AlfalfaGEDB | Msa0050660

M. sativa cultivar zhongmu-4 / Msa0050660

KEGG: -
GO: GO:0000325 GO:0000902 GO:0003674 GO:0005215 GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0005773 GO:0005774 GO:0005886 GO:0005887 GO:0005938 GO:0006521 GO:0006810 GO:0007154 GO:0007165 GO:0008150 GO:0009653 GO:0009705 GO:0009719 GO:0009725 GO:0009733 GO:0009734 GO:0009755 GO:0009826 GO:0009832 GO:0009834 GO:0009893 GO:0009914 GO:0009966 GO:0009987 GO:0010033 GO:0010315 GO:0010565 GO:0010646 GO:0010817 GO:0010928 GO:0016020 GO:0016021 GO:0016043 GO:0016049 GO:0019222 GO:0022857 GO:0023051 GO:0023052 GO:0031090 GO:0031224 GO:0031226 GO:0031323 GO:0031325 GO:0032350 GO:0032352 GO:0032502 GO:0032870 GO:0032989 GO:0033238 GO:0033240 GO:0040007 GO:0042221 GO:0042546 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044085 GO:0044422 GO:0044424 GO:0044425 GO:0044437 GO:0044444 GO:0044446 GO:0044459 GO:0044464 GO:0045764 GO:0048518 GO:0048522 GO:0048583 GO:0048589 GO:0048856 GO:0048869 GO:0050789 GO:0050794 GO:0050896 GO:0051171 GO:0051173 GO:0051179 GO:0051234 GO:0051716 GO:0055085 GO:0060560 GO:0060918 GO:0062012 GO:0062013 GO:0065007 GO:0065008 GO:0070887 GO:0071310 GO:0071365 GO:0071495 GO:0071554 GO:0071669 GO:0071840 GO:0071944 GO:0080090 GO:0090354 GO:0090355 GO:0090357 GO:0090358 GO:0098588 GO:0098805 GO:0099568
PFAM: PF00892.23

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050660	XP_003589345.1	96.774	403	2	5	1	395	1	400	0.0	769

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050660	sp\|Q94AP3\|WAT1_ARATH	74.687	399	87	7	1	395	1	389	0.0	589

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050660	G7I5V7	96.774	403	2	5	1	395	1	400	0.0	769

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0000050	Msa0050660	0.803840	2.877530e-49	-8.615850e-47
Msa0002580	Msa0050660	0.836601	8.502598e-57	-8.615850e-47
Msa0003080	Msa0050660	0.902983	5.542010e-79	-8.615850e-47
Msa0005890	Msa0050660	0.803588	3.245786e-49	-8.615850e-47
Msa0008040	Msa0050660	0.857964	1.140007e-62	-8.615850e-47
Msa0015150	Msa0050660	0.836843	7.378656e-57	-8.615850e-47
Msa0016040	Msa0050660	0.815045	1.130516e-51	-8.615850e-47
Msa0017670	Msa0050660	0.843226	1.596071e-58	-8.615850e-47
Msa0019900	Msa0050660	0.810824	9.512523e-51	-8.615850e-47
Msa0025160	Msa0050660	0.890887	6.562533e-74	-8.615850e-47
Msa0025580	Msa0050660	0.872782	2.441106e-67	-8.615850e-47
Msa0027280	Msa0050660	0.838246	3.222414e-57	-8.615850e-47
Msa0029960	Msa0050660	0.835670	1.465623e-56	-8.615850e-47
Msa0029970	Msa0050660	0.814655	1.379286e-51	-8.615850e-47
Msa0032460	Msa0050660	0.817894	2.601816e-52	-8.615850e-47
Msa0032980	Msa0050660	0.809052	2.289177e-50	-8.615850e-47
Msa0034210	Msa0050660	0.882166	1.308554e-70	-8.615850e-47
Msa0035270	Msa0050660	0.824907	6.258469e-54	-8.615850e-47
Msa0035340	Msa0050660	0.851823	6.903843e-61	-8.615850e-47
Msa0035380	Msa0050660	0.845492	3.927836e-59	-8.615850e-47
Msa0042640	Msa0050660	0.826925	2.075480e-54	-8.615850e-47
Msa0048510	Msa0050660	0.844930	5.569951e-59	-8.615850e-47
Msa0050660	Msa0050700	0.998795	6.577444e-277	-8.615850e-47
Msa0050660	Msa0050790	0.990079	5.795456e-181	-8.615850e-47
Msa0050660	Msa0053070	0.809353	1.973242e-50	-8.615850e-47
Msa0050660	Msa0054690	0.835003	2.160418e-56	-8.615850e-47
Msa0050660	Msa0057540	0.820942	5.254454e-53	-8.615850e-47
Msa0050660	Msa0062340	0.801606	8.318511e-49	-8.615850e-47
Msa0050660	Msa0064120	0.802986	4.323917e-49	-8.615850e-47
Msa0050660	Msa0067060	0.803032	4.229497e-49	-8.615850e-47
Msa0050660	Msa0067330	0.827794	1.284645e-54	-8.615850e-47
Msa0050660	Msa0068150	0.801891	7.270629e-49	-8.615850e-47
Msa0050660	Msa0071850	0.846116	2.657409e-59	-8.615850e-47
Msa0050660	Msa0071860	0.855110	7.860372e-62	-8.615850e-47
Msa0050660	Msa0071880	0.831388	1.717036e-55	-8.615850e-47
Msa0050660	Msa0072520	0.871339	7.368323e-67	-8.615850e-47
Msa0050660	Msa0073120	0.854987	8.534703e-62	-8.615850e-47
Msa0050660	Msa0074020	0.801931	7.132939e-49	-8.615850e-47
Msa0050660	Msa0077340	0.811847	5.704947e-51	-8.615850e-47
Msa0050660	Msa0077560	0.827804	1.278108e-54	-8.615850e-47
Msa0050660	Msa0090400	0.846822	1.705570e-59	-8.615850e-47
Msa0050660	Msa0093860	0.819194	1.319923e-52	-8.615850e-47
Msa0050660	Msa0094780	0.822303	2.546504e-53	-8.615850e-47
Msa0050660	Msa0094790	0.843964	1.013611e-58	-8.615850e-47
Msa0050660	Msa0098040	0.831267	1.839001e-55	-8.615850e-47
Msa0050660	Msa0098410	0.802007	6.879887e-49	-8.615850e-47
Msa0050660	Msa0108880	0.869285	3.471778e-66	-8.615850e-47
Msa0050660	Msa0113340	0.829570	4.781466e-55	-8.615850e-47
Msa0050660	Msa0115550	0.828946	6.775589e-55	-8.615850e-47
Msa0050660	Msa0120790	0.830555	2.749849e-55	-8.615850e-47
Msa0050660	Msa0121330	0.858367	8.648680e-63	-8.615850e-47
Msa0050660	Msa0122330	0.826263	2.985420e-54	-8.615850e-47
Msa0050660	Msa0123070	0.830917	2.242084e-55	-8.615850e-47
Msa0050660	Msa0125200	0.835240	1.882458e-56	-8.615850e-47
Msa0050660	Msa0125210	0.842569	2.387594e-58	-8.615850e-47
Msa0050660	Msa0125360	0.816603	5.077898e-52	-8.615850e-47
Msa0050660	Msa0126210	0.815284	1.000118e-51	-8.615850e-47
Msa0050660	Msa0128310	0.879185	1.531584e-69	-8.615850e-47
Msa0050660	Msa0136650	0.823365	1.440288e-53	-8.615850e-47
Msa0050660	Msa0137880	0.838308	3.106179e-57	-8.615850e-47
Msa0050660	Msa0140130	0.838190	3.331134e-57	-8.615850e-47
Msa0050660	Msa0140280	0.877913	4.289485e-69	-8.615850e-47
Msa0050660	Msa0140380	0.819049	1.424177e-52	-8.615850e-47
Msa0050660	Msa0143670	0.816910	4.335241e-52	-8.615850e-47
Msa0050660	Msa0146650	0.912450	1.920968e-83	-8.615850e-47
Msa0050660	Msa0149350	0.874326	7.371484e-68	-8.615850e-47
Msa0050660	Msa0158860	0.833721	4.532744e-56	-8.615850e-47
Msa0050660	Msa0161930	0.866531	2.663199e-65	-8.615850e-47
Msa0050660	Msa0166170	0.838918	2.161821e-57	-8.615850e-47
Msa0050660	Msa0174440	0.876987	9.015150e-69	-8.615850e-47
Msa0050660	Msa0174450	0.828398	9.193216e-55	-8.615850e-47
