
GGACCTGGTTGTTCTTCTCT+TGG	0.328407	3_2:-79208024	Msa0428370:CDS
GTAGGTGCATTCTCAGAAAA+TGG	0.330444	3_2:-79208000	Msa0428370:CDS
AATGAACATAGTTGGAATAA+AGG	0.338350	3_2:-79207943	Msa0428370:intron
TTAATAAGAAATTCACCATT+TGG	0.361078	3_2:+79207967	None:intergenic
CAAAAGGTTGAAAACCAAAA+AGG	0.369573	3_2:+79204743	None:intergenic
CTTTGGCTCAATGGAGGACC+TGG	0.390446	3_2:-79208039	Msa0428370:CDS
TATGTCTTTAAATCCATTGT+TGG	0.393903	3_2:+79204600	None:intergenic
TCAGTTGCATATTCTAGAAC+TGG	0.396182	3_2:+79207057	None:intergenic
ACTTGTTGAACCAACGTTCC+AGG	0.404293	3_2:+79207384	None:intergenic
GCACTTCATGCAAAACTTGT+TGG	0.416149	3_2:-79206484	Msa0428370:CDS
AAGGGACAATCTTGTATTCC+TGG	0.417025	3_2:-79207402	Msa0428370:CDS
AAATCTCTGTTTCTATATTG+AGG	0.417674	3_2:+79207359	None:intergenic
TTTATCAATGATCCAACAAC+AGG	0.423621	3_2:+79206068	None:intergenic
GTATAGAGAGAAAGAGTGAT+GGG	0.424629	3_2:+79208309	None:intergenic
AGGTTACAAACTACTTAAAC+AGG	0.431883	3_2:-79206522	Msa0428370:CDS
CTAAATAGTAAACACACAAA+AGG	0.432283	3_2:+79204890	None:intergenic
CCTTACAGAGTATGGTTTGA+AGG	0.432469	3_2:-79205809	Msa0428370:CDS
CTCTGTGCTGTCACAGTCCA+AGG	0.436842	3_2:-79206821	Msa0428370:intron
ATTGATAAAAGCTGGAGTTA+AGG	0.446975	3_2:-79206054	Msa0428370:CDS
GGTTGTTCTTCTCTTGGAGT+AGG	0.448812	3_2:-79208018	Msa0428370:CDS
GTGCCAACACTTCCTGTTGT+TGG	0.450313	3_2:-79206080	Msa0428370:CDS
TAAGAAAATCCAACTCCAAC+TGG	0.455371	3_2:+79207806	None:intergenic
TAAAGAAACTAGTAGATTTG+TGG	0.457756	3_2:-79206878	Msa0428370:CDS
ATGCAACTGATTTCAATTCA+AGG	0.458582	3_2:-79207044	Msa0428370:CDS
AGGGTGTGTCAGAAAACTTC+AGG	0.465152	3_2:+79204916	None:intergenic
CTCTCATTTGCCACAGTGAG+AGG	0.471001	3_2:-79205018	Msa0428370:CDS
TTGTTCAAAGGTTATGGGAT+TGG	0.472351	3_2:-79206905	Msa0428370:CDS
ATAGCCTTTCAACAATTCTC+AGG	0.473579	3_2:-79208150	Msa0428370:CDS
AATGGACCATTTAGACCAAA+TGG	0.474826	3_2:-79207982	Msa0428370:CDS
ATCATAAGCTTTGCAAGTTG+AGG	0.475887	3_2:+79207218	None:intergenic
AGTATGGTTTGAAGGCCAAC+AGG	0.477560	3_2:-79205801	Msa0428370:intron
TTTAATGAAACTTAGGTTGG+TGG	0.479581	3_2:-79205066	Msa0428370:intron
CCTTCAAACCATACTCTGTA+AGG	0.483426	3_2:+79205809	None:intergenic
GGACTATGATGTGCTTAACT+TGG	0.489157	3_2:-79206105	Msa0428370:CDS
CTATACTCTTCTCTCTCTCA+TGG	0.491043	3_2:-79208292	Msa0428370:exon
AGTATAGAGAGAAAGAGTGA+TGG	0.493963	3_2:+79208308	None:intergenic
ATAGAGAGAAAGAGTGATGG+GGG	0.496619	3_2:+79208311	None:intergenic
GATCTTTCAGGCTGTGAGAA+AGG	0.497374	3_2:+79204979	None:intergenic
TTGGAGACACCAGTTGGAGT+TGG	0.500117	3_2:-79207815	Msa0428370:CDS
ATCTTGTATTCCTGGAACGT+TGG	0.501196	3_2:-79207394	Msa0428370:CDS
CTTGTTCTTTGGCTCAATGG+AGG	0.503534	3_2:-79208045	Msa0428370:CDS
CTAACTGGGGAAAGTTATGC+AGG	0.506489	3_2:-79207332	Msa0428370:intron
GACTCGGTGATTCCACTGAC+TGG	0.508042	3_2:-79205887	Msa0428370:CDS
TGCAACTGATTTCAATTCAA+GGG	0.511117	3_2:-79207043	Msa0428370:CDS
TCAAATCATTCTTGGAAGGA+AGG	0.513553	3_2:-79204945	Msa0428370:CDS
TAAATAGTAAACACACAAAA+GGG	0.515682	3_2:+79204891	None:intergenic
TTAATGAAACTTAGGTTGGT+GGG	0.518560	3_2:-79205065	Msa0428370:intron
ACAGAGATTTGTTTCTAACT+GGG	0.518718	3_2:-79207346	Msa0428370:CDS
CTTTATTTGGAGACACCAGT+TGG	0.520213	3_2:-79207821	Msa0428370:CDS
AGTTTCACCTCTTTGTTCAA+AGG	0.523708	3_2:-79206917	Msa0428370:CDS
GTTGGATCATTGATAAAAGC+TGG	0.524225	3_2:-79206062	Msa0428370:CDS
GTTGTTGAAGAGAATGCAAG+TGG	0.534035	3_2:-79204645	Msa0428370:three_prime_UTR
ACAGTGAATGACGAGGAAAC+AGG	0.535990	3_2:-79207755	Msa0428370:intron
