AlfalfaGEDB | Msa0050700

M. sativa cultivar zhongmu-4 / Msa0050700

KEGG: -
GO: GO:0000325 GO:0000902 GO:0003674 GO:0005215 GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0005773 GO:0005774 GO:0005886 GO:0005887 GO:0005938 GO:0006521 GO:0006810 GO:0007154 GO:0007165 GO:0008150 GO:0009653 GO:0009705 GO:0009719 GO:0009725 GO:0009733 GO:0009734 GO:0009755 GO:0009826 GO:0009832 GO:0009834 GO:0009893 GO:0009914 GO:0009966 GO:0009987 GO:0010033 GO:0010315 GO:0010565 GO:0010646 GO:0010817 GO:0010928 GO:0016020 GO:0016021 GO:0016043 GO:0016049 GO:0019222 GO:0022857 GO:0023051 GO:0023052 GO:0031090 GO:0031224 GO:0031226 GO:0031323 GO:0031325 GO:0032350 GO:0032352 GO:0032502 GO:0032870 GO:0032989 GO:0033238 GO:0033240 GO:0040007 GO:0042221 GO:0042546 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044085 GO:0044422 GO:0044424 GO:0044425 GO:0044437 GO:0044444 GO:0044446 GO:0044459 GO:0044464 GO:0045764 GO:0048518 GO:0048522 GO:0048583 GO:0048589 GO:0048856 GO:0048869 GO:0050789 GO:0050794 GO:0050896 GO:0051171 GO:0051173 GO:0051179 GO:0051234 GO:0051716 GO:0055085 GO:0060560 GO:0060918 GO:0062012 GO:0062013 GO:0065007 GO:0065008 GO:0070887 GO:0071310 GO:0071365 GO:0071495 GO:0071554 GO:0071669 GO:0071840 GO:0071944 GO:0080090 GO:0090354 GO:0090355 GO:0090357 GO:0090358 GO:0098588 GO:0098805 GO:0099568
PFAM: PF00892.23

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050700	sp\|Q94AP3\|WAT1_ARATH	74.687	399	87	7	1	395	1	389	0.0	589

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050700	G7I5V7	96.774	403	2	5	1	395	1	400	0.0	769