Msa0050660	Msa0176060	0.849157	3.871895e-60	-8.615850e-47
Msa0050660	Msa0178450	0.803026	4.242295e-49	-8.615850e-47
Msa0050660	Msa0182240	0.805872	1.082039e-49	-8.615850e-47
Msa0050660	Msa0188610	0.864367	1.279620e-64	-8.615850e-47
Msa0050660	Msa0190570	0.855583	5.723569e-62	-8.615850e-47
Msa0050660	Msa0190730	0.809780	1.597631e-50	-8.615850e-47
Msa0050660	Msa0200050	0.843816	1.110591e-58	-8.615850e-47
Msa0050660	Msa0209980	0.805224	1.480339e-49	-8.615850e-47
Msa0050660	Msa0213030	0.834455	2.968641e-56	-8.615850e-47
Msa0050660	Msa0213610	0.820823	5.596012e-53	-8.615850e-47
Msa0050660	Msa0222560	0.811908	5.531901e-51	-8.615850e-47
Msa0050660	Msa0225100	0.813836	2.091831e-51	-8.615850e-47
Msa0050660	Msa0225860	0.828812	7.299085e-55	-8.615850e-47
Msa0050660	Msa0230780	0.812955	3.267843e-51	-8.615850e-47
Msa0050660	Msa0230800	0.866912	2.014188e-65	-8.615850e-47
Msa0050660	Msa0230840	0.823041	1.715084e-53	-8.615850e-47
Msa0050660	Msa0230870	0.873135	1.859056e-67	-8.615850e-47
Msa0050660	Msa0232760	0.844360	7.934394e-59	-8.615850e-47
Msa0050660	Msa0233020	0.819649	1.039540e-52	-8.615850e-47
Msa0050660	Msa0242590	0.837760	4.296869e-57	-8.615850e-47
Msa0050660	Msa0244640	0.800661	1.297705e-48	-8.615850e-47
Msa0050660	Msa0260510	0.810197	1.299505e-50	-8.615850e-47
Msa0050660	Msa0267110	0.819093	1.392086e-52	-8.615850e-47
Msa0050660	Msa0270340	0.853437	2.391445e-61	-8.615850e-47
Msa0050660	Msa0272260	0.829404	5.247083e-55	-8.615850e-47
Msa0050660	Msa0280790	0.838975	2.088530e-57	-8.615850e-47
Msa0050660	Msa0284800	0.845866	3.109415e-59	-8.615850e-47
Msa0050660	Msa0287740	0.814819	1.268817e-51	-8.615850e-47
Msa0050660	Msa0292160	0.812462	4.189143e-51	-8.615850e-47
Msa0050660	Msa0293040	0.818664	1.741816e-52	-8.615850e-47
Msa0050660	Msa0298470	0.836596	8.530494e-57	-8.615850e-47
Msa0050660	Msa0301820	0.803812	2.915714e-49	-8.615850e-47
Msa0050660	Msa0307270	0.823617	1.257604e-53	-8.615850e-47
Msa0050660	Msa0307670	0.847098	1.433788e-59	-8.615850e-47
Msa0050660	Msa0330520	0.846641	1.911243e-59	-8.615850e-47
Msa0050660	Msa0340500	0.802994	4.307313e-49	-8.615850e-47
Msa0050660	Msa0347530	0.803918	2.771118e-49	-8.615850e-47
Msa0050660	Msa0365210	0.810665	1.029523e-50	-8.615850e-47
Msa0050660	Msa0367520	0.850804	1.339622e-60	-8.615850e-47
Msa0050660	Msa0367690	0.854829	9.486534e-62	-8.615850e-47
Msa0050660	Msa0368860	0.818265	2.145409e-52	-8.615850e-47
Msa0050660	Msa0369790	0.845505	3.894238e-59	-8.615850e-47
Msa0050660	Msa0371270	0.810822	9.523537e-51	-8.615850e-47
Msa0050660	Msa0380620	0.822958	1.793174e-53	-8.615850e-47
Msa0050660	Msa0380670	0.882619	8.946528e-71	-8.615850e-47
Msa0050660	Msa0381730	0.830049	3.655418e-55	-8.615850e-47
Msa0050660	Msa0382390	0.826328	2.881122e-54	-8.615850e-47
Msa0050660	Msa0382740	0.825897	3.647634e-54	-8.615850e-47
Msa0050660	Msa0382770	0.832630	8.473185e-56	-8.615850e-47
Msa0050660	Msa0383000	0.823741	1.176521e-53	-8.615850e-47
Msa0050660	Msa0384870	0.853618	2.120900e-61	-8.615850e-47
Msa0050660	Msa0389950	0.826872	2.137750e-54	-8.615850e-47
Msa0050660	Msa0390970	0.831693	1.444414e-55	-8.615850e-47
Msa0050660	Msa0400000	0.831105	2.015147e-55	-8.615850e-47
Msa0050660	Msa0400950	0.818478	1.919665e-52	-8.615850e-47
Msa0050660	Msa0405680	0.801886	7.286367e-49	-8.615850e-47
Msa0050660	Msa0415140	0.800687	1.282097e-48	-8.615850e-47
Msa0050660	Msa0415450	0.842165	3.054379e-58	-8.615850e-47
Msa0050660	Msa0415600	0.804682	1.921136e-49	-8.615850e-47
Msa0050660	Msa0416160	0.808845	2.535665e-50	-8.615850e-47
Msa0050660	Msa0419540	0.831060	2.068088e-55	-8.615850e-47
Msa0050660	Msa0422050	0.817135	3.858134e-52	-8.615850e-47
Msa0050660	Msa0424160	0.801818	7.526175e-49	-8.615850e-47
Msa0050660	Msa0426530	0.861368	1.077620e-63	-8.615850e-47
Msa0050660	Msa0428370	0.814503	1.490592e-51	-8.615850e-47
Msa0050660	Msa0430260	0.824445	8.040470e-54	-8.615850e-47
Msa0050660	Msa0430300	0.870526	1.364920e-66	-8.615850e-47
Msa0050660	Msa0430480	0.815237	1.024448e-51	-8.615850e-47
Msa0050660	Msa0431200	0.841404	4.850595e-58	-8.615850e-47
Msa0050660	Msa0432010	0.855699	5.293278e-62	-8.615850e-47
Msa0050660	Msa0432140	0.825151	5.480599e-54	-8.615850e-47
Msa0050660	Msa0433150	0.826587	2.499615e-54	-8.615850e-47
Msa0050660	Msa0435210	0.867363	1.446411e-65	-8.615850e-47
Msa0050660	Msa0436910	0.842402	2.644083e-58	-8.615850e-47
Msa0050660	Msa0443410	0.811411	7.095018e-51	-8.615850e-47
Msa0050660	Msa0447750	0.819256	1.277922e-52	-8.615850e-47
Msa0050660	Msa0457570	0.836046	1.177266e-56	-8.615850e-47
Msa0050660	Msa0460070	0.836241	1.049965e-56	-8.615850e-47
Msa0050660	Msa0462780	0.808628	2.820555e-50	-8.615850e-47
Msa0050660	Msa0464000	0.844635	6.691988e-59	-8.615850e-47
Msa0050660	Msa0465530	0.827558	1.464056e-54	-8.615850e-47
Msa0050660	Msa0466520	0.815549	8.733975e-52	-8.615850e-47
Msa0050660	Msa0466880	0.813315	2.724424e-51	-8.615850e-47
Msa0050660	Msa0472950	0.870472	1.422695e-66	-8.615850e-47
Msa0050660	Msa0474730	0.803695	3.083114e-49	-8.615850e-47
Msa0050660	Msa0476280	0.828420	9.078002e-55	-8.615850e-47
Msa0050660	Msa0476650	0.805687	1.183340e-49	-8.615850e-47
Msa0050660	Msa0479320	0.864151	1.493938e-64	-8.615850e-47
Msa0050660	Msa0481890	0.843765	1.145714e-58	-8.615850e-47
Msa0050660	Msa0482080	0.829727	4.379383e-55	-8.615850e-47
Msa0050660	Msa0484570	0.822283	2.573068e-53	-8.615850e-47
Msa0050660	Msa0500380	0.804020	2.639488e-49	-8.615850e-47
Msa0050660	Msa0509550	0.840147	1.035755e-57	-8.615850e-47
Msa0050660	Msa0511470	0.815832	7.554282e-52	-8.615850e-47
Msa0050660	Msa0513080	0.804575	2.023081e-49	-8.615850e-47
Msa0050660	Msa0517250	0.895736	7.216284e-76	-8.615850e-47
Msa0050660	Msa0519750	0.804221	2.397244e-49	-8.615850e-47
Msa0050660	Msa0519830	0.806495	8.000850e-50	-8.615850e-47
Msa0050660	Msa0520260	0.844146	9.055858e-59	-8.615850e-47
Msa0050660	Msa0520870	0.845176	4.781016e-59	-8.615850e-47
Msa0050660	Msa0520990	0.836416	9.477583e-57	-8.615850e-47