TGTCAGAAAACTTCAGGTAA+AGG	0.539128	3_2:+79204922	None:intergenic
GTAAACACACAAAAGGGAAA+GGG	0.559233	3_2:+79204897	None:intergenic
TAATATCTAATAATCAGTAA+AGG	0.565877	3_2:-79204833	Msa0428370:three_prime_UTR
CAGAGATTTGTTTCTAACTG+GGG	0.566111	3_2:-79207345	Msa0428370:CDS
CCCATAACCTTTGAACAAAG+AGG	0.567501	3_2:+79206910	None:intergenic
AAGCTTCTGCTTCCAGTCAG+TGG	0.568377	3_2:+79205875	None:intergenic
GATCCAACAACAGGAAGTGT+TGG	0.570777	3_2:+79206077	None:intergenic
AGTAAACACACAAAAGGGAA+AGG	0.571309	3_2:+79204896	None:intergenic
CCATTGAGCCAAAGAACAAG+AGG	0.575023	3_2:+79208048	None:intergenic
CTATTCAAATCATTCTTGGA+AGG	0.581750	3_2:-79204949	Msa0428370:CDS
AGTTAAGCACATCATAGTCC+AGG	0.589846	3_2:+79206108	None:intergenic
AACTCAAACTCGTTGCAGAT+CGG	0.593466	3_2:-79204536	Msa0428370:three_prime_UTR
ATGAAACTTAGGTTGGTGGG+TGG	0.608032	3_2:-79205062	Msa0428370:intron
TATAGAGAGAAAGAGTGATG+GGG	0.618775	3_2:+79208310	None:intergenic
ATATCCTGAGAATTGTTGAA+AGG	0.621984	3_2:+79208146	None:intergenic
TAGAGAGAAAGAGTGATGGG+GGG	0.638949	3_2:+79208312	None:intergenic
TAATAATCAGTAAAGGAATG+TGG	0.639265	3_2:-79204826	Msa0428370:three_prime_UTR
CTACAGTGGAGATCAAGACT+CGG	0.646625	3_2:-79205903	Msa0428370:intron
GATTTAAAGACATAAATACA+AGG	0.658495	3_2:-79204591	Msa0428370:three_prime_UTR
TCTCATGGCAATGACAACAA+TGG	0.663515	3_2:-79208277	Msa0428370:exon
AAACAGGAGAGATGTGCAAG+AGG	0.664395	3_2:-79206506	Msa0428370:CDS
ACTCCAAGAGAAGAACAACC+AGG	0.669050	3_2:+79208021	None:intergenic
ATGTGCAGCACCTCTCACTG+TGG	0.718656	3_2:+79205008	None:intergenic
TACAACAACAGTGAATGACG+AGG	0.719486	3_2:-79207762	Msa0428370:CDS
CTTGGACTGTGACAGCACAG+AGG	0.766016	3_2:+79206822	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	AAATAACTTGTAATTTTATT+AGG	-	chr3_2:79206595-79206614	Msa0428370:intron	10.0%
!!!	TATAAATTTTAATGAAACTT+AGG	-	chr3_2:79207774-79207793	Msa0428370:CDS	10.0%
!!	TTATTAAAAATGAACATAGT+TGG	-	chr3_2:79204896-79204915	Msa0428370:three_prime_UTR	15.0%
!!!	TCATTATTATTGAATCTTTT+TGG	-	chr3_2:79205118-79205137	Msa0428370:intron	15.0%
!!!	TTATGTTTTTATACTTTCTT+AGG	-	chr3_2:79205208-79205227	Msa0428370:intron	15.0%
!!	AAATTCTGTCAAATTATTAT+TGG	+	chr3_2:79206162-79206181	None:intergenic	15.0%
!!	ATTAATATATATTTACCTGT+TGG	+	chr3_2:79207064-79207083	None:intergenic	15.0%
!!!	TACTGATTATTAGATATTAA+AGG	+	chr3_2:79208013-79208032	None:intergenic	15.0%
!!	TAATATCTAATAATCAGTAA+AGG	-	chr3_2:79208014-79208033	Msa0428370:CDS	15.0%
!!	TTAATAAGAAATTCACCATT+TGG	+	chr3_2:79204883-79204902	None:intergenic	20.0%
!!!	ACATATTTTGTAATCTGAAA+CGG	-	chr3_2:79205401-79205420	Msa0428370:intron	20.0%
!!!	TTTTTTGAATTGTTAAGCAA+GGG	-	chr3_2:79205427-79205446	Msa0428370:intron	20.0%
!!	AAAATTTATGCATGTATTTC+AGG	-	chr3_2:79205596-79205615	Msa0428370:intron	20.0%
!!	AACAAGATATTCAATCTTAA+AGG	-	chr3_2:79205668-79205687	Msa0428370:intron	20.0%
!!	CTTAGAATAAAAGTTAAATG+TGG	-	chr3_2:79206465-79206484	Msa0428370:intron	20.0%
!!	AGAATAAATCAAAAAACAGA+AGG	+	chr3_2:79206852-79206871	None:intergenic	20.0%
!!!	AATTTTAATGAAACTTAGGT+TGG	-	chr3_2:79207778-79207797	Msa0428370:CDS	20.0%
!!	TAAATAGTAAACACACAAAA+GGG	+	chr3_2:79207959-79207978	None:intergenic	20.0%
!!	GATTTAAAGACATAAATACA+AGG	-	chr3_2:79208256-79208275	Msa0428370:CDS	20.0%
!	AGAGAAACAAAACACTTTAA+AGG	+	chr3_2:79204626-79204645	None:intergenic	25.0%
!	AATGAACATAGTTGGAATAA+AGG	-	chr3_2:79204904-79204923	Msa0428370:three_prime_UTR	25.0%
!!	GTTGGATTTTCTTATGTTAA+AGG	-	chr3_2:79205050-79205069	Msa0428370:CDS	25.0%