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0000050	Msa0050700	0.805932	1.051527e-49	-8.615850e-47
Msa0002580	Msa0050700	0.836994	6.753402e-57	-8.615850e-47
Msa0003080	Msa0050700	0.903012	5.380674e-79	-8.615850e-47
Msa0005890	Msa0050700	0.804562	2.035537e-49	-8.615850e-47
Msa0008040	Msa0050700	0.858235	9.465681e-63	-8.615850e-47
Msa0015150	Msa0050700	0.838431	2.887907e-57	-8.615850e-47
Msa0016040	Msa0050700	0.816167	6.357683e-52	-8.615850e-47
Msa0017670	Msa0050700	0.845010	5.302802e-59	-8.615850e-47
Msa0019900	Msa0050700	0.813116	3.012242e-51	-8.615850e-47
Msa0025160	Msa0050700	0.891816	2.811338e-74	-8.615850e-47
Msa0025580	Msa0050700	0.873595	1.302137e-67	-8.615850e-47
Msa0027280	Msa0050700	0.841258	5.299476e-58	-8.615850e-47
Msa0029960	Msa0050700	0.833456	5.276796e-56	-8.615850e-47
Msa0029970	Msa0050700	0.816372	5.722565e-52	-8.615850e-47
Msa0032460	Msa0050700	0.819797	9.615348e-53	-8.615850e-47
Msa0032980	Msa0050700	0.808332	3.262376e-50	-8.615850e-47
Msa0034210	Msa0050700	0.883425	4.538201e-71	-8.615850e-47
Msa0035270	Msa0050700	0.826809	2.213163e-54	-8.615850e-47
Msa0035340	Msa0050700	0.851974	6.254723e-61	-8.615850e-47
Msa0035380	Msa0050700	0.846190	2.537424e-59	-8.615850e-47
Msa0042640	Msa0050700	0.830203	3.351000e-55	-8.615850e-47
Msa0048510	Msa0050700	0.846744	1.792084e-59	-8.615850e-47
Msa0050660	Msa0050700	0.998795	6.577444e-277	-8.615850e-47
Msa0050700	Msa0050790	0.990794	2.329434e-184	-8.615850e-47
Msa0050700	Msa0053070	0.810469	1.135169e-50	-8.615850e-47
Msa0050700	Msa0054690	0.834600	2.728542e-56	-8.615850e-47
Msa0050700	Msa0057540	0.820605	6.279339e-53	-8.615850e-47
Msa0050700	Msa0062340	0.801403	9.153447e-49	-8.615850e-47
Msa0050700	Msa0064120	0.803738	3.020536e-49	-8.615850e-47
Msa0050700	Msa0067060	0.800267	1.561656e-48	-8.615850e-47
Msa0050700	Msa0067330	0.828325	9.570715e-55	-8.615850e-47
Msa0050700	Msa0068150	0.802610	5.170985e-49	-8.615850e-47
Msa0050700	Msa0071850	0.845798	3.244216e-59	-8.615850e-47
Msa0050700	Msa0071860	0.854052	1.591352e-61	-8.615850e-47
Msa0050700	Msa0071880	0.829842	4.105474e-55	-8.615850e-47
Msa0050700	Msa0072520	0.871224	8.040071e-67	-8.615850e-47
Msa0050700	Msa0073120	0.854063	1.579005e-61	-8.615850e-47
Msa0050700	Msa0074020	0.803896	2.800572e-49	-8.615850e-47
Msa0050700	Msa0077340	0.814484	1.504590e-51	-8.615850e-47
Msa0050700	Msa0077560	0.830170	3.415563e-55	-8.615850e-47
Msa0050700	Msa0090400	0.846515	2.069940e-59	-8.615850e-47
Msa0050700	Msa0093860	0.816415	5.595388e-52	-8.615850e-47
Msa0050700	Msa0094780	0.825481	4.580050e-54	-8.615850e-47
Msa0050700	Msa0094790	0.846041	2.786898e-59	-8.615850e-47
Msa0050700	Msa0098040	0.833291	5.804031e-56	-8.615850e-47
Msa0050700	Msa0098410	0.801987	6.947178e-49	-8.615850e-47
Msa0050700	Msa0108880	0.871373	7.178675e-67	-8.615850e-47
Msa0050700	Msa0113340	0.830228	3.305886e-55	-8.615850e-47
Msa0050700	Msa0115550	0.827460	1.545505e-54	-8.615850e-47
Msa0050700	Msa0120790	0.834741	2.514608e-56	-8.615850e-47
Msa0050700	Msa0121330	0.858162	9.957580e-63	-8.615850e-47
Msa0050700	Msa0122330	0.827597	1.432485e-54	-8.615850e-47
Msa0050700	Msa0123070	0.833450	5.295389e-56	-8.615850e-47
Msa0050700	Msa0125200	0.834239	3.362952e-56	-8.615850e-47
Msa0050700	Msa0125210	0.843367	1.463692e-58	-8.615850e-47
Msa0050700	Msa0125360	0.818583	1.817099e-52	-8.615850e-47
Msa0050700	Msa0126210	0.813373	2.645206e-51	-8.615850e-47
Msa0050700	Msa0128310	0.880057	7.507782e-70	-8.615850e-47
Msa0050700	Msa0136650	0.825387	4.820148e-54	-8.615850e-47
Msa0050700	Msa0137880	0.838021	3.682947e-57	-8.615850e-47
Msa0050700	Msa0140130	0.839221	1.803832e-57	-8.615850e-47
Msa0050700	Msa0140280	0.879262	1.438826e-69	-8.615850e-47
Msa0050700	Msa0140380	0.817624	2.993641e-52	-8.615850e-47
Msa0050700	Msa0143670	0.818753	1.663008e-52	-8.615850e-47
Msa0050700	Msa0146650	0.912014	3.163165e-83	-8.615850e-47
Msa0050700	Msa0149350	0.874343	7.272221e-68	-8.615850e-47
Msa0050700	Msa0158860	0.835865	1.307965e-56	-8.615850e-47
Msa0050700	Msa0161930	0.867424	1.382354e-65	-8.615850e-47
Msa0050700	Msa0166170	0.837332	5.532901e-57	-8.615850e-47
Msa0050700	Msa0174440	0.877682	5.167096e-69	-8.615850e-47
Msa0050700	Msa0174450	0.830823	2.363473e-55	-8.615850e-47
Msa0050700	Msa0176060	0.849776	2.603096e-60	-8.615850e-47
Msa0050700	Msa0178450	0.806743	7.091794e-50	-8.615850e-47
Msa0050700	Msa0182240	0.806297	8.806906e-50	-8.615850e-47
Msa0050700	Msa0188610	0.865427	5.951569e-65	-8.615850e-47
Msa0050700	Msa0190570	0.853300	2.617492e-61	-8.615850e-47
Msa0050700	Msa0190730	0.810861	9.338069e-51	-8.615850e-47
Msa0050700	Msa0200050	0.843414	1.422262e-58	-8.615850e-47
Msa0050700	Msa0209980	0.803980	2.690053e-49	-8.615850e-47
Msa0050700	Msa0213030	0.835838	1.329284e-56	-8.615850e-47
Msa0050700	Msa0213610	0.821186	4.614689e-53	-8.615850e-47
Msa0050700	Msa0222560	0.808752	2.653488e-50	-8.615850e-47
Msa0050700	Msa0225100	0.816546	5.231468e-52	-8.615850e-47
Msa0050700	Msa0225860	0.829648	4.577662e-55	-8.615850e-47
Msa0050700	Msa0230780	0.815137	1.078345e-51	-8.615850e-47
Msa0050700	Msa0230800	0.868156	8.047086e-66	-8.615850e-47
Msa0050700	Msa0230840	0.825343	4.935410e-54	-8.615850e-47
Msa0050700	Msa0230870	0.873309	1.624726e-67	-8.615850e-47
Msa0050700	Msa0232760	0.843129	1.694352e-58	-8.615850e-47
Msa0050700	Msa0233020	0.819019	1.447113e-52	-8.615850e-47
Msa0050700	Msa0242590	0.838685	2.482954e-57	-8.615850e-47
Msa0050700	Msa0244640	0.802127	6.499809e-49	-8.615850e-47
Msa0050700	Msa0260510	0.811870	5.640226e-51	-8.615850e-47
Msa0050700	Msa0267110	0.819682	1.021725e-52	-8.615850e-47
Msa0050700	Msa0270340	0.854678	1.048935e-61	-8.615850e-47
Msa0050700	Msa0272260	0.827733	1.329416e-54	-8.615850e-47
Msa0050700	Msa0280790	0.839130	1.904296e-57	-8.615850e-47
Msa0050700	Msa0284800	0.850390	1.751380e-60	-8.615850e-47
Msa0050700	Msa0287740	0.817155	3.818002e-52	-8.615850e-47
Msa0050700	Msa0292160	0.812651	3.808432e-51	-8.615850e-47
Msa0050700	Msa0293040	0.818498	1.899987e-52	-8.615850e-47
Msa0050700	Msa0298470	0.838109	3.494751e-57	-8.615850e-47
Msa0050700	Msa0301820	0.801213	1.001142e-48	-8.615850e-47
Msa0050700	Msa0307270	0.825763	3.926529e-54	-8.615850e-47
Msa0050700	Msa0307670	0.849695	2.740769e-60	-8.615850e-47
Msa0050700	Msa0330520	0.850986	1.190275e-60	-8.615850e-47
Msa0050700	Msa0340500	0.803585	3.250332e-49	-8.615850e-47
Msa0050700	Msa0347530	0.806181	9.318360e-50	-8.615850e-47
Msa0050700	Msa0365210	0.813883	2.042618e-51	-8.615850e-47
Msa0050700	Msa0367520	0.850056	2.172998e-60	-8.615850e-47
Msa0050700	Msa0367690	0.856761	2.585824e-62	-8.615850e-47
Msa0050700	Msa0368860	0.817324	3.497917e-52	-8.615850e-47
Msa0050700	Msa0369790	0.848494	5.913327e-60	-8.615850e-47
Msa0050700	Msa0371270	0.811542	6.644919e-51	-8.615850e-47
Msa0050700	Msa0375640	0.803472	3.430546e-49	-8.615850e-47
Msa0050700	Msa0380620	0.824492	7.840243e-54	-8.615850e-47
Msa0050700	Msa0380670	0.884114	2.526871e-71	-8.615850e-47
Msa0050700	Msa0381730	0.829336	5.449092e-55	-8.615850e-47
Msa0050700	Msa0382390	0.825698	4.067027e-54	-8.615850e-47
Msa0050700	Msa0382740	0.824434	8.088788e-54	-8.615850e-47
Msa0050700	Msa0382770	0.832383	9.752376e-56	-8.615850e-47
Msa0050700	Msa0383000	0.823317	1.478625e-53	-8.615850e-47
Msa0050700	Msa0384870	0.855346	6.709338e-62	-8.615850e-47
Msa0050700	Msa0389950	0.824875	6.368394e-54	-8.615850e-47
Msa0050700	Msa0390970	0.828555	8.423461e-55	-8.615850e-47
Msa0050700	Msa0400000	0.828473	8.816420e-55	-8.615850e-47
Msa0050700	Msa0400950	0.817673	2.918257e-52	-8.615850e-47
Msa0050700	Msa0405680	0.805882	1.077117e-49	-8.615850e-47
Msa0050700	Msa0415140	0.800781	1.226869e-48	-8.615850e-47
Msa0050700	Msa0415450	0.843005	1.828294e-58	-8.615850e-47
Msa0050700	Msa0416160	0.809889	1.513844e-50	-8.615850e-47
Msa0050700	Msa0419540	0.831830	1.336676e-55	-8.615850e-47
Msa0050700	Msa0422050	0.817061	4.008613e-52	-8.615850e-47
Msa0050700	Msa0424160	0.806667	7.359953e-50	-8.615850e-47
Msa0050700	Msa0426530	0.862439	5.063375e-64	-8.615850e-47
Msa0050700	Msa0428370	0.815973	7.026055e-52	-8.615850e-47
Msa0050700	Msa0430260	0.826131	3.210551e-54	-8.615850e-47
Msa0050700	Msa0430300	0.870532	1.359355e-66	-8.615850e-47
Msa0050700	Msa0430480	0.816145	6.431367e-52	-8.615850e-47
Msa0050700	Msa0431200	0.841058	5.980784e-58	-8.615850e-47
Msa0050700	Msa0432010	0.856465	3.158337e-62	-8.615850e-47
Msa0050700	Msa0432140	0.824377	8.342235e-54	-8.615850e-47
Msa0050700	Msa0433150	0.825914	3.614687e-54	-8.615850e-47
Msa0050700	Msa0435210	0.868447	6.487144e-66	-8.615850e-47
Msa0050700	Msa0436910	0.843232	1.590314e-58	-8.615850e-47
Msa0050700	Msa0443410	0.808838	2.543873e-50	-8.615850e-47
Msa0050700	Msa0447750	0.815946	7.122547e-52	-8.615850e-47
Msa0050700	Msa0457570	0.837277	5.714795e-57	-8.615850e-47
Msa0050700	Msa0460070	0.837548	4.870933e-57	-8.615850e-47
Msa0050700	Msa0462780	0.808937	2.422697e-50	-8.615850e-47
Msa0050700	Msa0464000	0.847719	9.679890e-60	-8.615850e-47
Msa0050700	Msa0465530	0.827951	1.177896e-54	-8.615850e-47
Msa0050700	Msa0466520	0.815028	1.140407e-51	-8.615850e-47
Msa0050700	Msa0466880	0.812794	3.543937e-51	-8.615850e-47
Msa0050700	Msa0472950	0.873038	2.002818e-67	-8.615850e-47
Msa0050700	Msa0474730	0.805248	1.463236e-49	-8.615850e-47
Msa0050700	Msa0476280	0.827307	1.681407e-54	-8.615850e-47
Msa0050700	Msa0476650	0.806206	9.206656e-50	-8.615850e-47
Msa0050700	Msa0479320	0.865889	4.256489e-65	-8.615850e-47
Msa0050700	Msa0481890	0.843893	1.058696e-58	-8.615850e-47
Msa0050700	Msa0482080	0.831558	1.559389e-55	-8.615850e-47
Msa0050700	Msa0484570	0.823443	1.381724e-53	-8.615850e-47
Msa0050700	Msa0500380	0.806153	9.447089e-50	-8.615850e-47
Msa0050700	Msa0509550	0.843516	1.335796e-58	-8.615850e-47
Msa0050700	Msa0511470	0.815990	6.965385e-52	-8.615850e-47
Msa0050700	Msa0513080	0.806195	9.254956e-50	-8.615850e-47
Msa0050700	Msa0517250	0.895076	1.350239e-75	-8.615850e-47
Msa0050700	Msa0519750	0.806959	6.385188e-50	-8.615850e-47
Msa0050700	Msa0519830	0.809215	2.112457e-50	-8.615850e-47
Msa0050700	Msa0520260	0.843640	1.237130e-58	-8.615850e-47
Msa0050700	Msa0520870	0.844207	8.723649e-59	-8.615850e-47
Msa0050700	Msa0520990	0.835633	1.497873e-56	-8.615850e-47
Msa0050700	Msa0524520	0.822014	2.971302e-53	-8.615850e-47
Msa0050700	Msa0524800	0.803403	3.544670e-49	-8.615850e-47
Msa0050700	Msa0525000	0.827073	1.913035e-54	-8.615850e-47
Msa0050700	Msa0528570	0.897782	1.006627e-76	-8.615850e-47
Msa0050700	Msa0529030	0.852936	3.328738e-61	-8.615850e-47
Msa0050700	Msa0530780	0.830524	2.798055e-55	-8.615850e-47
Msa0050700	Msa0531960	0.840247	9.754873e-58	-8.615850e-47
Msa0050700	Msa0532050	0.805653	1.202962e-49	-8.615850e-47
Msa0050700	Msa0541300	0.902089	1.384295e-78	-8.615850e-47
Msa0050700	Msa0541310	0.899250	2.387745e-77	-8.615850e-47
Msa0050700	Msa0543660	0.814154	1.780148e-51	-8.615850e-47
Msa0050700	Msa0548470	0.872584	2.843305e-67	-8.615850e-47
Msa0050700	Msa0549370	0.811614	6.409870e-51	-8.615850e-47
Msa0050700	Msa0550050	0.830159	3.436239e-55	-8.615850e-47
Msa0050700	Msa0553750	0.808886	2.484902e-50	-8.615850e-47
Msa0050700	Msa0557290	0.802237	6.172535e-49	-8.615850e-47
Msa0050700	Msa0557370	0.822099	2.838666e-53	-8.615850e-47
Msa0050700	Msa0557460	0.876978	9.078640e-69	-8.615850e-47
Msa0050700	Msa0562350	0.859316	4.498997e-63	-8.615850e-47
Msa0050700	Msa0563740	0.814415	1.558919e-51	-8.615850e-47
Msa0050700	Msa0563940	0.829592	4.721705e-55	-8.615850e-47
Msa0050700	Msa0567170	0.838076	3.564475e-57	-8.615850e-47
Msa0050700	Msa0570010	0.842256	2.889901e-58	-8.615850e-47
Msa0050700	Msa0571290	0.822679	2.082275e-53	-8.615850e-47
Msa0050700	Msa0571620	0.818370	2.030923e-52	-8.615850e-47
Msa0050700	Msa0573810	0.830553	2.752882e-55	-8.615850e-47
Msa0050700	Msa0574300	0.801930	7.136992e-49	-8.615850e-47
Msa0050700	Msa0580200	0.810513	1.110728e-50	-8.615850e-47
Msa0050700	Msa0580370	0.840194	1.007028e-57	-8.615850e-47
Msa0050700	Msa0580810	0.831121	1.997089e-55	-8.615850e-47