Msa0050660	Msa0524520	0.823397	1.416234e-53	-8.615850e-47
Msa0050660	Msa0524800	0.804631	1.969030e-49	-8.615850e-47
Msa0050660	Msa0525000	0.828203	1.024430e-54	-8.615850e-47
Msa0050660	Msa0528570	0.895148	1.261617e-75	-8.615850e-47
Msa0050660	Msa0529030	0.850832	1.315739e-60	-8.615850e-47
Msa0050660	Msa0530780	0.829807	4.186950e-55	-8.615850e-47
Msa0050660	Msa0531960	0.839952	1.164674e-57	-8.615850e-47
Msa0050660	Msa0532050	0.805957	1.038705e-49	-8.615850e-47
Msa0050660	Msa0541300	0.899874	1.286327e-77	-8.615850e-47
Msa0050660	Msa0541310	0.896654	2.997697e-76	-8.615850e-47
Msa0050660	Msa0543660	0.813920	2.004691e-51	-8.615850e-47
Msa0050660	Msa0548470	0.870586	1.304894e-66	-8.615850e-47
Msa0050660	Msa0549370	0.810960	8.887143e-51	-8.615850e-47
Msa0050660	Msa0550050	0.826715	2.329854e-54	-8.615850e-47
Msa0050660	Msa0553750	0.809046	2.296233e-50	-8.615850e-47
Msa0050660	Msa0557290	0.802371	5.790049e-49	-8.615850e-47
Msa0050660	Msa0557370	0.816913	4.326544e-52	-8.615850e-47
Msa0050660	Msa0557460	0.873551	1.347459e-67	-8.615850e-47
Msa0050660	Msa0562350	0.855916	4.575890e-62	-8.615850e-47
Msa0050660	Msa0563740	0.814974	1.172092e-51	-8.615850e-47
Msa0050660	Msa0563940	0.830372	3.048625e-55	-8.615850e-47
Msa0050660	Msa0567170	0.836885	7.198681e-57	-8.615850e-47
Msa0050660	Msa0570010	0.841786	3.846511e-58	-8.615850e-47
Msa0050660	Msa0571290	0.820941	5.255291e-53	-8.615850e-47
Msa0050660	Msa0571620	0.820399	7.001517e-53	-8.615850e-47
Msa0050660	Msa0573810	0.831143	1.972862e-55	-8.615850e-47
Msa0050660	Msa0574300	0.802629	5.122729e-49	-8.615850e-47
Msa0050660	Msa0580200	0.810395	1.177722e-50	-8.615850e-47
Msa0050660	Msa0580370	0.838282	3.154355e-57	-8.615850e-47
Msa0050660	Msa0580810	0.829304	5.546562e-55	-8.615850e-47
Msa0050660	Msa0584420	0.828406	9.152545e-55	-8.615850e-47
Msa0050660	Msa0585020	0.889680	1.950565e-73	-8.615850e-47
Msa0050660	Msa0587620	0.847101	1.430800e-59	-8.615850e-47
Msa0050660	Msa0588920	0.806220	9.143642e-50	-8.615850e-47
Msa0050660	Msa0590200	0.824849	6.458553e-54	-8.615850e-47
Msa0050660	Msa0591170	0.821157	4.687967e-53	-8.615850e-47
Msa0050660	Msa0597270	0.892251	1.885194e-74	-8.615850e-47
Msa0050660	Msa0602430	0.804976	1.667610e-49	-8.615850e-47
Msa0050660	Msa0605560	0.828526	8.559672e-55	-8.615850e-47
Msa0050660	Msa0606100	0.820600	6.296284e-53	-8.615850e-47
Msa0050660	Msa0607800	0.828593	8.246051e-55	-8.615850e-47
Msa0050660	Msa0609650	0.801922	7.164863e-49	-8.615850e-47
Msa0050660	Msa0616210	0.871955	4.604895e-67	-8.615850e-47
Msa0050660	Msa0619710	0.826762	2.271088e-54	-8.615850e-47
Msa0050660	Msa0621710	0.859789	3.243051e-63	-8.615850e-47
Msa0050660	Msa0640200	0.810868	9.306992e-51	-8.615850e-47
Msa0050660	Msa0644410	0.875085	4.066817e-68	-8.615850e-47
Msa0050660	Msa0646510	0.807871	4.089861e-50	-8.615850e-47
Msa0050660	Msa0647050	0.807206	5.659949e-50	-8.615850e-47
Msa0050660	Msa0648040	0.809857	1.537793e-50	-8.615850e-47
Msa0050660	Msa0652650	0.815589	8.557447e-52	-8.615850e-47
Msa0050660	Msa0655700	0.880818	4.010822e-70	-8.615850e-47
Msa0050660	Msa0657440	0.828882	7.020529e-55	-8.615850e-47
Msa0050660	Msa0657700	0.829400	5.256919e-55	-8.615850e-47
Msa0050660	Msa0658640	0.832488	9.188780e-56	-8.615850e-47
Msa0050660	Msa0661150	0.839846	1.240853e-57	-8.615850e-47
Msa0050660	Msa0662110	0.812275	4.602240e-51	-8.615850e-47
Msa0050660	Msa0665620	0.827037	1.951175e-54	-8.615850e-47
Msa0050660	Msa0666700	0.841305	5.151648e-58	-8.615850e-47
Msa0050660	Msa0668900	0.817209	3.713207e-52	-8.615850e-47
Msa0050660	Msa0670100	0.808121	3.618879e-50	-8.615850e-47
Msa0050660	Msa0675330	0.892493	1.508420e-74	-8.615850e-47
Msa0050660	Msa0678490	0.813722	2.216178e-51	-8.615850e-47
Msa0050660	Msa0682770	0.819333	1.227161e-52	-8.615850e-47
Msa0050660	Msa0684220	0.821827	3.282448e-53	-8.615850e-47
Msa0050660	Msa0687090	0.858651	7.116381e-63	-8.615850e-47
Msa0050660	Msa0690740	0.804624	1.975705e-49	-8.615850e-47
Msa0050660	Msa0693890	0.833911	4.063026e-56	-8.615850e-47
Msa0050660	Msa0698730	0.801441	8.990870e-49	-8.615850e-47
Msa0050660	Msa0699540	0.876500	1.329647e-68	-8.615850e-47
Msa0050660	Msa0700460	0.849869	2.450771e-60	-8.615850e-47
Msa0050660	Msa0701720	0.833428	5.364621e-56	-8.615850e-47
Msa0050660	Msa0702810	0.820780	5.724015e-53	-8.615850e-47
Msa0050660	Msa0703600	0.827323	1.666893e-54	-8.615850e-47
Msa0050660	Msa0706150	0.837190	6.017211e-57	-8.615850e-47
Msa0050660	Msa0707670	0.812236	4.693468e-51	-8.615850e-47
Msa0050660	Msa0709200	0.826762	2.270964e-54	-8.615850e-47
Msa0050660	Msa0709440	0.845286	4.464508e-59	-8.615850e-47
Msa0050660	Msa0709630	0.809756	1.616847e-50	-8.615850e-47
Msa0050660	Msa0713700	0.844345	8.007650e-59	-8.615850e-47
Msa0050660	Msa0713960	0.805641	1.210337e-49	-8.615850e-47
Msa0050660	Msa0714520	0.836029	1.188913e-56	-8.615850e-47
Msa0050660	Msa0716480	0.806491	8.015812e-50	-8.615850e-47
Msa0050660	Msa0720410	0.858489	7.955611e-63	-8.615850e-47
Msa0050660	Msa0722220	0.844817	5.975731e-59	-8.615850e-47
Msa0050660	Msa0723090	0.808361	3.215722e-50	-8.615850e-47
Msa0050660	Msa0724800	0.805338	1.400973e-49	-8.615850e-47
Msa0050660	Msa0725750	0.823832	1.120276e-53	-8.615850e-47
Msa0050660	Msa0735780	0.846268	2.415922e-59	-8.615850e-47
Msa0050660	Msa0736890	0.816426	5.565207e-52	-8.615850e-47
Msa0050660	Msa0737990	0.831532	1.582374e-55	-8.615850e-47
Msa0050660	Msa0738700	0.875083	4.073169e-68	-8.615850e-47
Msa0050660	Msa0740710	0.805153	1.531554e-49	-8.615850e-47
Msa0050660	Msa0741220	0.844055	9.580706e-59	-8.615850e-47
Msa0050660	Msa0743440	0.847396	1.187401e-59	-8.615850e-47
Msa0050660	Msa0745720	0.811396	7.150827e-51	-8.615850e-47
Msa0050660	Msa0747000	0.808453	3.074833e-50	-8.615850e-47
Msa0050660	Msa0747740	0.811104	8.273878e-51	-8.615850e-47
Msa0050660	Msa0755930	0.830314	3.149752e-55	-8.615850e-47
Msa0050660	Msa0756490	0.871833	5.057353e-67	-8.615850e-47
Msa0050660	Msa0758650	0.837065	6.475011e-57	-8.615850e-47