!!	CTTTTAAATCCTACTTCTAT+TGG	-	chr3_2:79205170-79205189	Msa0428370:intron	25.0%
!!!	CTTTTTTGAATTGTTAAGCA+AGG	-	chr3_2:79205426-79205445	Msa0428370:intron	25.0%
!!!	AAATCTCTGTTTCTATATTG+AGG	+	chr3_2:79205491-79205510	None:intergenic	25.0%
!!!	CATGTTTTAAATAGCAGTAA+AGG	+	chr3_2:79205552-79205571	None:intergenic	25.0%
!	TAAAGAAACTAGTAGATTTG+TGG	-	chr3_2:79205969-79205988	Msa0428370:intron	25.0%
!	AAAGTTAAATGTGGTTTATG+CGG	-	chr3_2:79206474-79206493	Msa0428370:intron	25.0%
!!	AGAAATCACTGTCAAAATTT+TGG	-	chr3_2:79207107-79207126	Msa0428370:intron	25.0%
!	ACTCTTTGGATCTAATAAAA+GGG	-	chr3_2:79207486-79207505	Msa0428370:intron	25.0%
!	TTATAATCTAAACATAGCCT+CGG	-	chr3_2:79207541-79207560	Msa0428370:intron	25.0%
!	CTAAATAGTAAACACACAAA+AGG	+	chr3_2:79207960-79207979	None:intergenic	25.0%
!	TAATAATCAGTAAAGGAATG+TGG	-	chr3_2:79208021-79208040	Msa0428370:CDS	25.0%
!!!	TATTTCTTTTTTGGCCTTTT+TGG	-	chr3_2:79208090-79208109	Msa0428370:CDS	25.0%
!!!	GATTCTTGTTCTAAGTTTTT+GGG	-	chr3_2:79208224-79208243	Msa0428370:CDS	25.0%
!	TATGTCTTTAAATCCATTGT+TGG	+	chr3_2:79208250-79208269	None:intergenic	25.0%
	ATATCCTGAGAATTGTTGAA+AGG	+	chr3_2:79204704-79204723	None:intergenic	30.0%
	AATTCACCATTTGGTCTAAA+TGG	+	chr3_2:79204874-79204893	None:intergenic	30.0%
!!!	AGTTATTTTTTGTGTTGCAG+AGG	-	chr3_2:79204995-79205014	Msa0428370:CDS	30.0%
!!!	CTACTTTTTCCAATAGAAGT+AGG	+	chr3_2:79205182-79205201	None:intergenic	30.0%
!	TGATATCAGTATGATGATGA+TGG	-	chr3_2:79205369-79205388	Msa0428370:intron	30.0%
!!	AACAGAGATTTGTTTCTAAC+TGG	-	chr3_2:79205500-79205519	Msa0428370:intron	30.0%
!!	ACAGAGATTTGTTTCTAACT+GGG	-	chr3_2:79205501-79205520	Msa0428370:intron	30.0%
	TCAACAGCTAGAAAATTGTA+AGG	+	chr3_2:79205742-79205761	None:intergenic	30.0%
	TACCAAAATTGAATTGCAGT+TGG	-	chr3_2:79205762-79205781	Msa0428370:intron	30.0%
	ACCAAAATTGAATTGCAGTT+GGG	-	chr3_2:79205763-79205782	Msa0428370:intron	30.0%
!	ATGCAACTGATTTCAATTCA+AGG	-	chr3_2:79205803-79205822	Msa0428370:CDS	30.0%
!	TGCAACTGATTTCAATTCAA+GGG	-	chr3_2:79205804-79205823	Msa0428370:CDS	30.0%
	TGAAATGATAGATGTATGTG+TGG	-	chr3_2:79206296-79206315	Msa0428370:intron	30.0%
	AGGTTACAAACTACTTAAAC+AGG	-	chr3_2:79206325-79206344	Msa0428370:intron	30.0%
!!!	AAGGTTTTAAATTGCAGTTG+TGG	-	chr3_2:79206426-79206445	Msa0428370:intron	30.0%
!!!	GTTATTTTAGCTTAGTGAGA+AGG	+	chr3_2:79206582-79206601	None:intergenic	30.0%
	TTTATCAATGATCCAACAAC+AGG	+	chr3_2:79206782-79206801	None:intergenic	30.0%
	ATTGATAAAAGCTGGAGTTA+AGG	-	chr3_2:79206793-79206812	Msa0428370:intron	30.0%
!	TATTCTGTTGCTTAAACTAG+AGG	-	chr3_2:79206866-79206885	Msa0428370:CDS	30.0%
!	ATTCTGTTGCTTAAACTAGA+GGG	-	chr3_2:79206867-79206886	Msa0428370:CDS	30.0%
	CAGAAGCTTAGTTCAAAAAT+TGG	-	chr3_2:79206986-79207005	Msa0428370:CDS	30.0%
	CAAAAATTGGCTAGACAATT+AGG	-	chr3_2:79206999-79207018	Msa0428370:CDS	30.0%
!	CTTTCTGGTCACTTATAAAA+TGG	+	chr3_2:79207135-79207154	None:intergenic	30.0%
	ATTGAGACGTCATTTAACTA+AGG	+	chr3_2:79207427-79207446	None:intergenic	30.0%
	TTAGTTAAATGACGTCTCAA+TGG	-	chr3_2:79207426-79207445	Msa0428370:intron	30.0%
	CACTCTTTGGATCTAATAAA+AGG	-	chr3_2:79207485-79207504	Msa0428370:intron	30.0%
!!	ATAAAAGGGTGCTTAGATAT+AGG	-	chr3_2:79207500-79207519	Msa0428370:intron	30.0%
!!	TAAAAGGGTGCTTAGATATA+GGG	-	chr3_2:79207501-79207520	Msa0428370:intron	30.0%
!!	TTTAATGAAACTTAGGTTGG+TGG	-	chr3_2:79207781-79207800	Msa0428370:CDS	30.0%
!!	TTAATGAAACTTAGGTTGGT+GGG	-	chr3_2:79207782-79207801	Msa0428370:CDS	30.0%
	CTATTCAAATCATTCTTGGA+AGG	-	chr3_2:79207898-79207917	Msa0428370:intron	30.0%