Msa0050700	Msa0584420	0.828092	1.089300e-54	-8.615850e-47
Msa0050700	Msa0585020	0.892250	1.887663e-74	-8.615850e-47
Msa0050700	Msa0587620	0.845298	4.432092e-59	-8.615850e-47
Msa0050700	Msa0588920	0.805855	1.091131e-49	-8.615850e-47
Msa0050700	Msa0590200	0.826489	2.637241e-54	-8.615850e-47
Msa0050700	Msa0591170	0.822529	2.255865e-53	-8.615850e-47
Msa0050700	Msa0597270	0.895572	8.438085e-76	-8.615850e-47
Msa0050700	Msa0602430	0.801792	7.619398e-49	-8.615850e-47
Msa0050700	Msa0605560	0.832666	8.300321e-56	-8.615850e-47
Msa0050700	Msa0606100	0.819961	8.819734e-53	-8.615850e-47
Msa0050700	Msa0607800	0.828105	1.081319e-54	-8.615850e-47
Msa0050700	Msa0609650	0.805382	1.371220e-49	-8.615850e-47
Msa0050700	Msa0616210	0.874558	6.149745e-68	-8.615850e-47
Msa0050700	Msa0619710	0.826606	2.473648e-54	-8.615850e-47
Msa0050700	Msa0620980	0.800156	1.645014e-48	-8.615850e-47
Msa0050700	Msa0621710	0.859684	3.488928e-63	-8.615850e-47
Msa0050700	Msa0640200	0.810141	1.336194e-50	-8.615850e-47
Msa0050700	Msa0644410	0.877027	8.731669e-69	-8.615850e-47
Msa0050700	Msa0646510	0.809023	2.321931e-50	-8.615850e-47
Msa0050700	Msa0647050	0.805076	1.589775e-49	-8.615850e-47
Msa0050700	Msa0648040	0.809669	1.687546e-50	-8.615850e-47
Msa0050700	Msa0652650	0.815012	1.149546e-51	-8.615850e-47
Msa0050700	Msa0655700	0.884077	2.608591e-71	-8.615850e-47
Msa0050700	Msa0657440	0.831622	1.503598e-55	-8.615850e-47
Msa0050700	Msa0657700	0.829384	5.305735e-55	-8.615850e-47
Msa0050700	Msa0658640	0.833883	4.129536e-56	-8.615850e-47
Msa0050700	Msa0661150	0.839749	1.315568e-57	-8.615850e-47
Msa0050700	Msa0662110	0.815960	7.072604e-52	-8.615850e-47
Msa0050700	Msa0665620	0.827890	1.218299e-54	-8.615850e-47
Msa0050700	Msa0666700	0.842335	2.753947e-58	-8.615850e-47
Msa0050700	Msa0668900	0.819306	1.244930e-52	-8.615850e-47
Msa0050700	Msa0670100	0.810505	1.114879e-50	-8.615850e-47
Msa0050700	Msa0675330	0.895040	1.397770e-75	-8.615850e-47
Msa0050700	Msa0678490	0.813057	3.103790e-51	-8.615850e-47
Msa0050700	Msa0682770	0.817870	2.635555e-52	-8.615850e-47
Msa0050700	Msa0684220	0.822433	2.375042e-53	-8.615850e-47
Msa0050700	Msa0687090	0.859908	2.985773e-63	-8.615850e-47
Msa0050700	Msa0690740	0.804070	2.576551e-49	-8.615850e-47
Msa0050700	Msa0693890	0.835577	1.547865e-56	-8.615850e-47
Msa0050700	Msa0698730	0.800751	1.243987e-48	-8.615850e-47
Msa0050700	Msa0699540	0.878879	1.964886e-69	-8.615850e-47
Msa0050700	Msa0700460	0.850170	2.019096e-60	-8.615850e-47
Msa0050700	Msa0701720	0.835619	1.509684e-56	-8.615850e-47
Msa0050700	Msa0702810	0.823237	1.543074e-53	-8.615850e-47
Msa0050700	Msa0703600	0.828372	9.323766e-55	-8.615850e-47
Msa0050700	Msa0706150	0.837750	4.323909e-57	-8.615850e-47
Msa0050700	Msa0707670	0.809782	1.596390e-50	-8.615850e-47
Msa0050700	Msa0709200	0.827628	1.408567e-54	-8.615850e-47
Msa0050700	Msa0709440	0.845443	4.048404e-59	-8.615850e-47
Msa0050700	Msa0709630	0.806160	9.411517e-50	-8.615850e-47
Msa0050700	Msa0713700	0.841559	4.414654e-58	-8.615850e-47
Msa0050700	Msa0713960	0.804469	2.127993e-49	-8.615850e-47
Msa0050700	Msa0714520	0.834879	2.321262e-56	-8.615850e-47
Msa0050700	Msa0716480	0.806613	7.554099e-50	-8.615850e-47
Msa0050700	Msa0720410	0.858561	7.570237e-63	-8.615850e-47
Msa0050700	Msa0722220	0.843161	1.661422e-58	-8.615850e-47
Msa0050700	Msa0723090	0.812015	5.243947e-51	-8.615850e-47
Msa0050700	Msa0724800	0.804187	2.436765e-49	-8.615850e-47
Msa0050700	Msa0725750	0.826213	3.068586e-54	-8.615850e-47
Msa0050700	Msa0735780	0.847063	1.465191e-59	-8.615850e-47
Msa0050700	Msa0736890	0.814611	1.410668e-51	-8.615850e-47
Msa0050700	Msa0737990	0.828489	8.737083e-55	-8.615850e-47
Msa0050700	Msa0738700	0.879353	1.335725e-69	-8.615850e-47
Msa0050700	Msa0740710	0.806114	9.624361e-50	-8.615850e-47
Msa0050700	Msa0741220	0.845719	3.408785e-59	-8.615850e-47
Msa0050700	Msa0743440	0.846189	2.539883e-59	-8.615850e-47
Msa0050700	Msa0745720	0.810414	1.166404e-50	-8.615850e-47
Msa0050700	Msa0747000	0.808722	2.693287e-50	-8.615850e-47
Msa0050700	Msa0747740	0.811051	8.492837e-51	-8.615850e-47
Msa0050700	Msa0755930	0.831257	1.849408e-55	-8.615850e-47
Msa0050700	Msa0756490	0.873570	1.327025e-67	-8.615850e-47
Msa0050700	Msa0758650	0.835228	1.895515e-56	-8.615850e-47
Msa0050700	Msa0760970	0.852655	4.003631e-61	-8.615850e-47
Msa0050700	Msa0761670	0.848876	4.633115e-60	-8.615850e-47
Msa0050700	Msa0763550	0.808263	3.374422e-50	-8.615850e-47
Msa0050700	Msa0773630	0.841734	3.970757e-58	-8.615850e-47
Msa0050700	Msa0773670	0.808563	2.912300e-50	-8.615850e-47
Msa0050700	Msa0778550	0.855693	5.314506e-62	-8.615850e-47
Msa0050700	Msa0780910	0.821434	4.047054e-53	-8.615850e-47
Msa0050700	Msa0783930	0.805689	1.182371e-49	-8.615850e-47
Msa0050700	Msa0792370	0.859543	3.847059e-63	-8.615850e-47
Msa0050700	Msa0795870	0.839313	1.707141e-57	-8.615850e-47
Msa0050700	Msa0803250	0.832232	1.063142e-55	-8.615850e-47
Msa0050700	Msa0805680	0.841926	3.532090e-58	-8.615850e-47
Msa0050700	Msa0811020	0.818313	2.092174e-52	-8.615850e-47
Msa0050700	Msa0815920	0.832194	1.086313e-55	-8.615850e-47
Msa0050700	Msa0818880	0.803640	3.165724e-49	-8.615850e-47
Msa0050700	Msa0819170	0.831505	1.607446e-55	-8.615850e-47
Msa0050700	Msa0821160	0.811664	6.251957e-51	-8.615850e-47
Msa0050700	Msa0824450	0.841091	5.864605e-58	-8.615850e-47
Msa0050700	Msa0828970	0.828388	9.241161e-55	-8.615850e-47
Msa0050700	Msa0833650	0.832219	1.070768e-55	-8.615850e-47
Msa0050700	Msa0835160	0.811790	5.869902e-51	-8.615850e-47
Msa0050700	Msa0835350	0.809798	1.583584e-50	-8.615850e-47
Msa0050700	Msa0835490	0.853544	2.227120e-61	-8.615850e-47
Msa0050700	Msa0837460	0.808789	2.605834e-50	-8.615850e-47
Msa0050700	Msa0841590	0.853771	1.916968e-61	-8.615850e-47
Msa0050700	Msa0843050	0.852931	3.339234e-61	-8.615850e-47
Msa0050700	Msa0859290	0.876336	1.514485e-68	-8.615850e-47
Msa0050700	Msa0863620	0.842958	1.881404e-58	-8.615850e-47
Msa0050700	Msa0867110	0.812599	3.909387e-51	-8.615850e-47
Msa0050700	Msa0876940	0.810706	1.008734e-50	-8.615850e-47
Msa0050700	Msa0888790	0.807078	6.026175e-50	-8.615850e-47
Msa0050700	Msa0894790	0.807765	4.307409e-50	-8.615850e-47
Msa0050700	Msa0905240	0.816379	5.701776e-52	-8.615850e-47
Msa0050700	Msa0909760	0.824239	8.987566e-54	-8.615850e-47
Msa0050700	Msa0915520	0.815843	7.511198e-52	-8.615850e-47
Msa0050700	Msa0921590	0.819148	1.352557e-52	-8.615850e-47
Msa0050700	Msa0931590	0.843549	1.308863e-58	-8.615850e-47
Msa0050700	Msa0956350	0.814692	1.353754e-51	-8.615850e-47
Msa0050700	Msa0966320	0.827302	1.686416e-54	-8.615850e-47
Msa0050700	Msa0966480	0.827744	1.320737e-54	-8.615850e-47
Msa0050700	Msa0967870	0.804169	2.457030e-49	-8.615850e-47
Msa0050700	Msa0974520	0.816032	6.816589e-52	-8.615850e-47
Msa0050700	Msa0980290	0.802267	6.083981e-49	-8.615850e-47
Msa0050700	Msa0981320	0.835468	1.649121e-56	-8.615850e-47
Msa0050700	Msa0989500	0.825848	3.747635e-54	-8.615850e-47
Msa0050700	Msa1009950	0.871718	5.518984e-67	-8.615850e-47
Msa0050700	Msa1014320	0.802740	4.860231e-49	-8.615850e-47
Msa0050700	Msa1020480	0.823633	1.247066e-53	-8.615850e-47
Msa0050700	Msa1021590	0.872852	2.312131e-67	-8.615850e-47
Msa0050700	Msa1029530	0.827438	1.564174e-54	-8.615850e-47
Msa0050700	Msa1029800	0.826419	2.740657e-54	-8.615850e-47
Msa0050700	Msa1033920	0.807164	5.777762e-50	-8.615850e-47
Msa0050700	Msa1034600	0.819126	1.367979e-52	-8.615850e-47
Msa0050700	Msa1035220	0.807447	5.032266e-50	-8.615850e-47
Msa0050700	Msa1035570	0.838389	2.959793e-57	-8.615850e-47
Msa0050700	Msa1035610	0.846174	2.563361e-59	-8.615850e-47
Msa0050700	Msa1037540	0.803801	2.930470e-49	-8.615850e-47
Msa0050700	Msa1039220	0.832073	1.164105e-55	-8.615850e-47
Msa0050700	Msa1042160	0.918387	1.658812e-86	-8.615850e-47
Msa0050700	Msa1042190	0.919358	4.972212e-87	-8.615850e-47
Msa0050700	Msa1042880	0.805493	1.299826e-49	-8.615850e-47
Msa0050700	Msa1044680	0.854109	1.531697e-61	-8.615850e-47
Msa0050700	Msa1049280	0.809068	2.271039e-50	-8.615850e-47
Msa0050700	Msa1051420	0.823327	1.470377e-53	-8.615850e-47
Msa0050700	Msa1051900	0.813679	2.265815e-51	-8.615850e-47
Msa0050700	Msa1059020	0.844293	8.270715e-59	-8.615850e-47
Msa0050700	Msa1068400	0.803592	3.238381e-49	-8.615850e-47
Msa0050700	Msa1068920	0.821414	4.089055e-53	-8.615850e-47
Msa0050700	Msa1072940	0.841836	3.731558e-58	-8.615850e-47
Msa0050700	Msa1074370	0.805896	1.069523e-49	-8.615850e-47
Msa0050700	Msa1074600	0.846898	1.625828e-59	-8.615850e-47
Msa0050700	Msa1074860	0.804743	1.865389e-49	-8.615850e-47
Msa0050700	Msa1078820	0.861660	8.776127e-64	-8.615850e-47
Msa0050700	Msa1078880	0.853267	2.675012e-61	-8.615850e-47
Msa0050700	Msa1078970	0.858774	6.537894e-63	-8.615850e-47
Msa0050700	Msa1080000	0.857343	1.741280e-62	-8.615850e-47
Msa0050700	Msa1081390	0.841287	5.206780e-58	-8.615850e-47
Msa0050700	Msa1081690	0.870659	1.234836e-66	-8.615850e-47
Msa0050700	Msa1082200	0.818299	2.107090e-52	-8.615850e-47
Msa0050700	Msa1084530	0.847883	8.725114e-60	-8.615850e-47
Msa0050700	Msa1090140	0.803040	4.215058e-49	-8.615850e-47
Msa0050700	Msa1094010	0.801493	8.775235e-49	-8.615850e-47
Msa0050700	Msa1096960	0.806533	7.853294e-50	-8.615850e-47
Msa0050700	Msa1104220	0.817840	2.676607e-52	-8.615850e-47
Msa0050700	Msa1105640	0.864142	1.503627e-64	-8.615850e-47
Msa0050700	Msa1105780	0.817367	3.421840e-52	-8.615850e-47
Msa0050700	Msa1116220	0.849893	2.413433e-60	-8.615850e-47
Msa0050700	Msa1116660	0.844860	5.817494e-59	-8.615850e-47
Msa0050700	Msa1116740	0.803750	3.003612e-49	-8.615850e-47
Msa0050700	Msa1121310	0.814930	1.198644e-51	-8.615850e-47
Msa0050700	Msa1123210	0.849941	2.339605e-60	-8.615850e-47
Msa0050700	Msa1123970	0.866784	2.213563e-65	-8.615850e-47
Msa0050700	Msa1125250	0.810927	9.035810e-51	-8.615850e-47
Msa0050700	Msa1125820	0.853075	3.035705e-61	-8.615850e-47
Msa0050700	Msa1125990	0.852173	5.492407e-61	-8.615850e-47
Msa0050700	Msa1127470	0.801419	9.087022e-49	-8.615850e-47
Msa0050700	Msa1132530	0.846159	2.586790e-59	-8.615850e-47
Msa0050700	Msa1132840	0.836773	7.689827e-57	-8.615850e-47
Msa0050700	Msa1148960	0.847221	1.326029e-59	-8.615850e-47
Msa0050700	Msa1156520	0.815713	8.028809e-52	-8.615850e-47
Msa0050700	Msa1160920	0.831003	2.134748e-55	-8.615850e-47
Msa0050700	Msa1162180	0.833668	4.671375e-56	-8.615850e-47
Msa0050700	Msa1162880	0.817748	2.807812e-52	-8.615850e-47
Msa0050700	Msa1166190	0.848611	5.489908e-60	-8.615850e-47
Msa0050700	Msa1166290	0.842136	3.109724e-58	-8.615850e-47
Msa0050700	Msa1167470	0.908062	2.576413e-81	-8.615850e-47
Msa0050700	Msa1169190	0.850921	1.241694e-60	-8.615850e-47
Msa0050700	Msa1169650	0.860420	2.091952e-63	-8.615850e-47
Msa0050700	Msa1171290	0.838084	3.548308e-57	-8.615850e-47
Msa0050700	Msa1176260	0.810637	1.044061e-50	-8.615850e-47
Msa0050700	Msa1187760	0.814425	1.550657e-51	-8.615850e-47
Msa0050700	Msa1192560	0.840457	8.595750e-58	-8.615850e-47
Msa0050700	Msa1192570	0.811994	5.298109e-51	-8.615850e-47
Msa0050700	Msa1192590	0.841491	4.600192e-58	-8.615850e-47
Msa0050700	Msa1194240	0.829634	4.611974e-55	-8.615850e-47
Msa0050700	Msa1198540	0.802420	5.657397e-49	-8.615850e-47
Msa0050700	Msa1200890	0.804712	1.893526e-49	-8.615850e-47
Msa0050700	Msa1203300	0.825933	3.577551e-54	-8.615850e-47
Msa0050700	Msa1208950	0.841558	4.417163e-58	-8.615850e-47
Msa0050700	Msa1209320	0.814609	1.411785e-51	-8.615850e-47
Msa0050700	Msa1209720	0.809628	1.722316e-50	-8.615850e-47
Msa0050700	Msa1211240	0.817544	3.120880e-52	-8.615850e-47
Msa0050700	Msa1211640	0.800344	1.506182e-48	-8.615850e-47
Msa0050700	Msa1213830	0.818886	1.551008e-52	-8.615850e-47
Msa0050700	Msa1214350	0.833535	5.044378e-56	-8.615850e-47
Msa0050700	Msa1215870	0.842248	2.903583e-58	-8.615850e-47
Msa0050700	Msa1216090	0.801019	1.097115e-48	-8.615850e-47
Msa0050700	Msa1216110	0.830551	2.755424e-55	-8.615850e-47
Msa0050700	Msa1217230	0.845885	3.071091e-59	-8.615850e-47
Msa0050700	Msa1218820	0.804295	2.313195e-49	-8.615850e-47
Msa0050700	Msa1223390	0.814406	1.566147e-51	-8.615850e-47