Msa0050660	Msa0760970	0.852205	5.378068e-61	-8.615850e-47
Msa0050660	Msa0761670	0.849796	2.568744e-60	-8.615850e-47
Msa0050660	Msa0763550	0.811153	8.072573e-51	-8.615850e-47
Msa0050660	Msa0773630	0.840121	1.052254e-57	-8.615850e-47
Msa0050660	Msa0773670	0.808189	3.500341e-50	-8.615850e-47
Msa0050660	Msa0778550	0.857044	2.133363e-62	-8.615850e-47
Msa0050660	Msa0780910	0.820522	6.562137e-53	-8.615850e-47
Msa0050660	Msa0783930	0.806853	6.724021e-50	-8.615850e-47
Msa0050660	Msa0792370	0.857055	2.118072e-62	-8.615850e-47
Msa0050660	Msa0795870	0.837872	4.021751e-57	-8.615850e-47
Msa0050660	Msa0803250	0.832156	1.109989e-55	-8.615850e-47
Msa0050660	Msa0805680	0.842193	3.003117e-58	-8.615850e-47
Msa0050660	Msa0811020	0.816893	4.371925e-52	-8.615850e-47
Msa0050660	Msa0815920	0.830797	2.399333e-55	-8.615850e-47
Msa0050660	Msa0818880	0.802775	4.781496e-49	-8.615850e-47
Msa0050660	Msa0819170	0.828802	7.343049e-55	-8.615850e-47
Msa0050660	Msa0821160	0.810692	1.015862e-50	-8.615850e-47
Msa0050660	Msa0824450	0.839444	1.579317e-57	-8.615850e-47
Msa0050660	Msa0828970	0.825861	3.720159e-54	-8.615850e-47
Msa0050660	Msa0833650	0.830836	2.346324e-55	-8.615850e-47
Msa0050660	Msa0835160	0.812335	4.465336e-51	-8.615850e-47
Msa0050660	Msa0835350	0.809862	1.534067e-50	-8.615850e-47
Msa0050660	Msa0835490	0.852161	5.535331e-61	-8.615850e-47
Msa0050660	Msa0837460	0.807584	4.707724e-50	-8.615850e-47
Msa0050660	Msa0841590	0.853328	2.569605e-61	-8.615850e-47
Msa0050660	Msa0843050	0.856437	3.219048e-62	-8.615850e-47
Msa0050660	Msa0859290	0.872580	2.851900e-67	-8.615850e-47
Msa0050660	Msa0863620	0.843767	1.144037e-58	-8.615850e-47
Msa0050660	Msa0867110	0.813563	2.402248e-51	-8.615850e-47
Msa0050660	Msa0876940	0.807257	5.522811e-50	-8.615850e-47
Msa0050660	Msa0888790	0.807927	3.978441e-50	-8.615850e-47
Msa0050660	Msa0894790	0.806812	6.858714e-50	-8.615850e-47
Msa0050660	Msa0905240	0.811322	7.419563e-51	-8.615850e-47
Msa0050660	Msa0909760	0.824567	7.524999e-54	-8.615850e-47
Msa0050660	Msa0915520	0.816488	5.389202e-52	-8.615850e-47
Msa0050660	Msa0921590	0.817668	2.926719e-52	-8.615850e-47
Msa0050660	Msa0931590	0.843774	1.139480e-58	-8.615850e-47
Msa0050660	Msa0956350	0.812963	3.253542e-51	-8.615850e-47
Msa0050660	Msa0966320	0.825950	3.543784e-54	-8.615850e-47
Msa0050660	Msa0966480	0.826506	2.613239e-54	-8.615850e-47
Msa0050660	Msa0967870	0.802061	6.706103e-49	-8.615850e-47
Msa0050660	Msa0974520	0.812279	4.592028e-51	-8.615850e-47
Msa0050660	Msa0980290	0.800330	1.515837e-48	-8.615850e-47
Msa0050660	Msa0981320	0.838251	3.213708e-57	-8.615850e-47
Msa0050660	Msa0989500	0.824697	7.014109e-54	-8.615850e-47
Msa0050660	Msa1009950	0.869803	2.354049e-66	-8.615850e-47
Msa0050660	Msa1020480	0.822035	2.937633e-53	-8.615850e-47
Msa0050660	Msa1021590	0.869960	2.091873e-66	-8.615850e-47
Msa0050660	Msa1029530	0.827211	1.773345e-54	-8.615850e-47
Msa0050660	Msa1029800	0.821837	3.265207e-53	-8.615850e-47
Msa0050660	Msa1033920	0.809175	2.154237e-50	-8.615850e-47
Msa0050660	Msa1034600	0.817031	4.071849e-52	-8.615850e-47
Msa0050660	Msa1035220	0.807407	5.131377e-50	-8.615850e-47
Msa0050660	Msa1035570	0.840168	1.022785e-57	-8.615850e-47
Msa0050660	Msa1035610	0.847776	9.338195e-60	-8.615850e-47
Msa0050660	Msa1037540	0.804319	2.286855e-49	-8.615850e-47
Msa0050660	Msa1039220	0.833656	4.705442e-56	-8.615850e-47
Msa0050660	Msa1042160	0.915910	3.355483e-85	-8.615850e-47
Msa0050660	Msa1042190	0.917244	6.722784e-86	-8.615850e-47
Msa0050660	Msa1042880	0.805165	1.522416e-49	-8.615850e-47
Msa0050660	Msa1044680	0.852618	4.101355e-61	-8.615850e-47
Msa0050660	Msa1049280	0.809291	2.034280e-50	-8.615850e-47
Msa0050660	Msa1051420	0.821200	4.582706e-53	-8.615850e-47
Msa0050660	Msa1051900	0.813487	2.497401e-51	-8.615850e-47
Msa0050660	Msa1059020	0.845482	3.952363e-59	-8.615850e-47
Msa0050660	Msa1068400	0.802348	5.855671e-49	-8.615850e-47
Msa0050660	Msa1068920	0.815892	7.322135e-52	-8.615850e-47
Msa0050660	Msa1072940	0.840191	1.009028e-57	-8.615850e-47
Msa0050660	Msa1074370	0.804510	2.086694e-49	-8.615850e-47
Msa0050660	Msa1074600	0.846541	2.035540e-59	-8.615850e-47
Msa0050660	Msa1074860	0.804208	2.412303e-49	-8.615850e-47
Msa0050660	Msa1078820	0.860886	1.510860e-63	-8.615850e-47
Msa0050660	Msa1078880	0.854605	1.101062e-61	-8.615850e-47
Msa0050660	Msa1078970	0.860167	2.494421e-63	-8.615850e-47
Msa0050660	Msa1080000	0.855516	5.987878e-62	-8.615850e-47
Msa0050660	Msa1081390	0.843503	1.346671e-58	-8.615850e-47
Msa0050660	Msa1081690	0.868594	5.813248e-66	-8.615850e-47
Msa0050660	Msa1082200	0.819386	1.193675e-52	-8.615850e-47
Msa0050660	Msa1084530	0.847697	9.813034e-60	-8.615850e-47
Msa0050660	Msa1090140	0.803012	4.271151e-49	-8.615850e-47
Msa0050660	Msa1094010	0.800856	1.184526e-48	-8.615850e-47
Msa0050660	Msa1096960	0.806331	8.665781e-50	-8.615850e-47
Msa0050660	Msa1104220	0.819445	1.157320e-52	-8.615850e-47
Msa0050660	Msa1105640	0.863058	3.264382e-64	-8.615850e-47
Msa0050660	Msa1105780	0.816790	4.611313e-52	-8.615850e-47
Msa0050660	Msa1116220	0.852385	4.780440e-61	-8.615850e-47
Msa0050660	Msa1116660	0.845884	3.072987e-59	-8.615850e-47
Msa0050660	Msa1116740	0.805403	1.357929e-49	-8.615850e-47
Msa0050660	Msa1121310	0.814040	1.886495e-51	-8.615850e-47
Msa0050660	Msa1123210	0.849640	2.840453e-60	-8.615850e-47
Msa0050660	Msa1123970	0.866279	3.203006e-65	-8.615850e-47
Msa0050660	Msa1125250	0.810549	1.090811e-50	-8.615850e-47
Msa0050660	Msa1125820	0.853239	2.725640e-61	-8.615850e-47
Msa0050660	Msa1125990	0.852111	5.718344e-61	-8.615850e-47
Msa0050660	Msa1127470	0.802234	6.180871e-49	-8.615850e-47
Msa0050660	Msa1132530	0.845553	3.779652e-59	-8.615850e-47
Msa0050660	Msa1132840	0.835320	1.797533e-56	-8.615850e-47
Msa0050660	Msa1148960	0.844518	7.196045e-59	-8.615850e-47
Msa0050660	Msa1156520	0.816121	6.511745e-52	-8.615850e-47
Msa0050660	Msa1160920	0.828307	9.671116e-55	-8.615850e-47
Msa0050660	Msa1162180	0.834334	3.182393e-56	-8.615850e-47