	AGAATGTCAAAAAGAAAAGC+TGG	-	chr3_2:79208056-79208075	Msa0428370:CDS	30.0%
	CAAAAGGTTGAAAACCAAAA+AGG	+	chr3_2:79208107-79208126	None:intergenic	30.0%
	CACAAAAACTCAAGTACAAA+AGG	+	chr3_2:79208123-79208142	None:intergenic	30.0%
!!	GGATTCTTGTTCTAAGTTTT+TGG	-	chr3_2:79208223-79208242	Msa0428370:CDS	30.0%
	ATACAAGGTCATTACTCTTT+AGG	-	chr3_2:79208271-79208290	Msa0428370:CDS	30.0%
!!	CCTATTTAAAAAGTGTCGAA+TGG	+	chr3_2:79208347-79208366	None:intergenic	30.0%
!!	CCATTCGACACTTTTTAAAT+AGG	-	chr3_2:79208344-79208363	Msa0428370:five_prime_UTR	30.0%
	TATAGAGAGAAAGAGTGATG+GGG	+	chr3_2:79204540-79204559	None:intergenic	35.0%
	GTATAGAGAGAAAGAGTGAT+GGG	+	chr3_2:79204541-79204560	None:intergenic	35.0%
	AGTATAGAGAGAAAGAGTGA+TGG	+	chr3_2:79204542-79204561	None:intergenic	35.0%
!	TGTTGAAAGGCTATGTTTTG+AGG	+	chr3_2:79204691-79204710	None:intergenic	35.0%
	ATAGCCTTTCAACAATTCTC+AGG	-	chr3_2:79204697-79204716	Msa0428370:three_prime_UTR	35.0%
!!!	AGAACAAGAGGTTTTGAAGA+TGG	+	chr3_2:79204790-79204809	None:intergenic	35.0%
	CTTCAAAACCTCTTGTTCTT+TGG	-	chr3_2:79204791-79204810	Msa0428370:three_prime_UTR	35.0%
	AATGGACCATTTAGACCAAA+TGG	-	chr3_2:79204865-79204884	Msa0428370:three_prime_UTR	35.0%
	TCAATGAATGCATGTCATTG+TGG	+	chr3_2:79204957-79204976	None:intergenic	35.0%
!	AGAGGCAAACATGCTTTATT+TGG	-	chr3_2:79205013-79205032	Msa0428370:CDS	35.0%
	TAAGAAAATCCAACTCCAAC+TGG	+	chr3_2:79205044-79205063	None:intergenic	35.0%
!!	CAGAGATTTGTTTCTAACTG+GGG	-	chr3_2:79205502-79205521	Msa0428370:intron	35.0%
	ATCATAAGCTTTGCAAGTTG+AGG	+	chr3_2:79205632-79205651	None:intergenic	35.0%
	CCAAAATTGAATTGCAGTTG+GGG	-	chr3_2:79205764-79205783	Msa0428370:intron	35.0%
!!	TCAGTTGCATATTCTAGAAC+TGG	+	chr3_2:79205793-79205812	None:intergenic	35.0%
!	ATTCAAGGGCTGAATTCTTT+TGG	-	chr3_2:79205818-79205837	Msa0428370:CDS	35.0%
	AGTTTCACCTCTTTGTTCAA+AGG	-	chr3_2:79205930-79205949	Msa0428370:intron	35.0%
	ACCTCTTTGTTCAAAGGTTA+TGG	-	chr3_2:79205936-79205955	Msa0428370:intron	35.0%
	CCTCTTTGTTCAAAGGTTAT+GGG	-	chr3_2:79205937-79205956	Msa0428370:intron	35.0%
	TTGTTCAAAGGTTATGGGAT+TGG	-	chr3_2:79205942-79205961	Msa0428370:intron	35.0%
!	CATTTCATTTGCTTGCTACA+AGG	+	chr3_2:79206283-79206302	None:intergenic	35.0%
	AAGGTTATAAAACAGGTCCA+CGG	+	chr3_2:79206556-79206575	None:intergenic	35.0%
	AAGGACCAAGGTTATAAAAC+AGG	+	chr3_2:79206563-79206582	None:intergenic	35.0%
	GACCAATGAAGCTAAATCAT+TGG	+	chr3_2:79206621-79206640	None:intergenic	35.0%
	AAAGATCATCAGTGATCACA+TGG	+	chr3_2:79206699-79206718	None:intergenic	35.0%
!	CTGATGATCTTTGTCTGTTT+TGG	-	chr3_2:79206707-79206726	Msa0428370:intron	35.0%
	GTTGGATCATTGATAAAAGC+TGG	-	chr3_2:79206785-79206804	Msa0428370:intron	35.0%
	GAGTTAAGGTCCTAATTTAC+AGG	-	chr3_2:79206807-79206826	Msa0428370:intron	35.0%
	TAAGGTCCTAATTTACAGGT+AGG	-	chr3_2:79206811-79206830	Msa0428370:intron	35.0%
	ACACTTCCTACCTGTAAATT+AGG	+	chr3_2:79206820-79206839	None:intergenic	35.0%
	GTGCATTATTATTGCTACAG+TGG	-	chr3_2:79206930-79206949	Msa0428370:CDS	35.0%
	AAAAGGATCTTTCCACTTTG+GGG	+	chr3_2:79207197-79207216	None:intergenic	35.0%
	GAAAAGGATCTTTCCACTTT+GGG	+	chr3_2:79207198-79207217	None:intergenic	35.0%
	AAGACTAAAGCCAATGGAAA+AGG	+	chr3_2:79207214-79207233	None:intergenic	35.0%
	TTGACAAAGACTAAAGCCAA+TGG	+	chr3_2:79207220-79207239	None:intergenic	35.0%
!!	TGGCTTTAGTCTTTGTCAAT+TGG	-	chr3_2:79207221-79207240	Msa0428370:CDS	35.0%
!	GGCTTTAGTCTTTGTCAATT+GGG	-	chr3_2:79207222-79207241	Msa0428370:CDS	35.0%