Msa0050700	Msa1223570	0.824992	5.974532e-54	-8.615850e-47
Msa0050700	Msa1226520	0.836081	1.153412e-56	-8.615850e-47
Msa0050700	Msa1228580	0.803392	3.563875e-49	-8.615850e-47
Msa0050700	Msa1228630	0.836040	1.181031e-56	-8.615850e-47
Msa0050700	Msa1231700	0.824695	7.023529e-54	-8.615850e-47
Msa0050700	Msa1240770	0.846450	2.155270e-59	-8.615850e-47
Msa0050700	Msa1244240	0.819840	9.403834e-53	-8.615850e-47
Msa0050700	Msa1254540	0.839223	1.802234e-57	-8.615850e-47
Msa0050700	Msa1261050	0.820902	5.365246e-53	-8.615850e-47
Msa0050700	Msa1262570	0.816435	5.539255e-52	-8.615850e-47
Msa0050700	Msa1263490	0.803561	3.286540e-49	-8.615850e-47
Msa0050700	Msa1263740	0.828536	8.511767e-55	-8.615850e-47
Msa0050700	Msa1263780	0.860985	1.409797e-63	-8.615850e-47
Msa0050700	Msa1265650	0.835880	1.296634e-56	-8.615850e-47
Msa0050700	Msa1268630	0.825921	3.601286e-54	-8.615850e-47
Msa0050700	Msa1277640	0.866902	2.030125e-65	-8.615850e-47
Msa0050700	Msa1282260	0.826336	2.868633e-54	-8.615850e-47
Msa0050700	Msa1290380	0.803384	3.577404e-49	-8.615850e-47
Msa0050700	Msa1292840	0.815302	9.911428e-52	-8.615850e-47
Msa0050700	Msa1294460	0.807969	3.898166e-50	-8.615850e-47
Msa0050700	Msa1296950	0.821429	4.057524e-53	-8.615850e-47
Msa0050700	Msa1298220	0.800743	1.249076e-48	-8.615850e-47
Msa0050700	Msa1300460	0.834956	2.220546e-56	-8.615850e-47
Msa0050700	Msa1303560	0.830912	2.248076e-55	-8.615850e-47
Msa0050700	Msa1303650	0.837479	5.074280e-57	-8.615850e-47
Msa0050700	Msa1308850	0.820296	7.392469e-53	-8.615850e-47
Msa0050700	Msa1315130	0.812103	5.015781e-51	-8.615850e-47
Msa0050700	Msa1315160	0.849838	2.500645e-60	-8.615850e-47
Msa0050700	Msa1316330	0.854053	1.589612e-61	-8.615850e-47
Msa0050700	Msa1321340	0.836001	1.208313e-56	-8.615850e-47
Msa0050700	Msa1321530	0.802206	6.262588e-49	-8.615850e-47
Msa0050700	Msa1327800	0.810858	9.349838e-51	-8.615850e-47
Msa0050700	Msa1332630	0.832744	7.935464e-56	-8.615850e-47
Msa0050700	Msa1332950	0.826704	2.343973e-54	-8.615850e-47
Msa0050700	Msa1342810	0.841553	4.432902e-58	-8.615850e-47
Msa0050700	Msa1343170	0.853248	2.709122e-61	-8.615850e-47
Msa0050700	Msa1343180	0.853094	2.997955e-61	-8.615850e-47
Msa0050700	Msa1352310	0.823230	1.549233e-53	-8.615850e-47
Msa0050700	Msa1359690	0.829815	4.168575e-55	-8.615850e-47
Msa0050700	Msa1359980	0.813859	2.067360e-51	-8.615850e-47
Msa0050700	Msa1362130	0.804122	2.514029e-49	-8.615850e-47
Msa0050700	Msa1362620	0.836409	9.518035e-57	-8.615850e-47
Msa0050700	Msa1364410	0.833456	5.278246e-56	-8.615850e-47
Msa0050700	Msa1364680	0.814552	1.453479e-51	-8.615850e-47
Msa0050700	Msa1368750	0.858205	9.665757e-63	-8.615850e-47
Msa0050700	Msa1372040	0.840866	6.716280e-58	-8.615850e-47
Msa0050700	Msa1374790	0.863955	1.720055e-64	-8.615850e-47
Msa0050700	Msa1375350	0.803253	3.808157e-49	-8.615850e-47
Msa0050700	Msa1381180	0.821583	3.737997e-53	-8.615850e-47
Msa0050700	Msa1382300	0.804804	1.812099e-49	-8.615850e-47
Msa0050700	Msa1383310	0.833389	5.486533e-56	-8.615850e-47
Msa0050700	Msa1384150	0.834211	3.416845e-56	-8.615850e-47
Msa0050700	Msa1384460	0.870304	1.614796e-66	-8.615850e-47
Msa0050700	Msa1387620	0.812375	4.375109e-51	-8.615850e-47
Msa0050700	Msa1393780	0.886351	3.689738e-72	-8.615850e-47
Msa0050700	Msa1397400	0.809685	1.674673e-50	-8.615850e-47
Msa0050700	Msa1400010	0.815570	8.640586e-52	-8.615850e-47
Msa0050700	Msa1400710	0.801826	7.497281e-49	-8.615850e-47
Msa0050700	Msa1405460	0.848959	4.393836e-60	-8.615850e-47
Msa0050700	Msa1406720	0.822056	2.904596e-53	-8.615850e-47
Msa0050700	Msa1409410	0.897117	1.918466e-76	-8.615850e-47
Msa0050700	Msa1410160	0.851995	6.170862e-61	-8.615850e-47
Msa0050700	Msa1411790	0.845592	3.689743e-59	-8.615850e-47
Msa0050700	Msa1413940	0.813830	2.098220e-51	-8.615850e-47
Msa0050700	Msa1414170	0.838777	2.350096e-57	-8.615850e-47
Msa0050700	Msa1415540	0.893586	5.474706e-75	-8.615850e-47
Msa0050700	Msa1417370	0.847484	1.123121e-59	-8.615850e-47
Msa0050700	Msa1427100	0.822627	2.140953e-53	-8.615850e-47
Msa0050700	Msa1431480	0.865771	4.635476e-65	-8.615850e-47
Msa0050700	Msa1433790	0.835487	1.630960e-56	-8.615850e-47
Msa0050700	Msa1433860	0.804745	1.864255e-49	-8.615850e-47
Msa0050700	Msa1435960	0.805744	1.151328e-49	-8.615850e-47
Msa0050700	Msa1437930	0.810704	1.009696e-50	-8.615850e-47
Msa0050700	Msa1440630	0.993056	3.662077e-197	-8.615850e-47
Msa0050700	Msa1445120	0.812538	4.030837e-51	-8.615850e-47
Msa0050700	Msa1449480	0.810479	1.129428e-50	-8.615850e-47
Msa0050700	Msa1450190	0.824885	6.332475e-54	-8.615850e-47
Msa0050700	Msa1451820	0.866599	2.534357e-65	-8.615850e-47
Msa0050700	Msa1452140	0.880850	3.907139e-70	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050700	MtrunA17_Chr1g0155761	96.774	403	2	5	1	395	1	400	0.0	769
Msa0050700	MtrunA17_Chr3g0142131	82.663	398	62	6	1	395	1	394	0.0	636
Msa0050700	MtrunA17_Chr6g0483401	57.808	365	122	4	30	394	19	351	1.78e-141	407
Msa0050700	MtrunA17_Chr5g0407971	41.003	339	199	1	18	356	8	345	3.63e-85	264
Msa0050700	MtrunA17_Chr5g0407991	37.958	382	198	4	18	382	6	365	2.60e-84	262
Msa0050700	MtrunA17_Chr5g0408001	37.403	385	204	4	18	383	7	373	8.47e-84	260
Msa0050700	MtrunA17_Chr5g0408041	40.331	362	209	3	23	382	13	369	5.08e-83	259
Msa0050700	MtrunA17_Chr5g0408031	39.888	356	205	3	18	371	7	355	2.36e-82	256
Msa0050700	MtrunA17_Chr1g0160171	38.764	356	194	3	1	354	1	334	6.78e-80	250
Msa0050700	MtrunA17_Chr7g0255561	38.551	345	189	2	18	356	11	338	2.59e-79	249
Msa0050700	MtrunA17_Chr7g0255581	38.551	345	189	2	18	356	11	338	2.59e-79	249
Msa0050700	MtrunA17_Chr8g0369841	38.596	342	203	4	18	356	6	343	3.97e-79	248
Msa0050700	MtrunA17_Chr8g0354121	38.643	339	196	2	18	355	10	337	3.90e-77	244
Msa0050700	MtrunA17_Chr3g0114691	36.047	344	207	2	18	361	17	347	8.95e-77	243
Msa0050700	MtrunA17_Chr1g0160181	39.003	341	194	2	23	362	20	347	1.09e-76	242
Msa0050700	MtrunA17_Chr1g0186641	36.338	355	207	5	18	370	10	347	5.44e-76	239
Msa0050700	MtrunA17_Chr5g0404811	47.348	264	113	4	129	387	1	243	1.09e-75	235
Msa0050700	MtrunA17_Chr1g0186601	35.754	358	210	4	18	373	13	352	1.68e-75	238
Msa0050700	MtrunA17_Chr1g0186611	34.734	357	213	3	18	372	13	351	3.64e-75	237
Msa0050700	MtrunA17_Chr1g0171301	34.454	357	216	4	9	362	2	343	4.76e-75	237
Msa0050700	MtrunA17_Chr3g0081421	38.841	345	194	4	14	354	9	340	2.12e-74	236
Msa0050700	MtrunA17_Chr2g0284261	35.398	339	202	2	18	356	5	326	1.02e-73	234
Msa0050700	MtrunA17_Chr6g0463971	35.795	352	205	4	15	362	10	344	1.27e-72	231
Msa0050700	MtrunA17_Chr3g0081511	38.551	345	185	4	18	355	14	338	1.79e-72	231
Msa0050700	MtrunA17_Chr8g0334761	38.081	344	197	4	12	354	1	329	3.65e-72	230
Msa0050700	MtrunA17_Chr1g0164831	34.930	355	210	5	24	378	6	339	8.56e-72	228
Msa0050700	MtrunA17_Chr1g0186561	36.857	350	202	4	18	365	13	345	3.09e-71	227
Msa0050700	MtrunA17_Chr1g0186571	34.770	348	207	5	18	363	10	339	1.28e-70	226
Msa0050700	MtrunA17_Chr3g0114731	37.952	332	189	2	23	354	20	334	1.82e-70	226
Msa0050700	MtrunA17_Chr7g0271561	35.045	331	207	1	24	354	10	332	9.61e-69	221
Msa0050700	MtrunA17_Chr1g0182291	36.364	341	193	3	18	354	12	332	2.13e-68	220
Msa0050700	MtrunA17_Chr2g0310441	36.461	373	213	8	24	388	13	369	6.82e-68	219
Msa0050700	MtrunA17_Chr4g0059311	34.024	338	207	4	25	361	15	337	7.71e-68	218
Msa0050700	MtrunA17_Chr3g0114711	34.492	374	192	4	18	354	11	368	1.47e-67	219
Msa0050700	MtrunA17_Chr3g0129601	33.511	376	212	4	6	368	14	364	5.05e-66	214
Msa0050700	MtrunA17_Chr1g0184221	32.133	361	206	4	18	361	13	351	1.24e-65	213
Msa0050700	MtrunA17_Chr7g0263101	35.988	339	187	4	24	354	16	332	1.59e-65	213
Msa0050700	MtrunA17_Chr3g0114701	37.612	335	195	2	23	356	11	332	1.12e-64	211
Msa0050700	MtrunA17_Chr2g0278561	33.938	386	227	4	10	385	4	371	1.69e-64	211
Msa0050700	MtrunA17_Chr8g0383731	35.329	334	205	2	23	355	7	330	9.65e-64	207
Msa0050700	MtrunA17_Chr1g0160111	32.923	325	209	2	30	354	16	331	2.35e-63	207
Msa0050700	MtrunA17_Chr3g0126101	35.220	318	186	4	38	354	23	321	7.04e-62	202
Msa0050700	MtrunA17_Chr3g0129571	33.134	335	209	5	23	354	9	331	5.56e-61	201
Msa0050700	MtrunA17_Chr8g0334771	36.337	344	203	3	12	354	1	329	3.48e-60	199
Msa0050700	MtrunA17_Chr3g0129591	33.832	334	208	3	23	354	7	329	4.42e-60	198
Msa0050700	MtrunA17_Chr4g0073241	32.984	382	216	9	24	395	11	362	3.80e-59	196
Msa0050700	MtrunA17_Chr8g0334751	35.676	370	212	6	24	392	14	358	1.78e-58	194
Msa0050700	MtrunA17_Chr5g0413961	35.530	349	204	3	11	357	2	331	3.78e-58	193
Msa0050700	MtrunA17_Chr2g0290611	35.952	331	199	3	26	356	17	334	4.52e-57	191
Msa0050700	MtrunA17_Chr2g0278541	35.362	345	200	4	24	360	15	344	1.71e-55	187
Msa0050700	MtrunA17_Chr2g0278551	34.294	347	213	3	26	372	17	348	4.40e-55	186
Msa0050700	MtrunA17_Chr5g0413941	31.579	342	217	4	16	356	2	327	1.65e-54	184
Msa0050700	MtrunA17_Chr5g0413921	30.347	346	224	3	18	362	4	333	9.99e-53	179
Msa0050700	MtrunA17_Chr4g0050891	32.081	346	213	3	10	349	2	331	5.91e-52	177
Msa0050700	MtrunA17_Chr3g0129581	32.036	334	214	3	23	354	7	329	6.57e-52	177
Msa0050700	MtrunA17_Chr1g0150151	33.828	337	199	5	25	355	15	333	5.11e-51	175
Msa0050700	MtrunA17_Chr4g0051021	30.270	370	244	3	26	394	19	375	8.97e-51	174
Msa0050700	MtrunA17_Chr5g0404801	68.908	119	37	0	16	134	2	120	2.57e-50	165
Msa0050700	MtrunA17_Chr2g0332001	32.440	336	202	4	26	356	43	358	4.15e-50	173
Msa0050700	MtrunA17_Chr5g0413951	30.514	331	213	5	26	355	12	326	9.72e-50	171
Msa0050700	MtrunA17_Chr5g0428881	29.101	378	247	4	15	383	9	374	2.43e-49	171
Msa0050700	MtrunA17_Chr1g0177221	34.629	283	165	4	1	282	1	264	2.61e-48	165
Msa0050700	MtrunA17_Chr5g0413931	30.514	331	213	5	26	355	11	325	1.70e-46	162
Msa0050700	MtrunA17_Chr4g0050941	31.746	378	241	4	24	395	15	381	1.73e-46	163
Msa0050700	MtrunA17_Chr4g0056081	31.054	351	212	10	25	365	18	348	3.32e-43	154
Msa0050700	MtrunA17_Chr4g0050881	29.679	374	224	8	15	375	3	350	7.64e-43	153
Msa0050700	MtrunA17_Chr7g0227921	31.548	336	204	5	25	355	15	329	8.78e-43	153
Msa0050700	MtrunA17_Chr4g0050931	29.598	348	188	3	14	356	5	300	2.22e-41	148
Msa0050700	MtrunA17_Chr1g0211801	32.685	257	157	3	26	282	16	256	1.29e-40	145
Msa0050700	MtrunA17_Chr5g0441761	27.576	330	219	2	25	354	18	327	1.38e-39	144
Msa0050700	MtrunA17_Chr5g0399281	30.792	341	215	8	18	354	5	328	4.64e-39	143
Msa0050700	MtrunA17_Chr5g0429001	29.126	309	207	3	88	395	18	315	6.62e-38	139
Msa0050700	MtrunA17_Chr3g0084091	31.752	274	169	3	101	373	10	266	2.23e-37	137
Msa0050700	MtrunA17_Chr4g0051001	29.217	332	218	4	5	332	12	330	3.71e-37	137
Msa0050700	MtrunA17_Chr6g0451211	28.704	324	198	7	41	355	32	331	7.70e-37	137
Msa0050700	MtrunA17_Chr6g0451201	29.859	355	224	6	41	395	32	361	4.20e-34	130
Msa0050700	MtrunA17_Chr6g0451251	30.321	343	217	6	41	380	32	355	2.15e-32	125
Msa0050700	MtrunA17_Chr3g0126091	25.723	346	233	8	24	362	14	342	1.15e-31	123
Msa0050700	MtrunA17_Chr6g0451171	28.354	328	213	7	30	355	21	328	2.17e-31	122
Msa0050700	MtrunA17_Chr2g0278021	35.586	222	135	2	135	356	1	214	4.65e-31	119
Msa0050700	MtrunA17_Chr6g0451261	27.124	306	198	5	35	335	25	310	2.17e-30	123
Msa0050700	MtrunA17_Chr8g0334721	38.194	144	84	2	247	390	2	140	7.36e-29	110
Msa0050700	MtrunA17_Chr8g0334711	34.272	213	123	4	18	229	7	203	6.80e-28	109
Msa0050700	MtrunA17_Chr6g0451191	28.054	221	141	3	135	355	1	203	6.06e-21	90.9
Msa0050700	MtrunA17_Chr8g0334731	29.224	219	119	5	13	229	3	187	5.46e-19	84.7
Msa0050700	MtrunA17_Chr1g0177231	38.947	95	57	1	268	362	15	108	4.33e-16	74.3
Msa0050700	MtrunA17_Chr2g0278031	39.815	108	65	0	26	133	19	126	9.99e-15	70.5
Msa0050700	MtrunA17_Chr4g0050911	35.938	128	76	1	106	233	16	137	2.27e-14	70.5
Msa0050700	MtrunA17_Chr1g0182261	33.077	130	84	3	230	356	83	212	2.27e-14	72.0
Msa0050700	MtrunA17_Chr1g0172891	40.541	74	44	0	289	362	13	86	3.01e-14	68.9
Msa0050700	MtrunA17_Chr1g0211811	42.254	71	41	0	284	354	1	71	5.00e-14	67.4
Msa0050700	MtrunA17_Chr4g0050921	33.333	102	68	0	234	335	3	104	6.81e-14	68.2
Msa0050700	MtrunA17_Chr1g0172881	28.667	150	83	4	134	282	23	149	1.08e-11	62.8
Msa0050700	MtrunA17_Chr8g0334741	28.571	140	71	3	247	382	2	116	7.10e-11	59.7