Msa0050660	Msa1162880	0.819902	9.100088e-53	-8.615850e-47
Msa0050660	Msa1166190	0.845990	2.876977e-59	-8.615850e-47
Msa0050660	Msa1166290	0.840045	1.101351e-57	-8.615850e-47
Msa0050660	Msa1167470	0.906388	1.564536e-80	-8.615850e-47
Msa0050660	Msa1169190	0.852589	4.179484e-61	-8.615850e-47
Msa0050660	Msa1169650	0.860227	2.391813e-63	-8.615850e-47
Msa0050660	Msa1171290	0.837950	3.841590e-57	-8.615850e-47
Msa0050660	Msa1176260	0.810555	1.087489e-50	-8.615850e-47
Msa0050660	Msa1187760	0.810841	9.433784e-51	-8.615850e-47
Msa0050660	Msa1192560	0.838902	2.182103e-57	-8.615850e-47
Msa0050660	Msa1192570	0.809925	1.486740e-50	-8.615850e-47
Msa0050660	Msa1192590	0.839226	1.798970e-57	-8.615850e-47
Msa0050660	Msa1194240	0.828535	8.518112e-55	-8.615850e-47
Msa0050660	Msa1198540	0.800944	1.136358e-48	-8.615850e-47
Msa0050660	Msa1200890	0.803936	2.748155e-49	-8.615850e-47
Msa0050660	Msa1203300	0.828147	1.056607e-54	-8.615850e-47
Msa0050660	Msa1208950	0.840196	1.005507e-57	-8.615850e-47
Msa0050660	Msa1209320	0.812641	3.827765e-51	-8.615850e-47
Msa0050660	Msa1209720	0.808067	3.716100e-50	-8.615850e-47
Msa0050660	Msa1211240	0.815510	8.908026e-52	-8.615850e-47
Msa0050660	Msa1211640	0.801856	7.390504e-49	-8.615850e-47
Msa0050660	Msa1213830	0.820842	5.539065e-53	-8.615850e-47
Msa0050660	Msa1214350	0.835083	2.062891e-56	-8.615850e-47
Msa0050660	Msa1215870	0.842626	2.305546e-58	-8.615850e-47
Msa0050660	Msa1216090	0.800287	1.546937e-48	-8.615850e-47
Msa0050660	Msa1216110	0.828881	7.024828e-55	-8.615850e-47
Msa0050660	Msa1217230	0.846537	2.040991e-59	-8.615850e-47
Msa0050660	Msa1218820	0.802542	5.339269e-49	-8.615850e-47
Msa0050660	Msa1223390	0.815477	9.062910e-52	-8.615850e-47
Msa0050660	Msa1223570	0.822112	2.819972e-53	-8.615850e-47
Msa0050660	Msa1226520	0.834834	2.382718e-56	-8.615850e-47
Msa0050660	Msa1228580	0.803000	4.295263e-49	-8.615850e-47
Msa0050660	Msa1228630	0.835653	1.480795e-56	-8.615850e-47
Msa0050660	Msa1231700	0.823149	1.617808e-53	-8.615850e-47
Msa0050660	Msa1240770	0.844792	6.069718e-59	-8.615850e-47
Msa0050660	Msa1244240	0.819485	1.132818e-52	-8.615850e-47
Msa0050660	Msa1254540	0.839979	1.145948e-57	-8.615850e-47
Msa0050660	Msa1261050	0.822351	2.482084e-53	-8.615850e-47
Msa0050660	Msa1262570	0.816001	6.926003e-52	-8.615850e-47
Msa0050660	Msa1263490	0.801248	9.850082e-49	-8.615850e-47
Msa0050660	Msa1263740	0.828333	9.530903e-55	-8.615850e-47
Msa0050660	Msa1263780	0.862880	3.705069e-64	-8.615850e-47
Msa0050660	Msa1265650	0.835465	1.651876e-56	-8.615850e-47
Msa0050660	Msa1268630	0.825880	3.682983e-54	-8.615850e-47
Msa0050660	Msa1277640	0.866219	3.345801e-65	-8.615850e-47
Msa0050660	Msa1282260	0.826905	2.099257e-54	-8.615850e-47
Msa0050660	Msa1290380	0.802061	6.706136e-49	-8.615850e-47
Msa0050660	Msa1292840	0.812142	4.919321e-51	-8.615850e-47
Msa0050660	Msa1294460	0.810311	1.227900e-50	-8.615850e-47
Msa0050660	Msa1296950	0.824162	9.369495e-54	-8.615850e-47
Msa0050660	Msa1300460	0.834929	2.256048e-56	-8.615850e-47
Msa0050660	Msa1303560	0.830766	2.440811e-55	-8.615850e-47
Msa0050660	Msa1303650	0.837220	5.911000e-57	-8.615850e-47
Msa0050660	Msa1308850	0.819816	9.522296e-53	-8.615850e-47
Msa0050660	Msa1315130	0.809401	1.927176e-50	-8.615850e-47
Msa0050660	Msa1315160	0.848150	7.360219e-60	-8.615850e-47
Msa0050660	Msa1316330	0.853155	2.880713e-61	-8.615850e-47
Msa0050660	Msa1321340	0.836993	6.756863e-57	-8.615850e-47
Msa0050660	Msa1321530	0.802141	6.458042e-49	-8.615850e-47
Msa0050660	Msa1327800	0.810016	1.421116e-50	-8.615850e-47
Msa0050660	Msa1332630	0.835500	1.618300e-56	-8.615850e-47
Msa0050660	Msa1332950	0.827533	1.484087e-54	-8.615850e-47
Msa0050660	Msa1342810	0.842314	2.789622e-58	-8.615850e-47
Msa0050660	Msa1343170	0.854029	1.615502e-61	-8.615850e-47
Msa0050660	Msa1343180	0.853218	2.762977e-61	-8.615850e-47
Msa0050660	Msa1352310	0.825572	4.356898e-54	-8.615850e-47
Msa0050660	Msa1359690	0.830530	2.788088e-55	-8.615850e-47
Msa0050660	Msa1359980	0.815368	9.580507e-52	-8.615850e-47
Msa0050660	Msa1362130	0.804896	1.733017e-49	-8.615850e-47
Msa0050660	Msa1362620	0.835193	1.934575e-56	-8.615850e-47
Msa0050660	Msa1364040	0.803471	3.431977e-49	-8.615850e-47
Msa0050660	Msa1364410	0.830806	2.386833e-55	-8.615850e-47
Msa0050660	Msa1364680	0.815147	1.072908e-51	-8.615850e-47
Msa0050660	Msa1368750	0.857500	1.564800e-62	-8.615850e-47
Msa0050660	Msa1372040	0.839543	1.487632e-57	-8.615850e-47
Msa0050660	Msa1374790	0.863274	2.797294e-64	-8.615850e-47
Msa0050660	Msa1375350	0.803333	3.665209e-49	-8.615850e-47
Msa0050660	Msa1381180	0.819325	1.232244e-52	-8.615850e-47
Msa0050660	Msa1382300	0.802666	5.034400e-49	-8.615850e-47
Msa0050660	Msa1383310	0.833682	4.634967e-56	-8.615850e-47
Msa0050660	Msa1384150	0.834119	3.603926e-56	-8.615850e-47
Msa0050660	Msa1384460	0.869162	3.807258e-66	-8.615850e-47
Msa0050660	Msa1387620	0.809244	2.082347e-50	-8.615850e-47
Msa0050660	Msa1393780	0.886314	3.808255e-72	-8.615850e-47
Msa0050660	Msa1397400	0.808658	2.778938e-50	-8.615850e-47
Msa0050660	Msa1400010	0.815107	1.095099e-51	-8.615850e-47
Msa0050660	Msa1400710	0.800687	1.282307e-48	-8.615850e-47
Msa0050660	Msa1405460	0.846582	1.984626e-59	-8.615850e-47
Msa0050660	Msa1406720	0.822548	2.233677e-53	-8.615850e-47
Msa0050660	Msa1409410	0.896040	5.400993e-76	-8.615850e-47
Msa0050660	Msa1410160	0.849125	3.951879e-60	-8.615850e-47
Msa0050660	Msa1411790	0.845659	3.538340e-59	-8.615850e-47
Msa0050660	Msa1413940	0.811501	6.782497e-51	-8.615850e-47
Msa0050660	Msa1414170	0.836654	8.246578e-57	-8.615850e-47
Msa0050660	Msa1415540	0.891155	5.143471e-74	-8.615850e-47
Msa0050660	Msa1417370	0.846544	2.032378e-59	-8.615850e-47
Msa0050660	Msa1427100	0.819723	9.999419e-53	-8.615850e-47
Msa0050660	Msa1431480	0.864975	8.258365e-65	-8.615850e-47
Msa0050660	Msa1433790	0.832402	9.649432e-56	-8.615850e-47
Msa0050660	Msa1433860	0.804727	1.879778e-49	-8.615850e-47
Msa0050660	Msa1435960	0.801908	7.209578e-49	-8.615850e-47