	CAGACAATACTTCAGAAAGT+CGG	+	chr3_2:79207371-79207390	None:intergenic	35.0%
	TAACTAAGGATAAAACTGCG+AGG	+	chr3_2:79207413-79207432	None:intergenic	35.0%
!!	CCAAAGAGTGCTTACATATA+GGG	+	chr3_2:79207475-79207494	None:intergenic	35.0%
!!	TCCAAAGAGTGCTTACATAT+AGG	+	chr3_2:79207476-79207495	None:intergenic	35.0%
!!	ATGTGGGACTTTTTAGTGTA+CGG	-	chr3_2:79207574-79207593	Msa0428370:intron	35.0%
	CAATGGTTAAGGTCGTAAAA+TGG	+	chr3_2:79207688-79207707	None:intergenic	35.0%
	TAAAAGTGGTGCAATGGTTA+AGG	+	chr3_2:79207699-79207718	None:intergenic	35.0%
	CGTACAATACCTCATAAAAG+TGG	+	chr3_2:79207713-79207732	None:intergenic	35.0%
!!	TTATGAGGTATTGTACGCTT+AGG	-	chr3_2:79207716-79207735	Msa0428370:intron	35.0%
!	CGTGCTATTCAAATCATTCT+TGG	-	chr3_2:79207894-79207913	Msa0428370:intron	35.0%
	TCAAATCATTCTTGGAAGGA+AGG	-	chr3_2:79207902-79207921	Msa0428370:intron	35.0%
	TGTCAGAAAACTTCAGGTAA+AGG	+	chr3_2:79207928-79207947	None:intergenic	35.0%
	GTAAACACACAAAAGGGAAA+GGG	+	chr3_2:79207953-79207972	None:intergenic	35.0%
	AGTAAACACACAAAAGGGAA+AGG	+	chr3_2:79207954-79207973	None:intergenic	35.0%
	ATAGAGAGAAAGAGTGATGG+GGG	+	chr3_2:79204539-79204558	None:intergenic	40.0%
	CTATACTCTTCTCTCTCTCA+TGG	-	chr3_2:79204555-79204574	Msa0428370:three_prime_UTR	40.0%
	TCTCATGGCAATGACAACAA+TGG	-	chr3_2:79204570-79204589	Msa0428370:three_prime_UTR	40.0%
	GACAAAATTGTTACCCTTCC+TGG	-	chr3_2:79204661-79204680	Msa0428370:three_prime_UTR	40.0%
	GTAGGTGCATTCTCAGAAAA+TGG	-	chr3_2:79204847-79204866	Msa0428370:three_prime_UTR	40.0%
!	CTTTATTTGGAGACACCAGT+TGG	-	chr3_2:79205026-79205045	Msa0428370:CDS	40.0%
	TACAACAACAGTGAATGACG+AGG	-	chr3_2:79205085-79205104	Msa0428370:intron	40.0%
	AAGGGACAATCTTGTATTCC+TGG	-	chr3_2:79205445-79205464	Msa0428370:intron	40.0%
	ATCTTGTATTCCTGGAACGT+TGG	-	chr3_2:79205453-79205472	Msa0428370:intron	40.0%
!	CCCCAACTGCAATTCAATTT+TGG	+	chr3_2:79205767-79205786	None:intergenic	40.0%
!	GCTGAATTCTTTTGGTCACA+TGG	-	chr3_2:79205826-79205845	Msa0428370:CDS	40.0%
	CCCATAACCTTTGAACAAAG+AGG	+	chr3_2:79205940-79205959	None:intergenic	40.0%
	AGGTTGAGGAGAAATAACCT+TGG	+	chr3_2:79206046-79206065	None:intergenic	40.0%
!	GGAAAAGCATGAGAAAGGAA+AGG	+	chr3_2:79206092-79206111	None:intergenic	40.0%
!	GTGATGGAAAAGCATGAGAA+AGG	+	chr3_2:79206097-79206116	None:intergenic	40.0%
	GCTTCAAAGACTAGAAGTGA+TGG	+	chr3_2:79206113-79206132	None:intergenic	40.0%
	AGATGTATGTGTGGATGACA+AGG	-	chr3_2:79206305-79206324	Msa0428370:intron	40.0%
	GCACTTCATGCAAAACTTGT+TGG	-	chr3_2:79206363-79206382	Msa0428370:intron	40.0%
	CAGCAAGTAAGTCATTCTCA+AGG	-	chr3_2:79206407-79206426	Msa0428370:intron	40.0%
!	GTGGACCTGTTTTATAACCT+TGG	-	chr3_2:79206555-79206574	Msa0428370:intron	40.0%
!	GGCCAATGATTTAGCTTCAT+TGG	-	chr3_2:79206616-79206635	Msa0428370:intron	40.0%
	TCATCAGTGATCACATGGAT+TGG	+	chr3_2:79206694-79206713	None:intergenic	40.0%
	AGTTAAGCACATCATAGTCC+AGG	+	chr3_2:79206742-79206761	None:intergenic	40.0%
	GGACTATGATGTGCTTAACT+TGG	-	chr3_2:79206742-79206761	Msa0428370:intron	40.0%
	CAACAGTTCCTTACAGAGTA+TGG	-	chr3_2:79207030-79207049	Msa0428370:CDS	40.0%
	CCTTCAAACCATACTCTGTA+AGG	+	chr3_2:79207041-79207060	None:intergenic	40.0%
	CCTTACAGAGTATGGTTTGA+AGG	-	chr3_2:79207038-79207057	Msa0428370:CDS	40.0%
	AAAGGATCTTTCCACTTTGG+GGG	+	chr3_2:79207196-79207215	None:intergenic	40.0%
	GGAAAAGGATCTTTCCACTT+TGG	+	chr3_2:79207199-79207218	None:intergenic	40.0%
!	GTGGAAAGATCCTTTTCCAT+TGG	-	chr3_2:79207201-79207220	Msa0428370:CDS	40.0%
	AAGTCGGTACGAAAGATTTG+AGG	+	chr3_2:79207355-79207374	None:intergenic	40.0%