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050700	AT1G75500.1	74.687	399	87	7	1	395	1	389	0.0	589
Msa0050700	AT1G75500.2	74.687	399	87	7	1	395	1	389	0.0	589
Msa0050700	AT3G53210.1	52.632	380	161	3	16	390	4	369	6.50e-142	409
Msa0050700	AT3G18200.2	56.131	367	144	2	16	382	29	378	4.10e-141	407
Msa0050700	AT3G53210.3	57.143	266	100	2	16	281	4	255	1.85e-105	312
Msa0050700	AT3G53210.2	50.333	300	130	3	96	390	27	312	4.88e-102	305
Msa0050700	AT3G18200.1	50.943	265	113	2	118	382	1	248	1.07e-85	261
Msa0050700	AT3G45870.1	42.169	332	187	3	18	349	8	334	1.44e-77	245
Msa0050700	AT4G30420.2	37.371	388	217	7	18	395	5	376	2.54e-77	244
Msa0050700	AT5G45370.2	37.326	359	222	3	18	375	16	372	2.58e-77	244
Msa0050700	AT5G45370.4	37.326	359	222	3	18	375	16	372	2.58e-77	244
Msa0050700	AT5G45370.1	37.709	358	198	3	18	375	16	348	7.16e-77	242
Msa0050700	AT4G30420.1	36.911	382	215	6	24	395	1	366	1.02e-76	242
Msa0050700	AT5G07050.1	38.136	354	196	3	23	368	19	357	2.42e-74	237
Msa0050700	AT2G39510.1	37.838	333	191	2	24	355	10	327	7.48e-73	232
Msa0050700	AT3G45870.8	41.587	315	179	3	18	332	8	317	1.78e-71	227
Msa0050700	AT1G09380.1	38.602	329	191	1	24	352	10	327	3.06e-71	228
Msa0050700	AT4G08290.1	35.733	375	228	2	18	392	9	370	3.41e-71	228
Msa0050700	AT1G21890.1	34.262	359	230	1	23	381	12	364	5.70e-71	228
Msa0050700	AT1G44800.1	34.188	351	210	2	18	362	7	342	8.25e-71	227
Msa0050700	AT4G08300.1	34.384	349	215	3	18	365	7	342	2.54e-70	226
Msa0050700	AT4G19185.1	39.169	337	198	4	23	356	22	354	6.48e-70	225
Msa0050700	AT3G30340.1	33.828	337	209	3	26	362	15	337	2.64e-68	220
Msa0050700	AT2G40900.1	36.522	345	199	3	12	356	1	325	2.88e-68	221
Msa0050700	AT2G37460.1	35.674	356	205	6	18	369	11	346	3.63e-66	215
Msa0050700	AT1G43650.1	33.144	353	216	2	23	373	8	342	5.31e-63	206
Msa0050700	AT5G13670.1	33.628	339	211	3	18	355	4	329	3.49e-62	205
Msa0050700	AT4G01440.1	35.294	323	194	3	41	363	29	336	2.70e-61	202
Msa0050700	AT4G01430.1	33.934	333	205	4	24	354	11	330	1.52e-60	200
Msa0050700	AT1G01070.1	33.626	342	212	3	16	356	10	337	8.08e-60	198
Msa0050700	AT1G11450.3	35.030	334	200	4	24	356	18	335	1.17e-59	197
Msa0050700	AT3G45870.9	42.264	265	148	3	18	282	8	267	2.35e-59	194
Msa0050700	AT1G21890.2	35.161	310	195	1	23	332	12	315	4.05e-59	196
Msa0050700	AT3G56620.1	33.721	344	203	3	12	352	1	322	3.57e-58	194
Msa0050700	AT4G01440.3	35.959	292	172	3	41	332	29	305	7.71e-56	186
Msa0050700	AT1G11450.5	36.156	307	179	4	51	356	1	291	1.32e-55	186
Msa0050700	AT5G64700.1	31.686	344	227	3	29	372	15	350	1.24e-54	184
Msa0050700	AT1G11460.1	33.234	334	207	3	24	356	18	336	3.44e-54	182
Msa0050700	AT1G11450.2	36.577	298	172	4	60	356	3	284	3.69e-54	181
Msa0050700	AT4G28040.1	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050700	AT4G28040.5	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050700	AT4G28040.3	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050700	AT4G28040.4	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050700	AT4G28040.2	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050700	AT4G01430.2	33.119	311	193	4	24	332	11	308	8.13e-52	176
Msa0050700	AT1G11450.4	34.194	310	187	4	24	332	18	311	8.54e-51	173
Msa0050700	AT4G19185.2	36.604	265	161	4	95	356	16	276	3.55e-50	172
Msa0050700	AT2G37450.2	33.140	344	185	8	24	363	11	313	5.29e-50	172
Msa0050700	AT5G45370.6	34.926	272	174	3	105	375	1	270	2.09e-49	168
Msa0050700	AT5G45370.5	34.926	272	174	3	105	375	1	270	2.09e-49	168
Msa0050700	AT1G25270.1	32.934	334	209	2	24	356	5	324	7.68e-49	169
Msa0050700	AT1G68170.2	30.607	379	243	4	14	391	5	364	3.18e-48	168
Msa0050700	AT1G01070.2	33.793	290	177	3	68	356	15	290	3.45e-48	166
Msa0050700	AT4G08290.2	36.604	265	153	3	18	281	9	259	5.22e-48	165
Msa0050700	AT1G68170.1	31.250	368	233	4	25	391	6	354	1.84e-47	166
Msa0050700	AT5G40210.1	31.953	338	189	10	25	357	16	317	5.86e-47	164
Msa0050700	AT3G28130.2	32.653	343	202	10	22	356	13	334	5.96e-47	164
Msa0050700	AT4G01450.2	35.238	315	183	2	41	354	29	323	1.02e-46	164
Msa0050700	AT3G30340.2	32.685	257	159	3	26	282	15	257	1.11e-45	159
Msa0050700	AT1G11450.1	36.822	258	146	4	100	356	2	243	4.07e-45	157
Msa0050700	AT4G01450.1	34.471	293	171	2	41	332	29	301	5.09e-45	159
Msa0050700	AT5G40240.2	28.846	364	233	4	1	357	13	357	9.22e-45	159
Msa0050700	AT5G40240.1	30.000	340	212	4	25	357	23	343	1.04e-44	159
Msa0050700	AT5G40240.3	30.000	340	212	4	25	357	23	343	1.04e-44	159
Msa0050700	AT3G28050.1	31.267	371	223	10	25	387	15	361	1.20e-44	158
Msa0050700	AT4G01440.4	36.777	242	138	3	41	282	29	255	4.09e-44	154
Msa0050700	AT3G28100.1	30.286	350	219	8	25	370	17	345	1.19e-43	155
Msa0050700	AT5G40230.1	29.223	373	223	7	25	384	24	368	1.79e-43	155
Msa0050700	AT3G28130.5	33.594	256	149	6	105	356	10	248	2.42e-42	149
Msa0050700	AT3G28130.1	33.594	256	149	6	105	356	10	248	2.42e-42	149
Msa0050700	AT1G70260.1	29.462	353	233	5	24	370	14	356	8.18e-41	148
Msa0050700	AT3G28080.1	30.473	338	210	6	25	356	17	335	9.99e-41	148
Msa0050700	AT3G28070.2	29.740	269	168	5	105	371	8	257	2.55e-40	144
Msa0050700	AT3G28080.5	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050700	AT3G28080.7	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050700	AT3G28080.8	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050700	AT3G28080.6	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050700	AT3G45870.5	38.426	216	128	3	134	349	49	259	1.92e-39	143
Msa0050700	AT3G28070.1	29.740	269	168	5	105	371	100	349	2.64e-39	144
Msa0050700	AT3G28080.2	31.621	253	158	3	105	356	89	327	2.74e-39	144
Msa0050700	AT4G01450.4	34.156	243	139	2	41	282	29	251	2.67e-38	139
Msa0050700	AT4G01440.5	32.365	241	148	3	123	363	3	228	3.92e-38	138
Msa0050700	AT4G01440.2	32.365	241	148	3	123	363	3	228	3.92e-38	138
Msa0050700	AT5G47470.1	27.920	351	225	7	9	354	17	344	2.60e-37	139
Msa0050700	AT5G47470.2	27.920	351	225	7	9	354	45	372	3.34e-37	139
Msa0050700	AT5G47470.3	27.920	351	225	7	9	354	45	372	4.26e-37	139
Msa0050700	AT2G37450.3	34.100	261	148	6	107	363	1	241	5.97e-37	135
Msa0050700	AT5G45370.3	32.780	241	159	3	136	375	74	312	8.77e-37	136
Msa0050700	AT1G43650.2	31.274	259	160	1	23	281	8	248	9.42e-36	132
Msa0050700	AT4G15540.1	28.011	357	224	5	25	380	20	344	1.79e-34	130
Msa0050700	AT4G15540.2	28.011	357	224	5	25	380	20	344	1.79e-34	130
Msa0050700	AT4G16620.1	27.966	354	230	6	30	375	20	356	8.57e-34	129
Msa0050700	AT3G45870.6	37.186	199	120	3	134	332	49	242	1.40e-33	126
Msa0050700	AT3G45870.7	37.186	199	120	3	134	332	49	242	1.40e-33	126
Msa0050700	AT4G01450.3	35.071	211	116	2	41	250	29	219	4.15e-33	124
Msa0050700	AT5G64700.2	32.500	240	154	3	29	268	15	246	3.07e-32	122
Msa0050700	AT3G45870.2	37.234	188	113	3	162	349	1	183	1.24e-30	117
Msa0050700	AT1G60050.1	27.554	323	221	3	38	356	29	342	1.28e-30	121
Msa0050700	AT3G28130.3	30.973	226	135	6	135	356	1	209	3.62e-30	116
Msa0050700	AT3G28070.3	28.261	230	148	4	105	332	100	314	6.77e-29	115
Msa0050700	AT4G01430.3	31.220	205	127	3	151	354	2	193	1.60e-28	112
Msa0050700	AT3G28070.5	26.778	239	154	5	135	371	1	220	1.30e-27	109
Msa0050700	AT3G28080.9	28.251	223	145	3	135	356	1	209	1.64e-27	109
Msa0050700	AT2G37450.1	32.479	234	134	6	134	363	61	274	6.42e-27	109
Msa0050700	AT4G24980.1	28.302	318	147	8	38	355	3	239	8.75e-26	105
Msa0050700	AT3G28130.4	31.783	258	148	9	22	271	13	250	2.20e-24	101
Msa0050700	AT3G28100.3	31.076	251	153	6	25	271	17	251	1.01e-23	99.8
Msa0050700	AT4G16620.4	27.536	276	176	5	107	375	1	259	1.71e-23	99.0
Msa0050700	AT4G16620.2	27.536	276	176	5	107	375	1	259	1.71e-23	99.0
Msa0050700	AT3G45870.3	36.913	149	89	3	134	282	49	192	1.94e-21	92.0
Msa0050700	AT3G45870.4	36.735	147	88	3	136	282	4	145	2.03e-21	90.5
Msa0050700	AT3G28100.2	37.342	158	95	3	25	180	17	172	4.35e-21	92.0
Msa0050700	AT3G28130.6	36.943	157	91	4	22	174	13	165	2.10e-20	89.4
Msa0050700	AT4G16620.3	29.279	222	139	4	30	250	20	224	5.79e-20	89.4
Msa0050700	AT3G28080.3	36.025	161	93	3	25	180	17	172	7.97e-17	80.9
Msa0050700	AT3G28080.3	33.784	74	48	1	283	356	209	281	8.84e-11	62.8
Msa0050700	AT3G28080.4	46.053	76	41	0	105	180	8	83	4.90e-16	77.0
Msa0050700	AT3G28080.4	33.784	74	48	1	283	356	120	192	5.13e-11	62.4