Msa0050660	Msa1437930	0.809842	1.549668e-50	-8.615850e-47
Msa0050660	Msa1440630	0.991652	8.465482e-189	-8.615850e-47
Msa0050660	Msa1445120	0.812928	3.312799e-51	-8.615850e-47
Msa0050660	Msa1449480	0.808067	3.715426e-50	-8.615850e-47
Msa0050660	Msa1450190	0.825512	4.501855e-54	-8.615850e-47
Msa0050660	Msa1451820	0.865915	4.175000e-65	-8.615850e-47
Msa0050660	Msa1452140	0.879430	1.254742e-69	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050660	MtrunA17_Chr1g0155761	96.774	403	2	5	1	395	1	400	0.0	769
Msa0050660	MtrunA17_Chr3g0142131	82.663	398	62	6	1	395	1	394	0.0	636
Msa0050660	MtrunA17_Chr6g0483401	57.808	365	122	4	30	394	19	351	1.78e-141	407
Msa0050660	MtrunA17_Chr5g0407971	41.003	339	199	1	18	356	8	345	3.63e-85	264
Msa0050660	MtrunA17_Chr5g0407991	37.958	382	198	4	18	382	6	365	2.60e-84	262
Msa0050660	MtrunA17_Chr5g0408001	37.403	385	204	4	18	383	7	373	8.47e-84	260
Msa0050660	MtrunA17_Chr5g0408041	40.331	362	209	3	23	382	13	369	5.08e-83	259
Msa0050660	MtrunA17_Chr5g0408031	39.888	356	205	3	18	371	7	355	2.36e-82	256
Msa0050660	MtrunA17_Chr1g0160171	38.764	356	194	3	1	354	1	334	6.78e-80	250
Msa0050660	MtrunA17_Chr7g0255561	38.551	345	189	2	18	356	11	338	2.59e-79	249
Msa0050660	MtrunA17_Chr7g0255581	38.551	345	189	2	18	356	11	338	2.59e-79	249
Msa0050660	MtrunA17_Chr8g0369841	38.596	342	203	4	18	356	6	343	3.97e-79	248
Msa0050660	MtrunA17_Chr8g0354121	38.643	339	196	2	18	355	10	337	3.90e-77	244
Msa0050660	MtrunA17_Chr3g0114691	36.047	344	207	2	18	361	17	347	8.95e-77	243
Msa0050660	MtrunA17_Chr1g0160181	39.003	341	194	2	23	362	20	347	1.09e-76	242
Msa0050660	MtrunA17_Chr1g0186641	36.338	355	207	5	18	370	10	347	5.44e-76	239
Msa0050660	MtrunA17_Chr5g0404811	47.348	264	113	4	129	387	1	243	1.09e-75	235
Msa0050660	MtrunA17_Chr1g0186601	35.754	358	210	4	18	373	13	352	1.68e-75	238
Msa0050660	MtrunA17_Chr1g0186611	34.734	357	213	3	18	372	13	351	3.64e-75	237
Msa0050660	MtrunA17_Chr1g0171301	34.454	357	216	4	9	362	2	343	4.76e-75	237
Msa0050660	MtrunA17_Chr3g0081421	38.841	345	194	4	14	354	9	340	2.12e-74	236
Msa0050660	MtrunA17_Chr2g0284261	35.398	339	202	2	18	356	5	326	1.02e-73	234
Msa0050660	MtrunA17_Chr6g0463971	35.795	352	205	4	15	362	10	344	1.27e-72	231
Msa0050660	MtrunA17_Chr3g0081511	38.551	345	185	4	18	355	14	338	1.79e-72	231
Msa0050660	MtrunA17_Chr8g0334761	38.081	344	197	4	12	354	1	329	3.65e-72	230
Msa0050660	MtrunA17_Chr1g0164831	34.930	355	210	5	24	378	6	339	8.56e-72	228
Msa0050660	MtrunA17_Chr1g0186561	36.857	350	202	4	18	365	13	345	3.09e-71	227
Msa0050660	MtrunA17_Chr1g0186571	34.770	348	207	5	18	363	10	339	1.28e-70	226
Msa0050660	MtrunA17_Chr3g0114731	37.952	332	189	2	23	354	20	334	1.82e-70	226
Msa0050660	MtrunA17_Chr7g0271561	35.045	331	207	1	24	354	10	332	9.61e-69	221
Msa0050660	MtrunA17_Chr1g0182291	36.364	341	193	3	18	354	12	332	2.13e-68	220
Msa0050660	MtrunA17_Chr2g0310441	36.461	373	213	8	24	388	13	369	6.82e-68	219
Msa0050660	MtrunA17_Chr4g0059311	34.024	338	207	4	25	361	15	337	7.71e-68	218
Msa0050660	MtrunA17_Chr3g0114711	34.492	374	192	4	18	354	11	368	1.47e-67	219
Msa0050660	MtrunA17_Chr3g0129601	33.511	376	212	4	6	368	14	364	5.05e-66	214
Msa0050660	MtrunA17_Chr1g0184221	32.133	361	206	4	18	361	13	351	1.24e-65	213
Msa0050660	MtrunA17_Chr7g0263101	35.988	339	187	4	24	354	16	332	1.59e-65	213
Msa0050660	MtrunA17_Chr3g0114701	37.612	335	195	2	23	356	11	332	1.12e-64	211
Msa0050660	MtrunA17_Chr2g0278561	33.938	386	227	4	10	385	4	371	1.69e-64	211
Msa0050660	MtrunA17_Chr8g0383731	35.329	334	205	2	23	355	7	330	9.65e-64	207
Msa0050660	MtrunA17_Chr1g0160111	32.923	325	209	2	30	354	16	331	2.35e-63	207
Msa0050660	MtrunA17_Chr3g0126101	35.220	318	186	4	38	354	23	321	7.04e-62	202
Msa0050660	MtrunA17_Chr3g0129571	33.134	335	209	5	23	354	9	331	5.56e-61	201
Msa0050660	MtrunA17_Chr8g0334771	36.337	344	203	3	12	354	1	329	3.48e-60	199
Msa0050660	MtrunA17_Chr3g0129591	33.832	334	208	3	23	354	7	329	4.42e-60	198
Msa0050660	MtrunA17_Chr4g0073241	32.984	382	216	9	24	395	11	362	3.80e-59	196
Msa0050660	MtrunA17_Chr8g0334751	35.676	370	212	6	24	392	14	358	1.78e-58	194
Msa0050660	MtrunA17_Chr5g0413961	35.530	349	204	3	11	357	2	331	3.78e-58	193
Msa0050660	MtrunA17_Chr2g0290611	35.952	331	199	3	26	356	17	334	4.52e-57	191
Msa0050660	MtrunA17_Chr2g0278541	35.362	345	200	4	24	360	15	344	1.71e-55	187
Msa0050660	MtrunA17_Chr2g0278551	34.294	347	213	3	26	372	17	348	4.40e-55	186
Msa0050660	MtrunA17_Chr5g0413941	31.579	342	217	4	16	356	2	327	1.65e-54	184
Msa0050660	MtrunA17_Chr5g0413921	30.347	346	224	3	18	362	4	333	9.99e-53	179
Msa0050660	MtrunA17_Chr4g0050891	32.081	346	213	3	10	349	2	331	5.91e-52	177
Msa0050660	MtrunA17_Chr3g0129581	32.036	334	214	3	23	354	7	329	6.57e-52	177
Msa0050660	MtrunA17_Chr1g0150151	33.828	337	199	5	25	355	15	333	5.11e-51	175
Msa0050660	MtrunA17_Chr4g0051021	30.270	370	244	3	26	394	19	375	8.97e-51	174
Msa0050660	MtrunA17_Chr5g0404801	68.908	119	37	0	16	134	2	120	2.57e-50	165
Msa0050660	MtrunA17_Chr2g0332001	32.440	336	202	4	26	356	43	358	4.15e-50	173
Msa0050660	MtrunA17_Chr5g0413951	30.514	331	213	5	26	355	12	326	9.72e-50	171
Msa0050660	MtrunA17_Chr5g0428881	29.101	378	247	4	15	383	9	374	2.43e-49	171
Msa0050660	MtrunA17_Chr1g0177221	34.629	283	165	4	1	282	1	264	2.61e-48	165
Msa0050660	MtrunA17_Chr5g0413931	30.514	331	213	5	26	355	11	325	1.70e-46	162
Msa0050660	MtrunA17_Chr4g0050941	31.746	378	241	4	24	395	15	381	1.73e-46	163
Msa0050660	MtrunA17_Chr4g0056081	31.054	351	212	10	25	365	18	348	3.32e-43	154
Msa0050660	MtrunA17_Chr4g0050881	29.679	374	224	8	15	375	3	350	7.64e-43	153
Msa0050660	MtrunA17_Chr7g0227921	31.548	336	204	5	25	355	15	329	8.78e-43	153
Msa0050660	MtrunA17_Chr4g0050931	29.598	348	188	3	14	356	5	300	2.22e-41	148
Msa0050660	MtrunA17_Chr1g0211801	32.685	257	157	3	26	282	16	256	1.29e-40	145
Msa0050660	MtrunA17_Chr5g0441761	27.576	330	219	2	25	354	18	327	1.38e-39	144
Msa0050660	MtrunA17_Chr5g0399281	30.792	341	215	8	18	354	5	328	4.64e-39	143