!	AGAGTGCTTACATATAGGGA+CGG	+	chr3_2:79207471-79207490	None:intergenic	40.0%
	CCCTATATGTAAGCACTCTT+TGG	-	chr3_2:79207472-79207491	Msa0428370:intron	40.0%
!	GTTGAGATTAAGGTGCTACA+GGG	-	chr3_2:79207623-79207642	Msa0428370:intron	40.0%
!	TTGAGATTAAGGTGCTACAG+GGG	-	chr3_2:79207624-79207643	Msa0428370:intron	40.0%
!!	ACCATTGCACCACTTTTATG+AGG	-	chr3_2:79207701-79207720	Msa0428370:intron	40.0%
	ACCTCATAAAAGTGGTGCAA+TGG	+	chr3_2:79207705-79207724	None:intergenic	40.0%
	AATAGCACGAGTGATCTTTC+AGG	+	chr3_2:79207883-79207902	None:intergenic	40.0%
	GTTGTTGAAGAGAATGCAAG+TGG	-	chr3_2:79208202-79208221	Msa0428370:CDS	40.0%
!!	CTAAGTTTTTGGGCCAACAA+TGG	-	chr3_2:79208234-79208253	Msa0428370:CDS	40.0%
	AACTCAAACTCGTTGCAGAT+CGG	-	chr3_2:79208311-79208330	Msa0428370:five_prime_UTR	40.0%
!	TAGAGAGAAAGAGTGATGGG+GGG	+	chr3_2:79204538-79204557	None:intergenic	45.0%
!!!	GTTTTGAGGTTGTCCAGGAA+GGG	+	chr3_2:79204677-79204696	None:intergenic	45.0%
!!!	TGTTTTGAGGTTGTCCAGGA+AGG	+	chr3_2:79204678-79204697	None:intergenic	45.0%
!!!	GCTATGTTTTGAGGTTGTCC+AGG	+	chr3_2:79204682-79204701	None:intergenic	45.0%
	CCATTGAGCCAAAGAACAAG+AGG	+	chr3_2:79204802-79204821	None:intergenic	45.0%
!	CCTCTTGTTCTTTGGCTCAA+TGG	-	chr3_2:79204799-79204818	Msa0428370:three_prime_UTR	45.0%
!	CTTGTTCTTTGGCTCAATGG+AGG	-	chr3_2:79204802-79204821	Msa0428370:three_prime_UTR	45.0%
	ACTCCAAGAGAAGAACAACC+AGG	+	chr3_2:79204829-79204848	None:intergenic	45.0%
	GGTTGTTCTTCTCTTGGAGT+AGG	-	chr3_2:79204829-79204848	Msa0428370:three_prime_UTR	45.0%
	ACAGTGAATGACGAGGAAAC+AGG	-	chr3_2:79205092-79205111	Msa0428370:intron	45.0%
!	ACTTGTTGAACCAACGTTCC+AGG	+	chr3_2:79205466-79205485	None:intergenic	45.0%
	CTAACTGGGGAAAGTTATGC+AGG	-	chr3_2:79205515-79205534	Msa0428370:intron	45.0%
	AAGACACTCACTTGAGGTTG+AGG	+	chr3_2:79206060-79206079	None:intergenic	45.0%
	CAAGAGAAGACACTCACTTG+AGG	+	chr3_2:79206066-79206085	None:intergenic	45.0%
	AAACAGGAGAGATGTGCAAG+AGG	-	chr3_2:79206341-79206360	Msa0428370:intron	45.0%
!!	AACTTGTTGGAGTTCGCAAG+TGG	-	chr3_2:79206376-79206395	Msa0428370:intron	45.0%
!	ACTTGTTGGAGTTCGCAAGT+GGG	-	chr3_2:79206377-79206396	Msa0428370:intron	45.0%
	TGTCTTCGCAACCTCAAATG+AGG	+	chr3_2:79206500-79206519	None:intergenic	45.0%
	TAGCTTAGTGAGAAGGACCA+AGG	+	chr3_2:79206575-79206594	None:intergenic	45.0%
!!!	CTGTTTTGGTAACAGTGTCC+TGG	-	chr3_2:79206721-79206740	Msa0428370:intron	45.0%
!	GATCCAACAACAGGAAGTGT+TGG	+	chr3_2:79206773-79206792	None:intergenic	45.0%
	CTACAGTGGAGATCAAGACT+CGG	-	chr3_2:79206944-79206963	Msa0428370:CDS	45.0%
	AGTATGGTTTGAAGGCCAAC+AGG	-	chr3_2:79207046-79207065	Msa0428370:CDS	45.0%
	TGCTTACATATAGGGACGGA+GGG	+	chr3_2:79207467-79207486	None:intergenic	45.0%
!	AGGGTGCTTAGATATAGGGA+CGG	-	chr3_2:79207505-79207524	Msa0428370:intron	45.0%
	TGCTTAGATATAGGGACGGA+GGG	-	chr3_2:79207509-79207528	Msa0428370:intron	45.0%
	CCTCGGTTCTTACGTAATGT+GGG	-	chr3_2:79207558-79207577	Msa0428370:intron	45.0%
	TGAGGCTGAGGTTGAGATTA+AGG	-	chr3_2:79207613-79207632	Msa0428370:intron	45.0%
!	GGTTGAGATTAAGGTGCTAC+AGG	-	chr3_2:79207622-79207641	Msa0428370:intron	45.0%
	AAGGTCGTAAAATGGCCTCT+AGG	+	chr3_2:79207680-79207699	None:intergenic	45.0%
!!	ATGAAACTTAGGTTGGTGGG+TGG	-	chr3_2:79207785-79207804	Msa0428370:CDS	45.0%
	GATCTTTCAGGCTGTGAGAA+AGG	+	chr3_2:79207871-79207890	None:intergenic	45.0%
	AGGGTGTGTCAGAAAACTTC+AGG	+	chr3_2:79207934-79207953	None:intergenic	45.0%
!!	AAAAAAGAAATATAAAAAAT+TGG	+	chr3_2:79208082-79208101	None:intergenic	5.0%