Find 113 sgRNAs with CRISPR-Local

Find 193 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ACAACACCAATGATTGATTT+TGG	0.075897	1_2:+4720586	Msa0050700:CDS
CAAACTAGTGTTGGTTAATT+AGG	0.160697	1_2:-4719171	None:intergenic
CTTGGATGTCTTTATCTAAT+TGG	0.160867	1_2:+4720649	Msa0050700:CDS
TTTGCTAGGCTTCAATTATT+TGG	0.186662	1_2:+4719197	Msa0050700:five_prime_UTR
TCTTCCATTTGCTTATTTCT+TGG	0.199338	1_2:+4719475	Msa0050700:CDS
TATTCTACAATGGCTGATTT+AGG	0.205011	1_2:+4719272	Msa0050700:exon
TTTCTTTATGGTTTGATTTA+CGG	0.229174	1_2:+4722006	Msa0050700:three_prime_UTR
TATGTTAGTTAATTTCTTTA+TGG	0.244766	1_2:+4721994	Msa0050700:three_prime_UTR
CTTAAACGGGGTCATCATTT+TGG	0.252308	1_2:+4722174	Msa0050700:three_prime_UTR
ACTTCCTATACATGTTTCTT+TGG	0.256420	1_2:+4720748	Msa0050700:CDS
ATCAGTGATTACATTATATC+AGG	0.276969	1_2:+4720498	Msa0050700:CDS
TTGCATTTGCAGTACAAATA+TGG	0.283549	1_2:+4720973	Msa0050700:CDS
GCAATTTCTTCTTATTGCTT+TGG	0.291149	1_2:+4720777	Msa0050700:CDS
TGGGAGTGGTTTCAAAAGTA+TGG	0.304445	1_2:+4722107	Msa0050700:three_prime_UTR
AAATTTCTCAAGATTAGAAT+TGG	0.317880	1_2:+4722087	Msa0050700:three_prime_UTR
ATCATGGCTTCTATTGCTTT+AGG	0.322920	1_2:+4721062	Msa0050700:CDS
CTAATTAACCAACACTAGTT+TGG	0.326664	1_2:+4719172	Msa0050700:five_prime_UTR
GATGCTTTAGCGTGGCTTGC+GGG	0.332227	1_2:-4721721	None:intergenic
CAGAGGAAGTTTAAATTAAT+CGG	0.338959	1_2:-4719945	None:intergenic
CTAACTAACCGCGTATAAAA+TGG	0.340348	1_2:-4720854	None:intergenic
GGTTTCAAAAGTATGGTAAT+TGG	0.340685	1_2:+4722114	Msa0050700:three_prime_UTR
CCTTTATATTACAGGATCAT+TGG	0.349819	1_2:+4721583	Msa0050700:intron
CCACTATTTAAGTGACTACT+TGG	0.366846	1_2:-4720544	None:intergenic
CACAAATTGTGACTCTTAAA+CGG	0.370000	1_2:+4722160	Msa0050700:three_prime_UTR
ATCAAGGTTTCTACTTGCTT+GGG	0.374867	1_2:+4720228	Msa0050700:CDS
AATCAAGGTTTCTACTTGCT+TGG	0.382223	1_2:+4720227	Msa0050700:CDS
TCTTAGTAGATTATTTAGAT+TGG	0.388213	1_2:+4721867	Msa0050700:three_prime_UTR
CACACAAGCATGGTACTATA+AGG	0.389716	1_2:-4721812	None:intergenic
ATTGTTTGTCTTGGTCTGCT+TGG	0.391168	1_2:+4720674	Msa0050700:CDS
CTTAGTAGATTATTTAGATT+GGG	0.394466	1_2:+4721868	Msa0050700:three_prime_UTR
TTGCAGGGAGTGGTGGCATC+TGG	0.399814	1_2:+4720948	Msa0050700:intron
GCCCTGCAGTTTGGTTATGC+TGG	0.404103	1_2:+4719362	Msa0050700:CDS
TAATTGGACATTGTTTGTCT+TGG	0.407693	1_2:+4720665	Msa0050700:CDS
GCCATGTTGGCCCTGCAGTT+TGG	0.410120	1_2:+4719353	Msa0050700:CDS
ACAAATTGTGACTCTTAAAC+GGG	0.414592	1_2:+4722161	Msa0050700:three_prime_UTR
GCTACAACAAAAGTTTGAAC+AGG	0.438205	1_2:-4721038	None:intergenic
AACAGGATTACAGCAAATCA+AGG	0.453990	1_2:+4720212	Msa0050700:intron
GCAATGATGTTCCTATAGAC+AGG	0.454821	1_2:-4719440	None:intergenic
TTGAAAGAAATGCTCAGGCT+TGG	0.458050	1_2:+4720803	Msa0050700:CDS
ATGGGAACATGTTGTAATAG+TGG	0.458354	1_2:+4721909	Msa0050700:three_prime_UTR
GGACTTGGACTATATATAGT+TGG	0.461139	1_2:-4720523	None:intergenic
CCCTGCCATTACATTTCTCA+TGG	0.470693	1_2:+4720298	Msa0050700:CDS
AATTTCTCAAGATTAGAATT+GGG	0.471413	1_2:+4722088	Msa0050700:three_prime_UTR
CCAAGTAGTCACTTAAATAG+TGG	0.472865	1_2:+4720544	Msa0050700:CDS
ATTGTCCCAAAATCAATCAT+TGG	0.475219	1_2:-4720592	None:intergenic
TTCAAGAGCTGCACTTAACA+TGG	0.475828	1_2:+4719397	Msa0050700:CDS
TTAATTACTAAAGCTAATAG+TGG	0.477006	1_2:+4722291	Msa0050700:three_prime_UTR
AAGTCCAAAGAAACATGTAT+AGG	0.477885	1_2:-4720752	None:intergenic
CAAATATGGTGCATTGATAG+AGG	0.486474	1_2:+4720987	Msa0050700:CDS
GACGAGCAGGATACTTCTTA+AGG	0.487109	1_2:-4720717	None:intergenic
GATGGAATTGCTAAAGTAGC+AGG	0.489379	1_2:+4720451	Msa0050700:CDS
TTGGTTAATTAGGAAAAGAA+AGG	0.496181	1_2:-4719161	None:intergenic
TTTAAGTGACTACTTGGACT+TGG	0.498895	1_2:-4720538	None:intergenic
AGAAATAAGCAAATGGAAGA+AGG	0.501047	1_2:-4719472	None:intergenic
TGGACTATACTTTGTGCTGT+GGG	0.502383	1_2:+4721624	Msa0050700:CDS
TTCTCATGGCAGTCATACTA+AGG	0.503575	1_2:+4720312	Msa0050700:CDS
TTTAGGAGAAGAGTTCTACT+TGG	0.503735	1_2:+4721079	Msa0050700:CDS
GCCATGAGAAATGTAATGGC+AGG	0.506658	1_2:-4720299	None:intergenic
GTTAATTAGGAAAAGAAAGG+TGG	0.513729	1_2:-4719158	None:intergenic
AGGTTTCTACTTGCTTGGGT+TGG	0.514004	1_2:+4720232	Msa0050700:CDS
ATAGTGGATGTCACTAAAAG+TGG	0.518080	1_2:+4721925	Msa0050700:three_prime_UTR
AGGAAAAGAAAGGTGGGAAG+TGG	0.518388	1_2:-4719151	None:intergenic
AACCAGCATAACCAAACTGC+AGG	0.522465	1_2:-4719364	None:intergenic
AGTATGGTAATTGGCAAGCA+TGG	0.522694	1_2:+4722123	Msa0050700:three_prime_UTR
GAGAAGAGTTCTACTTGGGC+GGG	0.532422	1_2:+4721084	Msa0050700:CDS
ATGTCACTTGGTGATGCAAA+GGG	0.532729	1_2:+4720613	Msa0050700:CDS
GTGAGATTGAATCGAAAGGA+TGG	0.534056	1_2:+4720433	Msa0050700:CDS
TGTATTGCTGATGCAAAGGT+AGG	0.537203	1_2:-4720266	None:intergenic
CTCAAGATTAGAATTGGGAG+TGG	0.539135	1_2:+4722093	Msa0050700:three_prime_UTR
CTGGACTATACTTTGTGCTG+TGG	0.541801	1_2:+4721623	Msa0050700:CDS
GAAGTGACAGAAAGACGAGC+AGG	0.543364	1_2:-4720730	None:intergenic
TGATACACTGCAACAAACAC+TGG	0.547318	1_2:-4721014	None:intergenic
TTAATTCAATTATTCTACAA+TGG	0.548981	1_2:+4719262	Msa0050700:exon
CATCATTATCATGACATGGA+AGG	0.551192	1_2:+4722060	Msa0050700:three_prime_UTR
TATTAATTTGCAGGGAGTGG+TGG	0.551473	1_2:+4720941	Msa0050700:intron
GTATTGCTGATGCAAAGGTA+GGG	0.556287	1_2:-4720265	None:intergenic
TTAGGAGAAGAGTTCTACTT+GGG	0.557775	1_2:+4721080	Msa0050700:CDS
GCAGGATACTTCTTAAGGAC+AGG	0.559573	1_2:-4720712	None:intergenic
ATCATTATCATGACATGGAA+GGG	0.562114	1_2:+4722061	Msa0050700:three_prime_UTR
AGAGAAGAAATTATTTGCAA+AGG	0.564376	1_2:+4721657	Msa0050700:CDS
TAAAGCAATAGAAGCCATGA+TGG	0.564411	1_2:-4721060	None:intergenic
TCAGCTGCATGTGGCCATGT+TGG	0.564609	1_2:+4719340	Msa0050700:CDS
ACCAAACTGCAGGGCCAACA+TGG	0.565314	1_2:-4719354	None:intergenic
CAGCTTCTTCTAAGAGAATG+TGG	0.569037	1_2:+4719297	Msa0050700:CDS
AATGTCACTTGGTGATGCAA+AGG	0.570694	1_2:+4720612	Msa0050700:CDS
GGTGCAGTGTTGATAGTAGC+TGG	0.570883	1_2:+4721604	Msa0050700:CDS
TAGTGGATGTCACTAAAAGT+GGG	0.571839	1_2:+4721926	Msa0050700:three_prime_UTR
TCTGTTGAAGAAGATAGGAA+TGG	0.578628	1_2:-4721754	None:intergenic
TTAATTAGGAAAAGAAAGGT+GGG	0.579788	1_2:-4719157	None:intergenic
TCAGTGATTACATTATATCA+GGG	0.580478	1_2:+4720499	Msa0050700:CDS
TAATTACTAAAGCTAATAGT+GGG	0.588040	1_2:+4722292	Msa0050700:three_prime_UTR
TGATGCTTTAGCGTGGCTTG+CGG	0.596033	1_2:-4721722	None:intergenic
CAATGATGTTCCTATAGACA+GGG	0.596068	1_2:-4719439	None:intergenic
ATATATATATAAAAGCATAT+GGG	0.599668	1_2:-4721972	None:intergenic
GACTGCCATGAGAAATGTAA+TGG	0.601131	1_2:-4720303	None:intergenic
GTTCTGTATTGCTGATGCAA+AGG	0.604446	1_2:-4720270	None:intergenic
ATAATGACCTAGATGCATGC+TGG	0.606908	1_2:+4722241	Msa0050700:three_prime_UTR
GGAGAAGAGTTCTACTTGGG+CGG	0.607421	1_2:+4721083	Msa0050700:CDS
GTGCAGCTCTTGAAACAACA+TGG	0.618096	1_2:-4719388	None:intergenic
AGGAAGTTTAAATTAATCGG+TGG	0.623492	1_2:-4719942	None:intergenic
GCAAGTGAGATTGAATCGAA+AGG	0.625916	1_2:+4720429	Msa0050700:CDS
TCAAGAGCTGCACTTAACAT+GGG	0.631283	1_2:+4719398	Msa0050700:CDS
CCATGAGAAATGTAATGGCA+GGG	0.635566	1_2:-4720298	None:intergenic
TATCACAACACACACAAGCA+TGG	0.644681	1_2:-4721822	None:intergenic
TAGTCATCATTATCATGACA+TGG	0.647380	1_2:+4722056	Msa0050700:three_prime_UTR
CATATGGGACTAATTTCACA+AGG	0.653189	1_2:-4721957	None:intergenic
TATTGCTGATGCAAAGGTAG+GGG	0.668908	1_2:-4720264	None:intergenic
ATATGGTGCATTGATAGAGG+AGG	0.677817	1_2:+4720990	Msa0050700:CDS
ACCAGCATAACCAAACTGCA+GGG	0.678569	1_2:-4719363	None:intergenic
GGACTATACTTTGTGCTGTG+GGG	0.683443	1_2:+4721625	Msa0050700:CDS
GAGTGAGTGATGCTTTAGCG+TGG	0.695699	1_2:-4721729	None:intergenic
AGTGGATGTCACTAAAAGTG+GGG	0.697940	1_2:+4721927	Msa0050700:three_prime_UTR
CAAATTGTGACTCTTAAACG+GGG	0.725158	1_2:+4722162	Msa0050700:three_prime_UTR