Msa0050660	MtrunA17_Chr5g0429001	29.126	309	207	3	88	395	18	315	6.62e-38	139
Msa0050660	MtrunA17_Chr3g0084091	31.752	274	169	3	101	373	10	266	2.23e-37	137
Msa0050660	MtrunA17_Chr4g0051001	29.217	332	218	4	5	332	12	330	3.71e-37	137
Msa0050660	MtrunA17_Chr6g0451211	28.704	324	198	7	41	355	32	331	7.70e-37	137
Msa0050660	MtrunA17_Chr6g0451201	29.859	355	224	6	41	395	32	361	4.20e-34	130
Msa0050660	MtrunA17_Chr6g0451251	30.321	343	217	6	41	380	32	355	2.15e-32	125
Msa0050660	MtrunA17_Chr3g0126091	25.723	346	233	8	24	362	14	342	1.15e-31	123
Msa0050660	MtrunA17_Chr6g0451171	28.354	328	213	7	30	355	21	328	2.17e-31	122
Msa0050660	MtrunA17_Chr2g0278021	35.586	222	135	2	135	356	1	214	4.65e-31	119
Msa0050660	MtrunA17_Chr6g0451261	27.124	306	198	5	35	335	25	310	2.17e-30	123
Msa0050660	MtrunA17_Chr8g0334721	38.194	144	84	2	247	390	2	140	7.36e-29	110
Msa0050660	MtrunA17_Chr8g0334711	34.272	213	123	4	18	229	7	203	6.80e-28	109
Msa0050660	MtrunA17_Chr6g0451191	28.054	221	141	3	135	355	1	203	6.06e-21	90.9
Msa0050660	MtrunA17_Chr8g0334731	29.224	219	119	5	13	229	3	187	5.46e-19	84.7
Msa0050660	MtrunA17_Chr1g0177231	38.947	95	57	1	268	362	15	108	4.33e-16	74.3
Msa0050660	MtrunA17_Chr2g0278031	39.815	108	65	0	26	133	19	126	9.99e-15	70.5
Msa0050660	MtrunA17_Chr4g0050911	35.938	128	76	1	106	233	16	137	2.27e-14	70.5
Msa0050660	MtrunA17_Chr1g0182261	33.077	130	84	3	230	356	83	212	2.27e-14	72.0
Msa0050660	MtrunA17_Chr1g0172891	40.541	74	44	0	289	362	13	86	3.01e-14	68.9
Msa0050660	MtrunA17_Chr1g0211811	42.254	71	41	0	284	354	1	71	5.00e-14	67.4
Msa0050660	MtrunA17_Chr4g0050921	33.333	102	68	0	234	335	3	104	6.81e-14	68.2
Msa0050660	MtrunA17_Chr1g0172881	28.667	150	83	4	134	282	23	149	1.08e-11	62.8
Msa0050660	MtrunA17_Chr8g0334741	28.571	140	71	3	247	382	2	116	7.10e-11	59.7

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0050660	AT1G75500.1	74.687	399	87	7	1	395	1	389	0.0	589
Msa0050660	AT1G75500.2	74.687	399	87	7	1	395	1	389	0.0	589
Msa0050660	AT3G53210.1	52.632	380	161	3	16	390	4	369	6.50e-142	409
Msa0050660	AT3G18200.2	56.131	367	144	2	16	382	29	378	4.10e-141	407
Msa0050660	AT3G53210.3	57.143	266	100	2	16	281	4	255	1.85e-105	312
Msa0050660	AT3G53210.2	50.333	300	130	3	96	390	27	312	4.88e-102	305
Msa0050660	AT3G18200.1	50.943	265	113	2	118	382	1	248	1.07e-85	261
Msa0050660	AT3G45870.1	42.169	332	187	3	18	349	8	334	1.44e-77	245
Msa0050660	AT4G30420.2	37.371	388	217	7	18	395	5	376	2.54e-77	244
Msa0050660	AT5G45370.2	37.326	359	222	3	18	375	16	372	2.58e-77	244
Msa0050660	AT5G45370.4	37.326	359	222	3	18	375	16	372	2.58e-77	244
Msa0050660	AT5G45370.1	37.709	358	198	3	18	375	16	348	7.16e-77	242
Msa0050660	AT4G30420.1	36.911	382	215	6	24	395	1	366	1.02e-76	242
Msa0050660	AT5G07050.1	38.136	354	196	3	23	368	19	357	2.42e-74	237
Msa0050660	AT2G39510.1	37.838	333	191	2	24	355	10	327	7.48e-73	232
Msa0050660	AT3G45870.8	41.587	315	179	3	18	332	8	317	1.78e-71	227
Msa0050660	AT1G09380.1	38.602	329	191	1	24	352	10	327	3.06e-71	228
Msa0050660	AT4G08290.1	35.733	375	228	2	18	392	9	370	3.41e-71	228
Msa0050660	AT1G21890.1	34.262	359	230	1	23	381	12	364	5.70e-71	228
Msa0050660	AT1G44800.1	34.188	351	210	2	18	362	7	342	8.25e-71	227
Msa0050660	AT4G08300.1	34.384	349	215	3	18	365	7	342	2.54e-70	226
Msa0050660	AT4G19185.1	39.169	337	198	4	23	356	22	354	6.48e-70	225
Msa0050660	AT3G30340.1	33.828	337	209	3	26	362	15	337	2.64e-68	220
Msa0050660	AT2G40900.1	36.522	345	199	3	12	356	1	325	2.88e-68	221
Msa0050660	AT2G37460.1	35.674	356	205	6	18	369	11	346	3.63e-66	215
Msa0050660	AT1G43650.1	33.144	353	216	2	23	373	8	342	5.31e-63	206
Msa0050660	AT5G13670.1	33.628	339	211	3	18	355	4	329	3.49e-62	205
Msa0050660	AT4G01440.1	35.294	323	194	3	41	363	29	336	2.70e-61	202
Msa0050660	AT4G01430.1	33.934	333	205	4	24	354	11	330	1.52e-60	200
Msa0050660	AT1G01070.1	33.626	342	212	3	16	356	10	337	8.08e-60	198
Msa0050660	AT1G11450.3	35.030	334	200	4	24	356	18	335	1.17e-59	197
Msa0050660	AT3G45870.9	42.264	265	148	3	18	282	8	267	2.35e-59	194
Msa0050660	AT1G21890.2	35.161	310	195	1	23	332	12	315	4.05e-59	196
Msa0050660	AT3G56620.1	33.721	344	203	3	12	352	1	322	3.57e-58	194
Msa0050660	AT4G01440.3	35.959	292	172	3	41	332	29	305	7.71e-56	186
Msa0050660	AT1G11450.5	36.156	307	179	4	51	356	1	291	1.32e-55	186
Msa0050660	AT5G64700.1	31.686	344	227	3	29	372	15	350	1.24e-54	184
Msa0050660	AT1G11460.1	33.234	334	207	3	24	356	18	336	3.44e-54	182
Msa0050660	AT1G11450.2	36.577	298	172	4	60	356	3	284	3.69e-54	181
Msa0050660	AT4G28040.1	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050660	AT4G28040.5	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050660	AT4G28040.3	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050660	AT4G28040.4	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050660	AT4G28040.2	31.471	340	203	5	18	354	4	316	1.66e-53	181
Msa0050660	AT4G01430.2	33.119	311	193	4	24	332	11	308	8.13e-52	176
Msa0050660	AT1G11450.4	34.194	310	187	4	24	332	18	311	8.54e-51	173
Msa0050660	AT4G19185.2	36.604	265	161	4	95	356	16	276	3.55e-50	172
Msa0050660	AT2G37450.2	33.140	344	185	8	24	363	11	313	5.29e-50	172
Msa0050660	AT5G45370.6	34.926	272	174	3	105	375	1	270	2.09e-49	168
Msa0050660	AT5G45370.5	34.926	272	174	3	105	375	1	270	2.09e-49	168
Msa0050660	AT1G25270.1	32.934	334	209	2	24	356	5	324	7.68e-49	169
Msa0050660	AT1G68170.2	30.607	379	243	4	14	391	5	364	3.18e-48	168
Msa0050660	AT1G01070.2	33.793	290	177	3	68	356	15	290	3.45e-48	166
Msa0050660	AT4G08290.2	36.604	265	153	3	18	281	9	259	5.22e-48	165
Msa0050660	AT1G68170.1	31.250	368	233	4	25	391	6	354	1.84e-47	166
Msa0050660	AT5G40210.1	31.953	338	189	10	25	357	16	317	5.86e-47	164
Msa0050660	AT3G28130.2	32.653	343	202	10	22	356	13	334	5.96e-47	164
Msa0050660	AT4G01450.2	35.238	315	183	2	41	354	29	323	1.02e-46	164
Msa0050660	AT3G30340.2	32.685	257	159	3	26	282	15	257	1.11e-45	159
Msa0050660	AT1G11450.1	36.822	258	146	4	100	356	2	243	4.07e-45	157
Msa0050660	AT4G01450.1	34.471	293	171	2	41	332	29	301	5.09e-45	159