!!!	AATTTTTTATATTTCTTTTT+TGG	-	chr3_2:79208081-79208100	Msa0428370:CDS	5.0%
	GGACCTGGTTGTTCTTCTCT+TGG	-	chr3_2:79204823-79204842	Msa0428370:three_prime_UTR	50.0%
	TTGGAGACACCAGTTGGAGT+TGG	-	chr3_2:79205032-79205051	Msa0428370:CDS	50.0%
	GGTTTATGCGGCCTCATTTG+AGG	-	chr3_2:79206486-79206505	Msa0428370:CDS	50.0%
!	CGATTTGGGCTGTGACATCA+AGG	+	chr3_2:79206529-79206548	None:intergenic	50.0%
	AGGTCCACGGACAACGATTT+GGG	+	chr3_2:79206543-79206562	None:intergenic	50.0%
	GTGCCAACACTTCCTGTTGT+TGG	-	chr3_2:79206767-79206786	Msa0428370:intron	50.0%
	AAGCTTCTGCTTCCAGTCAG+TGG	+	chr3_2:79206975-79206994	None:intergenic	50.0%
	AGTGACCAGAAAGCCTTCAG+TGG	-	chr3_2:79207142-79207161	Msa0428370:intron	50.0%
	TGACTCCACTGAAGGCTTTC+TGG	+	chr3_2:79207150-79207169	None:intergenic	50.0%
	AAGCCTTCAGTGGAGTCACT+AGG	-	chr3_2:79207152-79207171	Msa0428370:intron	50.0%
	AGCCTTCAGTGGAGTCACTA+GGG	-	chr3_2:79207153-79207172	Msa0428370:intron	50.0%
	ATCCCTAGTGACTCCACTGA+AGG	+	chr3_2:79207158-79207177	None:intergenic	50.0%
	GACTACTCTTTCCCCCAAAG+TGG	-	chr3_2:79207182-79207201	Msa0428370:CDS	50.0%
	GTGCTTACATATAGGGACGG+AGG	+	chr3_2:79207468-79207487	None:intergenic	50.0%
	GTGCTTAGATATAGGGACGG+AGG	-	chr3_2:79207508-79207527	Msa0428370:intron	50.0%
	GCCTCGGTTCTTACGTAATG+TGG	-	chr3_2:79207557-79207576	Msa0428370:intron	50.0%
	CCCACATTACGTAAGAACCG+AGG	+	chr3_2:79207561-79207580	None:intergenic	50.0%
!	GTGTACGGAACACTAGTCTC+CGG	-	chr3_2:79207589-79207608	Msa0428370:intron	50.0%
	ATCTCAACCTCAGCCTCAAC+CGG	+	chr3_2:79207611-79207630	None:intergenic	50.0%
!	GGTGGGTGGACTCAAGTTTA+TGG	-	chr3_2:79207799-79207818	Msa0428370:CDS	50.0%
	CTCTCATTTGCCACAGTGAG+AGG	-	chr3_2:79207829-79207848	Msa0428370:CDS	50.0%
!	AGAGAAAGAGTGATGGGGGG+TGG	+	chr3_2:79204535-79204554	None:intergenic	55.0%
!	CTTTGGCTCAATGGAGGACC+TGG	-	chr3_2:79204808-79204827	Msa0428370:three_prime_UTR	55.0%
	CTTGGACTGTGACAGCACAG+AGG	+	chr3_2:79206028-79206047	None:intergenic	55.0%
	CTCTGTGCTGTCACAGTCCA+AGG	-	chr3_2:79206026-79206045	Msa0428370:intron	55.0%
	ACAGCCCAAATCGTTGTCCG+TGG	-	chr3_2:79206536-79206555	Msa0428370:intron	55.0%
	CAGGTCCACGGACAACGATT+TGG	+	chr3_2:79206544-79206563	None:intergenic	55.0%
!!	GACTCGGTGATTCCACTGAC+TGG	-	chr3_2:79206960-79206979	Msa0428370:CDS	55.0%
!	GGAACACTAGTCTCCGGTTG+AGG	-	chr3_2:79207595-79207614	Msa0428370:intron	55.0%
	AGAGCCTAAGCCACACACGA+GGG	+	chr3_2:79207657-79207676	None:intergenic	55.0%
	TGTGGCTTAGGCTCTCCTAG+AGG	-	chr3_2:79207662-79207681	Msa0428370:intron	55.0%
	ATGTGCAGCACCTCTCACTG+TGG	+	chr3_2:79207842-79207861	None:intergenic	55.0%
	CTAGTCTCCGGTTGAGGCTG+AGG	-	chr3_2:79207601-79207620	Msa0428370:intron	60.0%
!	GGGTTTTCAGCCCTCGTGTG+TGG	-	chr3_2:79207644-79207663	Msa0428370:intron	60.0%
	TCAGCCCTCGTGTGTGGCTT+AGG	-	chr3_2:79207650-79207669	Msa0428370:intron	60.0%
	GAGAGCCTAAGCCACACACG+AGG	+	chr3_2:79207658-79207677	None:intergenic	60.0%

Chromosome	Type	Strat	End	Strand	Name
chr3_2	gene	79204499	79208370	79204499	ID=Msa0428370;Name=Msa0428370
chr3_2	mRNA	79204499	79208370	79204499	ID=Msa0428370-mRNA-1;Parent=Msa0428370;Name=Msa0428370-mRNA-1;_AED=0.21;_eAED=0.21;_QI=75\|0.75\|0.77\|1\|1\|1\|9\|425\|439
chr3_2	exon	79204499	79205073	79204499	ID=Msa0428370-mRNA-1:exon:21363;Parent=Msa0428370-mRNA-1
chr3_2	exon	79205802	79205919	79205802	ID=Msa0428370-mRNA-1:exon:21362;Parent=Msa0428370-mRNA-1
chr3_2	exon	79206041	79206133	79206041	ID=Msa0428370-mRNA-1:exon:21361;Parent=Msa0428370-mRNA-1