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	AAATTAATTTTATAAATTAA+AGG	+	chr1_2:4720085-4720104	Msa0050700:intron	0.0%
!!!	AAAAATTATTAAAGGTATAA+AGG	-	chr1_2:4720180-4720199	None:intergenic	10.0%
!!	TCAACATAAAAAATTATTAA+AGG	-	chr1_2:4720188-4720207	None:intergenic	10.0%
!!!	ATTTTTTTTTATTAATTTGC+AGG	+	chr1_2:4720932-4720951	Msa0050700:intron	10.0%
!!!	TTTTTTTTTATTAATTTGCA+GGG	+	chr1_2:4720933-4720952	Msa0050700:intron	10.0%
!!!	GAGTTTTTTTTTTTTTTTTA+TGG	+	chr1_2:4721890-4721909	Msa0050700:three_prime_UTR	10.0%
!!!	ATATATATATAAAAGCATAT+GGG	-	chr1_2:4721975-4721994	None:intergenic	10.0%
!!!	TATATATATATAAAAGCATA+TGG	-	chr1_2:4721976-4721995	None:intergenic	10.0%
!!	TTAATTCAATTATTCTACAA+TGG	+	chr1_2:4719262-4719281	Msa0050700:exon	15.0%
!!	AATATTAATGAAATTGTTAG+AGG	-	chr1_2:4719517-4719536	None:intergenic	15.0%
!!	ATAATGTACAAAAATTTCAT+AGG	-	chr1_2:4719545-4719564	None:intergenic	15.0%
!!	AATCCAATATAAAAAAACTT+TGG	-	chr1_2:4719582-4719601	None:intergenic	15.0%
!!!	TTTTTTATGTTGAATTAAAC+AGG	+	chr1_2:4720195-4720214	Msa0050700:intron	15.0%
!!!	AAATTTTGCATGAATTTTTT+TGG	-	chr1_2:4720394-4720413	None:intergenic	15.0%
!!	TATCATAAACATTTGAATTA+AGG	-	chr1_2:4721133-4721152	None:intergenic	15.0%
!!!	AAGTTTTTGTTACTAATTTA+GGG	+	chr1_2:4721415-4721434	Msa0050700:intron	15.0%
!!	TGAATAAAGTAAAATCAAAA+GGG	-	chr1_2:4721551-4721570	None:intergenic	15.0%
!!	ATGAATAAAGTAAAATCAAA+AGG	-	chr1_2:4721552-4721571	None:intergenic	15.0%
!!	TATGTTAGTTAATTTCTTTA+TGG	+	chr1_2:4721994-4722013	Msa0050700:three_prime_UTR	15.0%
!!!	CAACCAAAGTTTTTTTATAT+TGG	+	chr1_2:4719576-4719595	Msa0050700:intron	20.0%
!!!	AACGTGTCAATTTTTATAAA+AGG	-	chr1_2:4719697-4719716	None:intergenic	20.0%
!!!	GAACAATATTTTGTGTAATT+GGG	+	chr1_2:4720473-4720492	Msa0050700:CDS	20.0%
!!!	AACAATATTTTGTGTAATTG+GGG	+	chr1_2:4720474-4720493	Msa0050700:CDS	20.0%
!!	GTATTTACTAAACAACTTAT+CGG	+	chr1_2:4721291-4721310	Msa0050700:intron	20.0%
!!!	TTTGATTGCGATTTTATTTT+TGG	+	chr1_2:4721325-4721344	Msa0050700:intron	20.0%
!!!	CAAGTTTTTGTTACTAATTT+AGG	+	chr1_2:4721414-4721433	Msa0050700:intron	20.0%
!!	TCTTAGTAGATTATTTAGAT+TGG	+	chr1_2:4721867-4721886	Msa0050700:three_prime_UTR	20.0%
!!	CTTAGTAGATTATTTAGATT+GGG	+	chr1_2:4721868-4721887	Msa0050700:three_prime_UTR	20.0%
!!!	TTTCTTTATGGTTTGATTTA+CGG	+	chr1_2:4722006-4722025	Msa0050700:three_prime_UTR	20.0%
!!	AAATTTCTCAAGATTAGAAT+TGG	+	chr1_2:4722087-4722106	Msa0050700:three_prime_UTR	20.0%
!!	AATTTCTCAAGATTAGAATT+GGG	+	chr1_2:4722088-4722107	Msa0050700:three_prime_UTR	20.0%
!!	TTAATTACTAAAGCTAATAG+TGG	+	chr1_2:4722291-4722310	Msa0050700:three_prime_UTR	20.0%
!!	TAATTACTAAAGCTAATAGT+GGG	+	chr1_2:4722292-4722311	Msa0050700:three_prime_UTR	20.0%
!	TTAATTAGGAAAAGAAAGGT+GGG	-	chr1_2:4719160-4719179	None:intergenic	25.0%
!	TTGGTTAATTAGGAAAAGAA+AGG	-	chr1_2:4719164-4719183	None:intergenic	25.0%
!!	TTTTCCAAGAAATAAGCAAA+TGG	-	chr1_2:4719482-4719501	None:intergenic	25.0%
!	TAATGAAATTGTTAGAGGAA+TGG	-	chr1_2:4719512-4719531	None:intergenic	25.0%
!!	TATTTAGTTCCCGTTAAAAT+GGG	-	chr1_2:4719725-4719744	None:intergenic	25.0%
!!	ATATTTAGTTCCCGTTAAAA+TGG	-	chr1_2:4719726-4719745	None:intergenic	25.0%
!	CAGAGGAAGTTTAAATTAAT+CGG	-	chr1_2:4719948-4719967	None:intergenic	25.0%
!!	GGAACAATATTTTGTGTAAT+TGG	+	chr1_2:4720472-4720491	Msa0050700:CDS	25.0%
!	ATCAGTGATTACATTATATC+AGG	+	chr1_2:4720498-4720517	Msa0050700:CDS	25.0%
!	TCAGTGATTACATTATATCA+GGG	+	chr1_2:4720499-4720518	Msa0050700:CDS	25.0%
!	TAATTTAAACCTAATAGTCG+TGG	-	chr1_2:4720880-4720899	None:intergenic	25.0%
!	TTGAATTAAGGATCGTAATT+AGG	-	chr1_2:4721121-4721140	None:intergenic	25.0%
!	GTAACAAAAACTTGATCATA+GGG	-	chr1_2:4721408-4721427	None:intergenic	25.0%
!	AGTAACAAAAACTTGATCAT+AGG	-	chr1_2:4721409-4721428	None:intergenic	25.0%
!	TTGAAGCAAAAAATCATCAT+AGG	+	chr1_2:4721454-4721473	Msa0050700:intron	25.0%
!	TAGGATATACTACTATTGAA+TGG	+	chr1_2:4721473-4721492	Msa0050700:intron	25.0%
!	ATAATACCCCTTTATATTAC+AGG	+	chr1_2:4721575-4721594	Msa0050700:intron	25.0%
!	AATGATCCTGTAATATAAAG+GGG	-	chr1_2:4721584-4721603	None:intergenic	25.0%
!	CAATGATCCTGTAATATAAA+GGG	-	chr1_2:4721585-4721604	None:intergenic	25.0%
!	AGAGAAGAAATTATTTGCAA+AGG	+	chr1_2:4721657-4721676	Msa0050700:CDS	25.0%
	GTTAATTAGGAAAAGAAAGG+TGG	-	chr1_2:4719161-4719180	None:intergenic	30.0%
!!	CAAACTAGTGTTGGTTAATT+AGG	-	chr1_2:4719174-4719193	None:intergenic	30.0%
	CTAATTAACCAACACTAGTT+TGG	+	chr1_2:4719172-4719191	Msa0050700:five_prime_UTR	30.0%
	TTTGCTAGGCTTCAATTATT+TGG	+	chr1_2:4719197-4719216	Msa0050700:five_prime_UTR	30.0%
!	TATTCTACAATGGCTGATTT+AGG	+	chr1_2:4719272-4719291	Msa0050700:exon	30.0%
	AGAAATAAGCAAATGGAAGA+AGG	-	chr1_2:4719475-4719494	None:intergenic	30.0%
!	TCTTCCATTTGCTTATTTCT+TGG	+	chr1_2:4719475-4719494	Msa0050700:CDS	30.0%
	TTCCTTAGCATATTCTCTTA+AGG	+	chr1_2:4719600-4719619	Msa0050700:intron	30.0%
!!	ACGTTTAGTTCCCATTTTAA+CGG	+	chr1_2:4719712-4719731	Msa0050700:intron	30.0%
!	TGTTTCTTTTCCTTTTGTTC+AGG	+	chr1_2:4719910-4719929	Msa0050700:intron	30.0%
	AGGAAGTTTAAATTAATCGG+TGG	-	chr1_2:4719945-4719964	None:intergenic	30.0%
!!!	TTCTTTTTTCTCGCACTTAT+TGG	+	chr1_2:4719972-4719991	Msa0050700:CDS	30.0%
!!!	TCTTTTTTCTCGCACTTATT+GGG	+	chr1_2:4719973-4719992	Msa0050700:CDS	30.0%
	TCATGCAAAATTTCATCAAC+AGG	+	chr1_2:4720401-4720420	Msa0050700:intron	30.0%
!!	ACAACACCAATGATTGATTT+TGG	+	chr1_2:4720586-4720605	Msa0050700:CDS	30.0%
!!	CAACACCAATGATTGATTTT+GGG	+	chr1_2:4720587-4720606	Msa0050700:CDS	30.0%
	ATTGTCCCAAAATCAATCAT+TGG	-	chr1_2:4720595-4720614	None:intergenic	30.0%
	CTTGGATGTCTTTATCTAAT+TGG	+	chr1_2:4720649-4720668	Msa0050700:CDS	30.0%
	TAATTGGACATTGTTTGTCT+TGG	+	chr1_2:4720665-4720684	Msa0050700:CDS	30.0%
	ACTTCCTATACATGTTTCTT+TGG	+	chr1_2:4720748-4720767	Msa0050700:CDS	30.0%
	AAGTCCAAAGAAACATGTAT+AGG	-	chr1_2:4720755-4720774	None:intergenic	30.0%
	GCAATTTCTTCTTATTGCTT+TGG	+	chr1_2:4720777-4720796	Msa0050700:CDS	30.0%
!!!	TTTTATTAATTTGCAGGGAG+TGG	+	chr1_2:4720938-4720957	Msa0050700:intron	30.0%
	TTGCATTTGCAGTACAAATA+TGG	+	chr1_2:4720973-4720992	Msa0050700:CDS	30.0%
	TAAGGATCGTAATTAGGATT+AGG	-	chr1_2:4721115-4721134	None:intergenic	30.0%
	GTATCATTACATAAGATACG+TGG	-	chr1_2:4721220-4721239	None:intergenic	30.0%
	AATGACCTAAAGTGAGATAA+AGG	+	chr1_2:4721249-4721268	Msa0050700:intron	30.0%
	ATGACCTAAAGTGAGATAAA+GGG	+	chr1_2:4721250-4721269	Msa0050700:intron	30.0%
	AATACCCTTTATCTCACTTT+AGG	-	chr1_2:4721257-4721276	None:intergenic	30.0%
	CCAATGATCCTGTAATATAA+AGG	-	chr1_2:4721586-4721605	None:intergenic	30.0%
	CCTTTATATTACAGGATCAT+TGG	+	chr1_2:4721583-4721602	Msa0050700:intron	30.0%
!	CATTTTCTGTTGAAGAAGAT+AGG	-	chr1_2:4721762-4721781	None:intergenic	30.0%
	TAGTCATCATTATCATGACA+TGG	+	chr1_2:4722056-4722075	Msa0050700:three_prime_UTR	30.0%
	ATCATTATCATGACATGGAA+GGG	+	chr1_2:4722061-4722080	Msa0050700:three_prime_UTR	30.0%
!	GGTTTCAAAAGTATGGTAAT+TGG	+	chr1_2:4722114-4722133	Msa0050700:three_prime_UTR	30.0%
	CACAAATTGTGACTCTTAAA+CGG	+	chr1_2:4722160-4722179	Msa0050700:three_prime_UTR	30.0%
	ACAAATTGTGACTCTTAAAC+GGG	+	chr1_2:4722161-4722180	Msa0050700:three_prime_UTR	30.0%
	AGCAAAAACCAAACTAGTGT+TGG	-	chr1_2:4719183-4719202	None:intergenic	35.0%
!!!	ACACTAGTTTGGTTTTTGCT+AGG	+	chr1_2:4719183-4719202	Msa0050700:five_prime_UTR	35.0%
!	CATGCAGCTGAAATTTTTCA+GGG	-	chr1_2:4719331-4719350	None:intergenic	35.0%
!	ACATGCAGCTGAAATTTTTC+AGG	-	chr1_2:4719332-4719351	None:intergenic	35.0%
	TGAAAAATTTCAGCTGCATG+TGG	+	chr1_2:4719331-4719350	Msa0050700:CDS	35.0%
!!	AACTTGTTTTCCCTGTCTAT+AGG	+	chr1_2:4719429-4719448	Msa0050700:CDS	35.0%
	CAATGATGTTCCTATAGACA+GGG	-	chr1_2:4719442-4719461	None:intergenic	35.0%
	TGCCTTAAGAGAATATGCTA+AGG	-	chr1_2:4719605-4719624	None:intergenic	35.0%
!!	CGTTTAGTTCCCATTTTAAC+GGG	+	chr1_2:4719713-4719732	Msa0050700:intron	35.0%
!	TCTTTTCCTTTTGTTCAGGA+AGG	+	chr1_2:4719914-4719933	Msa0050700:intron	35.0%
	TAAGTGCGAGAAAAAAGAAC+TGG	-	chr1_2:4719971-4719990	None:intergenic	35.0%
	AACAGGATTACAGCAAATCA+AGG	+	chr1_2:4720212-4720231	Msa0050700:intron	35.0%
	AATCAAGGTTTCTACTTGCT+TGG	+	chr1_2:4720227-4720246	Msa0050700:CDS	35.0%
	ATCAAGGTTTCTACTTGCTT+GGG	+	chr1_2:4720228-4720247	Msa0050700:CDS	35.0%
	GGACTTGGACTATATATAGT+TGG	-	chr1_2:4720526-4720545	None:intergenic	35.0%
	TTTAAGTGACTACTTGGACT+TGG	-	chr1_2:4720541-4720560	None:intergenic	35.0%
	CCACTATTTAAGTGACTACT+TGG	-	chr1_2:4720547-4720566	None:intergenic	35.0%
	CCAAGTAGTCACTTAAATAG+TGG	+	chr1_2:4720544-4720563	Msa0050700:CDS	35.0%
	GTGATGCAAAGGGAAAAAAT+TGG	+	chr1_2:4720623-4720642	Msa0050700:CDS	35.0%
	AAGGGAAAAAATTGGACACT+TGG	+	chr1_2:4720631-4720650	Msa0050700:CDS	35.0%
!!	GGTTTTTGAAAGAAATGCTC+AGG	+	chr1_2:4720798-4720817	Msa0050700:CDS	35.0%
!	AGCTTTCACCATTTTATACG+CGG	+	chr1_2:4720846-4720865	Msa0050700:CDS	35.0%
	CTAACTAACCGCGTATAAAA+TGG	-	chr1_2:4720857-4720876	None:intergenic	35.0%
!	CAAATATGGTGCATTGATAG+AGG	+	chr1_2:4720987-4721006	Msa0050700:CDS	35.0%
	GCTACAACAAAAGTTTGAAC+AGG	-	chr1_2:4721041-4721060	None:intergenic	35.0%
!!	AACTTTTGTTGTAGCCATCA+TGG	+	chr1_2:4721046-4721065	Msa0050700:CDS	35.0%
	TAAAGCAATAGAAGCCATGA+TGG	-	chr1_2:4721063-4721082	None:intergenic	35.0%
	ATCATGGCTTCTATTGCTTT+AGG	+	chr1_2:4721062-4721081	Msa0050700:CDS	35.0%
	TTTAGGAGAAGAGTTCTACT+TGG	+	chr1_2:4721079-4721098	Msa0050700:CDS	35.0%
	TTAGGAGAAGAGTTCTACTT+GGG	+	chr1_2:4721080-4721099	Msa0050700:CDS	35.0%
	TAATTGCTTTGCGAGTGTTT+AGG	-	chr1_2:4721168-4721187	None:intergenic	35.0%
	TTATGTAATGATACCGCCTT+CGG	+	chr1_2:4721226-4721245	Msa0050700:intron	35.0%
	TCTGTTGAAGAAGATAGGAA+TGG	-	chr1_2:4721757-4721776	None:intergenic	35.0%
	ATGGGAACATGTTGTAATAG+TGG	+	chr1_2:4721909-4721928	Msa0050700:three_prime_UTR	35.0%
!!	ATAGTGGATGTCACTAAAAG+TGG	+	chr1_2:4721925-4721944	Msa0050700:three_prime_UTR	35.0%
!	TAGTGGATGTCACTAAAAGT+GGG	+	chr1_2:4721926-4721945	Msa0050700:three_prime_UTR	35.0%
	CATATGGGACTAATTTCACA+AGG	-	chr1_2:4721960-4721979	None:intergenic	35.0%
	CATCATTATCATGACATGGA+AGG	+	chr1_2:4722060-4722079	Msa0050700:three_prime_UTR	35.0%
	CAAATTGTGACTCTTAAACG+GGG	+	chr1_2:4722162-4722181	Msa0050700:three_prime_UTR	35.0%
!	ATTTTTACCAGCATGCATCT+AGG	-	chr1_2:4722251-4722270	None:intergenic	35.0%
!	CAGCTTCTTCTAAGAGAATG+TGG	+	chr1_2:4719297-4719316	Msa0050700:CDS	40.0%
	TTCAAGAGCTGCACTTAACA+TGG	+	chr1_2:4719397-4719416	Msa0050700:CDS	40.0%
	TCAAGAGCTGCACTTAACAT+GGG	+	chr1_2:4719398-4719417	Msa0050700:CDS	40.0%
	GCAATGATGTTCCTATAGAC+AGG	-	chr1_2:4719443-4719462	None:intergenic	40.0%
	TATTGCTGATGCAAAGGTAG+GGG	-	chr1_2:4720267-4720286	None:intergenic	40.0%
	GTATTGCTGATGCAAAGGTA+GGG	-	chr1_2:4720268-4720287	None:intergenic	40.0%
	TGTATTGCTGATGCAAAGGT+AGG	-	chr1_2:4720269-4720288	None:intergenic	40.0%
	GTTCTGTATTGCTGATGCAA+AGG	-	chr1_2:4720273-4720292	None:intergenic	40.0%
	CCATGAGAAATGTAATGGCA+GGG	-	chr1_2:4720301-4720320	None:intergenic	40.0%
	GACTGCCATGAGAAATGTAA+TGG	-	chr1_2:4720306-4720325	None:intergenic	40.0%
	TTCTCATGGCAGTCATACTA+AGG	+	chr1_2:4720312-4720331	Msa0050700:CDS	40.0%
	GCAAGTGAGATTGAATCGAA+AGG	+	chr1_2:4720429-4720448	Msa0050700:CDS	40.0%
	GTGAGATTGAATCGAAAGGA+TGG	+	chr1_2:4720433-4720452	Msa0050700:CDS	40.0%
	GATGGAATTGCTAAAGTAGC+AGG	+	chr1_2:4720451-4720470	Msa0050700:CDS	40.0%
!!!	GATTTTGGGACAATGTCACT+TGG	+	chr1_2:4720601-4720620	Msa0050700:CDS	40.0%
!!	AATGTCACTTGGTGATGCAA+AGG	+	chr1_2:4720612-4720631	Msa0050700:CDS	40.0%
!!	ATGTCACTTGGTGATGCAAA+GGG	+	chr1_2:4720613-4720632	Msa0050700:CDS	40.0%
	ATTGTTTGTCTTGGTCTGCT+TGG	+	chr1_2:4720674-4720693	Msa0050700:CDS	40.0%
	TTGAAAGAAATGCTCAGGCT+TGG	+	chr1_2:4720803-4720822	Msa0050700:CDS	40.0%
	GTTAGTTAGCCACGACTATT+AGG	+	chr1_2:4720868-4720887	Msa0050700:intron	40.0%
!!	TATTAATTTGCAGGGAGTGG+TGG	+	chr1_2:4720941-4720960	Msa0050700:intron	40.0%
!	ATATGGTGCATTGATAGAGG+AGG	+	chr1_2:4720990-4721009	Msa0050700:CDS	40.0%
	TGATACACTGCAACAAACAC+TGG	-	chr1_2:4721017-4721036	None:intergenic	40.0%
	TGGACTATACTTTGTGCTGT+GGG	+	chr1_2:4721624-4721643	Msa0050700:CDS	40.0%
	CACACAAGCATGGTACTATA+AGG	-	chr1_2:4721815-4721834	None:intergenic	40.0%
	TATCACAACACACACAAGCA+TGG	-	chr1_2:4721825-4721844	None:intergenic	40.0%
	AGTGGATGTCACTAAAAGTG+GGG	+	chr1_2:4721927-4721946	Msa0050700:three_prime_UTR	40.0%
	CTCAAGATTAGAATTGGGAG+TGG	+	chr1_2:4722093-4722112	Msa0050700:three_prime_UTR	40.0%
	TGGGAGTGGTTTCAAAAGTA+TGG	+	chr1_2:4722107-4722126	Msa0050700:three_prime_UTR	40.0%
	AGTATGGTAATTGGCAAGCA+TGG	+	chr1_2:4722123-4722142	Msa0050700:three_prime_UTR	40.0%
!	CTTAAACGGGGTCATCATTT+TGG	+	chr1_2:4722174-4722193	Msa0050700:three_prime_UTR	40.0%
	ATAATGACCTAGATGCATGC+TGG	+	chr1_2:4722241-4722260	Msa0050700:three_prime_UTR	40.0%
	AGGAAAAGAAAGGTGGGAAG+TGG	-	chr1_2:4719154-4719173	None:intergenic	45.0%
	ACCAGCATAACCAAACTGCA+GGG	-	chr1_2:4719366-4719385	None:intergenic	45.0%
	AACCAGCATAACCAAACTGC+AGG	-	chr1_2:4719367-4719386	None:intergenic	45.0%
	GTGCAGCTCTTGAAACAACA+TGG	-	chr1_2:4719391-4719410	None:intergenic	45.0%
	GTCTGTCCTTCCTGAACAAA+AGG	-	chr1_2:4719923-4719942	None:intergenic	45.0%
	CGAGAAAAAAGAACTGGCAG+AGG	-	chr1_2:4719965-4719984	None:intergenic	45.0%
	AGGTTTCTACTTGCTTGGGT+TGG	+	chr1_2:4720232-4720251	Msa0050700:CDS	45.0%
	CCCTGCCATTACATTTCTCA+TGG	+	chr1_2:4720298-4720317	Msa0050700:CDS	45.0%
	GCCATGAGAAATGTAATGGC+AGG	-	chr1_2:4720302-4720321	None:intergenic	45.0%
	GCAGGATACTTCTTAAGGAC+AGG	-	chr1_2:4720715-4720734	None:intergenic	45.0%
	GACGAGCAGGATACTTCTTA+AGG	-	chr1_2:4720720-4720739	None:intergenic	45.0%
!	CAGGCTTGGATTTTTCACTC+TGG	+	chr1_2:4720817-4720836	Msa0050700:CDS	45.0%
!	GCTTGGATTTTTCACTCTGG+TGG	+	chr1_2:4720820-4720839	Msa0050700:CDS	45.0%
	ACTTTAGGTCATTCCGAAGG+CGG	-	chr1_2:4721242-4721261	None:intergenic	45.0%
	CTCACTTTAGGTCATTCCGA+AGG	-	chr1_2:4721245-4721264	None:intergenic	45.0%
	CTGGACTATACTTTGTGCTG+TGG	+	chr1_2:4721623-4721642	Msa0050700:CDS	45.0%
	GGACTATACTTTGTGCTGTG+GGG	+	chr1_2:4721625-4721644	Msa0050700:CDS	45.0%
!!	AACGGGGTCATCATTTTGGT+CGG	+	chr1_2:4722178-4722197	Msa0050700:three_prime_UTR	45.0%
!!!	AGTTTTTTTTTTTTTTTTAT+GGG	+	chr1_2:4721891-4721910	Msa0050700:three_prime_UTR	5.0%
	GAAGTGACAGAAAGACGAGC+AGG	-	chr1_2:4720733-4720752	None:intergenic	50.0%
	GGAGAAGAGTTCTACTTGGG+CGG	+	chr1_2:4721083-4721102	Msa0050700:CDS	50.0%
	GAGAAGAGTTCTACTTGGGC+GGG	+	chr1_2:4721084-4721103	Msa0050700:CDS	50.0%
!!	GGTGCAGTGTTGATAGTAGC+TGG	+	chr1_2:4721604-4721623	Msa0050700:CDS	50.0%
	TGATGCTTTAGCGTGGCTTG+CGG	-	chr1_2:4721725-4721744	None:intergenic	50.0%
	GAGTGAGTGATGCTTTAGCG+TGG	-	chr1_2:4721732-4721751	None:intergenic	50.0%
	TCAGCTGCATGTGGCCATGT+TGG	+	chr1_2:4719340-4719359	Msa0050700:CDS	55.0%
	ACCAAACTGCAGGGCCAACA+TGG	-	chr1_2:4719357-4719376	None:intergenic	55.0%
	GCCCTGCAGTTTGGTTATGC+TGG	+	chr1_2:4719362-4719381	Msa0050700:CDS	55.0%
!	GATGCTTTAGCGTGGCTTGC+GGG	-	chr1_2:4721724-4721743	None:intergenic	55.0%
	GCCATGTTGGCCCTGCAGTT+TGG	+	chr1_2:4719353-4719372	Msa0050700:CDS	60.0%
	TTGCAGGGAGTGGTGGCATC+TGG	+	chr1_2:4720948-4720967	Msa0050700:intron	60.0%