chr3_2	exon	79206475	79206542	79206475	ID=Msa0428370-mRNA-1:exon:21360;Parent=Msa0428370-mRNA-1
chr3_2	exon	79206822	79207088	79206822	ID=Msa0428370-mRNA-1:exon:21359;Parent=Msa0428370-mRNA-1
chr3_2	exon	79207172	79207251	79207172	ID=Msa0428370-mRNA-1:exon:21358;Parent=Msa0428370-mRNA-1
chr3_2	exon	79207333	79207425	79207333	ID=Msa0428370-mRNA-1:exon:21357;Parent=Msa0428370-mRNA-1
chr3_2	exon	79207756	79207854	79207756	ID=Msa0428370-mRNA-1:exon:21356;Parent=Msa0428370-mRNA-1
chr3_2	exon	79207944	79208370	79207944	ID=Msa0428370-mRNA-1:exon:21355;Parent=Msa0428370-mRNA-1
chr3_2	five_prime_UTR	79208296	79208370	79208296	ID=Msa0428370-mRNA-1:five_prime_utr;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79207944	79208295	79207944	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79207756	79207854	79207756	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79207333	79207425	79207333	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79207172	79207251	79207172	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79206822	79207088	79206822	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79206475	79206542	79206475	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79206041	79206133	79206041	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79205802	79205919	79205802	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	CDS	79204924	79205073	79204924	ID=Msa0428370-mRNA-1:cds;Parent=Msa0428370-mRNA-1
chr3_2	three_prime_UTR	79204499	79204923	79204499	ID=Msa0428370-mRNA-1:three_prime_utr;Parent=Msa0428370-mRNA-1

Gene Sequence

>Msa0428370

ATGGCAATGACAACAATGGCTATGTTATTTCTTCATTTGAGTTTTTTTACCTTTAAAGTGTTTTGTTTCTCTTCTCATTCTCATGCAGACAAAATTGTTACCCTTCCTGGACAACCTCAAAACATAGCCTTTCAACAATTCTCAGGATATGTCACAGTTGATAACAAAAAACACAAGTCACTTTTTTACTATTTTGCTGAATCAGAAACTGATCCATCTTCAAAACCTCTTGTTCTTTGGCTCAATGGAGGACCTGGTTGTTCTTCTCTTGGAGTAGGTGCATTCTCAGAAAATGGACCATTTAGACCAAATGGTGAATTTCTTATTAAAAATGAACATAGTTGGAATAAAGAGGCAAACATGCTTTATTTGGAGACACCAGTTGGAGTTGGATTTTCTTATGTTAAAGGTAGTTCTGCTTATACAACAACAGTGAATGACGAGGAAACAGCAAGGGACAATCTTGTATTCCTGGAACGTTGGTTCAACAAGTTTCCTCAATATAGAAACAGAGATTTGTTTCTAACTGGGGAAAGTTATGCAGGTCATTATGTTCCTCAACTTGCAAAGCTTATGATTGAAATGAACAAAAGAAACAAGATATTCAATCTTAAAGGCATAGCTTTGGGGAATCCAGTTCTAGAATATGCAACTGATTTCAATTCAAGGGCTGAATTCTTTTGGTCACATGGACTAATATCAGATGCAACTTACAACATGTTCACTAGAGTGTGTAATTACTCTCGTTATGTAAGTGAGTACAATAGAGACTCAGTTTCACCTCTTTGTTCAAAGGTTATGGGATTGGTGAGTAAAGAAACTAGTAGATTTGTGGACAAATATGATGTCACACTTGATGTTTGCATTTCCTCTGTGCTGTCACAGTCCAAGGTTACAAACTACTTAAACAGGAGAGATGTGCAAGAGGCACTTCATGCAAAACTTGTTGGAGTTCGCAATGTCCTGGACTATGATGTGCTTAACTTGGAAGTGCCAACACTTCCTGTTGTTGGATCATTGATAAAAGCTGGAGTTAAGGTCCTAATTTACAGTGGAGATCAAGACTCGGTGATTCCACTGACTGGAAGCAGAAGCTTAGTTCAAAAATTGGCTAGACAATTAGGACTGAATACAACAGTTCCTTACAGAGTATGGTTTGAAGGCCAACAGGTTGGTGGGTGGACTCAAGTTTATGGCAATGTTCTCTCATTTGCCACAGTGAGAGGTGCTGCACATGAAGCTCCTTTCTCACAGCCTGAAAGATCACTCGTGCTATTCAAATCATTCTTGGAAGGAAGGCCTTTACCTGAAGTTTTCTGA

Protein sequence

>Msa0428370

MAMTTMAMLFLHLSFFTFKVFCFSSHSHADKIVTLPGQPQNIAFQQFSGYVTVDNKKHKSLFYYFAESETDPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEFLIKNEHSWNKEANMLYLETPVGVGFSYVKGSSAYTTTVNDEETARDNLVFLERWFNKFPQYRNRDLFLTGESYAGHYVPQLAKLMIEMNKRNKIFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDATYNMFTRVCNYSRYVSEYNRDSVSPLCSKVMGLVSKETSRFVDKYDVTLDVCISSVLSQSKVTNYLNRRDVQEALHAKLVGVRNVLDYDVLNLEVPTLPVVGSLIKAGVKVLIYSGDQDSVIPLTGSRSLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGNVLSFATVRGAAHEAPFSQPERSLVLFKSFLEGRPLPEVF*