Chromosome	Type	Strat	End	Strand	Name
chr1_2	gene	4719150	4722398	4719150	ID=Msa0050700;Name=Msa0050700
chr1_2	mRNA	4719150	4722398	4719150	ID=Msa0050700-mRNA-1;Parent=Msa0050700;Name=Msa0050700-mRNA-1;_AED=0.04;_eAED=0.04;_QI=131\|1\|1\|1\|1\|1\|6\|612\|395
chr1_2	exon	4719150	4719501	4719150	ID=Msa0050700-mRNA-1:exon:1236;Parent=Msa0050700-mRNA-1
chr1_2	exon	4719932	4719994	4719932	ID=Msa0050700-mRNA-1:exon:1237;Parent=Msa0050700-mRNA-1
chr1_2	exon	4720217	4720333	4720217	ID=Msa0050700-mRNA-1:exon:1238;Parent=Msa0050700-mRNA-1
chr1_2	exon	4720423	4720867	4720423	ID=Msa0050700-mRNA-1:exon:1239;Parent=Msa0050700-mRNA-1
chr1_2	exon	4720954	4721105	4720954	ID=Msa0050700-mRNA-1:exon:1240;Parent=Msa0050700-mRNA-1
chr1_2	exon	4721597	4722398	4721597	ID=Msa0050700-mRNA-1:exon:1241;Parent=Msa0050700-mRNA-1
chr1_2	five_prime_UTR	4719150	4719280	4719150	ID=Msa0050700-mRNA-1:five_prime_utr;Parent=Msa0050700-mRNA-1
chr1_2	CDS	4719281	4719501	4719281	ID=Msa0050700-mRNA-1:cds;Parent=Msa0050700-mRNA-1
chr1_2	CDS	4719932	4719994	4719932	ID=Msa0050700-mRNA-1:cds;Parent=Msa0050700-mRNA-1
chr1_2	CDS	4720217	4720333	4720217	ID=Msa0050700-mRNA-1:cds;Parent=Msa0050700-mRNA-1
chr1_2	CDS	4720423	4720867	4720423	ID=Msa0050700-mRNA-1:cds;Parent=Msa0050700-mRNA-1
chr1_2	CDS	4720954	4721105	4720954	ID=Msa0050700-mRNA-1:cds;Parent=Msa0050700-mRNA-1
chr1_2	CDS	4721597	4721786	4721597	ID=Msa0050700-mRNA-1:cds;Parent=Msa0050700-mRNA-1
chr1_2	three_prime_UTR	4721787	4722398	4721787	ID=Msa0050700-mRNA-1:three_prime_utr;Parent=Msa0050700-mRNA-1

Gene Sequence

>Msa0050700

ATGGCTGATTTAGGTTCAGCTTCTTCTAAGAGAATGTGGTGTTCTATCCCTGAAAAATTTCAGCTGCATGTGGCCATGTTGGCCCTGCAGTTTGGTTATGCTGGTTTCCATGTTGTTTCAAGAGCTGCACTTAACATGGGAGTTAGCAAACTTGTTTTCCCTGTCTATAGGAACATCATTGCTTTGCTTCTCCTTCTTCCATTTGCTTATTTCTTGGAAAAGAAGGACAGACCACCGATTAATTTAAACTTCCTCTGCCAGTTCTTTTTTCTCGCACTTATTGGGATTACAGCAAATCAAGGTTTCTACTTGCTTGGGTTGGATAACACATCCCCTACCTTTGCATCAGCAATACAGAACTCTGTCCCTGCCATTACATTTCTCATGGCAGTCATACTAAGGATAGAGCAAGTGAGATTGAATCGAAAGGATGGAATTGCTAAAGTAGCAGGAACAATATTTTGTGTAATTGGGGCATCAGTGATTACATTATATCAGGGACCAACTATATATAGTCCAAGTCCAAGTAGTCACTTAAATAGTGGCATAACAGAAGTAACAACAACAACACCAATGATTGATTTTGGGACAATGTCACTTGGTGATGCAAAGGGAAAAAATTGGACACTTGGATGTCTTTATCTAATTGGACATTGTTTGTCTTGGTCTGCTTGGCTTGTGTTTCAAGCACCTGTCCTTAAGAAGTATCCTGCTCGTCTTTCTGTCACTTCCTATACATGTTTCTTTGGACTTTTGCAATTTCTTCTTATTGCTTTGGTTTTTGAAAGAAATGCTCAGGCTTGGATTTTTCACTCTGGTGGTGAAGCTTTCACCATTTTATACGCGGGAGTGGTGGCATCTGGAATTGCATTTGCAGTACAAATATGGTGCATTGATAGAGGAGGTCCAGTGTTTGTTGCAGTGTATCAACCTGTTCAAACTTTTGTTGTAGCCATCATGGCTTCTATTGCTTTAGGAGAAGAGTTCTACTTGGGCGGGATCATTGGTGCAGTGTTGATAGTAGCTGGACTATACTTTGTGCTGTGGGGTAAAAGTGAAGAGAAGAAATTATTTGCAAAGGAACAGCTTGCAATTGCATCAACAGAACATAGCATCATTAGACCCGCAAGCCACGCTAAAGCATCACTCACTCAACCATTCCTATCTTCTTCAACAGAAAATGTTTGA

Protein sequence

>Msa0050700

MADLGSASSKRMWCSIPEKFQLHVAMLALQFGYAGFHVVSRAALNMGVSKLVFPVYRNIIALLLLLPFAYFLEKKDRPPINLNFLCQFFFLALIGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAVILRIEQVRLNRKDGIAKVAGTIFCVIGASVITLYQGPTIYSPSPSSHLNSGITEVTTTTPMIDFGTMSLGDAKGKNWTLGCLYLIGHCLSWSAWLVFQAPVLKKYPARLSVTSYTCFFGLLQFLLIALVFERNAQAWIFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIMASIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEEKKLFAKEQLAIASTEHSIIRPASHAKASLTQPFLSSSTENV*