Msa0050660	AT5G40240.2	28.846	364	233	4	1	357	13	357	9.22e-45	159
Msa0050660	AT5G40240.1	30.000	340	212	4	25	357	23	343	1.04e-44	159
Msa0050660	AT5G40240.3	30.000	340	212	4	25	357	23	343	1.04e-44	159
Msa0050660	AT3G28050.1	31.267	371	223	10	25	387	15	361	1.20e-44	158
Msa0050660	AT4G01440.4	36.777	242	138	3	41	282	29	255	4.09e-44	154
Msa0050660	AT3G28100.1	30.286	350	219	8	25	370	17	345	1.19e-43	155
Msa0050660	AT5G40230.1	29.223	373	223	7	25	384	24	368	1.79e-43	155
Msa0050660	AT3G28130.5	33.594	256	149	6	105	356	10	248	2.42e-42	149
Msa0050660	AT3G28130.1	33.594	256	149	6	105	356	10	248	2.42e-42	149
Msa0050660	AT1G70260.1	29.462	353	233	5	24	370	14	356	8.18e-41	148
Msa0050660	AT3G28080.1	30.473	338	210	6	25	356	17	335	9.99e-41	148
Msa0050660	AT3G28070.2	29.740	269	168	5	105	371	8	257	2.55e-40	144
Msa0050660	AT3G28080.5	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050660	AT3G28080.7	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050660	AT3G28080.8	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050660	AT3G28080.6	31.621	253	158	3	105	356	8	246	4.51e-40	144
Msa0050660	AT3G45870.5	38.426	216	128	3	134	349	49	259	1.92e-39	143
Msa0050660	AT3G28070.1	29.740	269	168	5	105	371	100	349	2.64e-39	144
Msa0050660	AT3G28080.2	31.621	253	158	3	105	356	89	327	2.74e-39	144
Msa0050660	AT4G01450.4	34.156	243	139	2	41	282	29	251	2.67e-38	139
Msa0050660	AT4G01440.5	32.365	241	148	3	123	363	3	228	3.92e-38	138
Msa0050660	AT4G01440.2	32.365	241	148	3	123	363	3	228	3.92e-38	138
Msa0050660	AT5G47470.1	27.920	351	225	7	9	354	17	344	2.60e-37	139
Msa0050660	AT5G47470.2	27.920	351	225	7	9	354	45	372	3.34e-37	139
Msa0050660	AT5G47470.3	27.920	351	225	7	9	354	45	372	4.26e-37	139
Msa0050660	AT2G37450.3	34.100	261	148	6	107	363	1	241	5.97e-37	135
Msa0050660	AT5G45370.3	32.780	241	159	3	136	375	74	312	8.77e-37	136
Msa0050660	AT1G43650.2	31.274	259	160	1	23	281	8	248	9.42e-36	132
Msa0050660	AT4G15540.1	28.011	357	224	5	25	380	20	344	1.79e-34	130
Msa0050660	AT4G15540.2	28.011	357	224	5	25	380	20	344	1.79e-34	130
Msa0050660	AT4G16620.1	27.966	354	230	6	30	375	20	356	8.57e-34	129
Msa0050660	AT3G45870.6	37.186	199	120	3	134	332	49	242	1.40e-33	126
Msa0050660	AT3G45870.7	37.186	199	120	3	134	332	49	242	1.40e-33	126
Msa0050660	AT4G01450.3	35.071	211	116	2	41	250	29	219	4.15e-33	124
Msa0050660	AT5G64700.2	32.500	240	154	3	29	268	15	246	3.07e-32	122
Msa0050660	AT3G45870.2	37.234	188	113	3	162	349	1	183	1.24e-30	117
Msa0050660	AT1G60050.1	27.554	323	221	3	38	356	29	342	1.28e-30	121
Msa0050660	AT3G28130.3	30.973	226	135	6	135	356	1	209	3.62e-30	116
Msa0050660	AT3G28070.3	28.261	230	148	4	105	332	100	314	6.77e-29	115
Msa0050660	AT4G01430.3	31.220	205	127	3	151	354	2	193	1.60e-28	112
Msa0050660	AT3G28070.5	26.778	239	154	5	135	371	1	220	1.30e-27	109
Msa0050660	AT3G28080.9	28.251	223	145	3	135	356	1	209	1.64e-27	109
Msa0050660	AT2G37450.1	32.479	234	134	6	134	363	61	274	6.42e-27	109
Msa0050660	AT4G24980.1	28.302	318	147	8	38	355	3	239	8.75e-26	105
Msa0050660	AT3G28130.4	31.783	258	148	9	22	271	13	250	2.20e-24	101
Msa0050660	AT3G28100.3	31.076	251	153	6	25	271	17	251	1.01e-23	99.8
Msa0050660	AT4G16620.4	27.536	276	176	5	107	375	1	259	1.71e-23	99.0
Msa0050660	AT4G16620.2	27.536	276	176	5	107	375	1	259	1.71e-23	99.0
Msa0050660	AT3G45870.3	36.913	149	89	3	134	282	49	192	1.94e-21	92.0
Msa0050660	AT3G45870.4	36.735	147	88	3	136	282	4	145	2.03e-21	90.5
Msa0050660	AT3G28100.2	37.342	158	95	3	25	180	17	172	4.35e-21	92.0
Msa0050660	AT3G28130.6	36.943	157	91	4	22	174	13	165	2.10e-20	89.4
Msa0050660	AT4G16620.3	29.279	222	139	4	30	250	20	224	5.79e-20	89.4
Msa0050660	AT3G28080.3	36.025	161	93	3	25	180	17	172	7.97e-17	80.9
Msa0050660	AT3G28080.3	33.784	74	48	1	283	356	209	281	8.84e-11	62.8
Msa0050660	AT3G28080.4	46.053	76	41	0	105	180	8	83	4.90e-16	77.0
Msa0050660	AT3G28080.4	33.784	74	48	1	283	356	120	192	5.13e-11	62.4

Find 113 sgRNAs with CRISPR-Local

Find 193 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ACAACACCAATGATTGATTT+TGG	0.075897	1_2:+4616339	Msa0050660:CDS
CAAACTAGTGTTGGTTAATT+AGG	0.160697	1_2:-4614924	None:intergenic
CTTGGATGTCTTTATCTAAT+TGG	0.160867	1_2:+4616402	Msa0050660:CDS
TTTGCTAGGCTTCAATTATT+TGG	0.186662	1_2:+4614950	Msa0050660:five_prime_UTR
TCTTCCATTTGCTTATTTCT+TGG	0.199338	1_2:+4615228	Msa0050660:CDS
TATTCTACAATGGCTGATTT+AGG	0.205011	1_2:+4615025	Msa0050660:exon
TTTCTTTATGGTTTGATTTA+CGG	0.229174	1_2:+4617758	Msa0050660:three_prime_UTR
TATGTTAGTTAATTTCTTTA+TGG	0.244766	1_2:+4617746	Msa0050660:three_prime_UTR
CTTAAACGGGGTCATCATTT+TGG	0.252308	1_2:+4617926	Msa0050660:three_prime_UTR
ACTTCCTATACATGTTTCTT+TGG	0.256420	1_2:+4616501	Msa0050660:CDS
ATCAGTGATTACATTATATC+AGG	0.276969	1_2:+4616251	Msa0050660:CDS
TTGCATTTGCAGTACAAATA+TGG	0.283549	1_2:+4616726	Msa0050660:CDS
GCAATTTCTTCTTATTGCTT+TGG	0.291149	1_2:+4616530	Msa0050660:CDS
TGGGAGTGGTTTCAAAAGTA+TGG	0.304445	1_2:+4617859	Msa0050660:three_prime_UTR
AAATTTCTCAAGATTAGAAT+TGG	0.317880	1_2:+4617839	Msa0050660:three_prime_UTR
ATCATGGCTTCTATTGCTTT+AGG	0.322920	1_2:+4616815	Msa0050660:CDS
CTAATTAACCAACACTAGTT+TGG	0.326664	1_2:+4614925	Msa0050660:five_prime_UTR
GATGCTTTAGCGTGGCTTGC+GGG	0.332227	1_2:-4617474	None:intergenic
CAGAGGAAGTTTAAATTAAT+CGG	0.338959	1_2:-4615698	None:intergenic
CTAACTAACCGCGTATAAAA+TGG	0.340348	1_2:-4616607	None:intergenic
GGTTTCAAAAGTATGGTAAT+TGG	0.340685	1_2:+4617866	Msa0050660:three_prime_UTR
CCTTTATATTACAGGATCAT+TGG	0.349819	1_2:+4617336	Msa0050660:intron
CCACTATTTAAGTGACTACT+TGG	0.366846	1_2:-4616297	None:intergenic
CACAAATTGTGACTCTTAAA+CGG	0.370000	1_2:+4617912	Msa0050660:three_prime_UTR
ATCAAGGTTTCTACTTGCTT+GGG	0.374867	1_2:+4615981	Msa0050660:CDS
AATCAAGGTTTCTACTTGCT+TGG	0.382223	1_2:+4615980	Msa0050660:CDS
TCTTAGTAGATTATTTAGAT+TGG	0.388213	1_2:+4617620	Msa0050660:three_prime_UTR
CACACAAGCATGGTACTATA+AGG	0.389716	1_2:-4617565	None:intergenic
ATTGTTTGTCTTGGTCTGCT+TGG	0.391168	1_2:+4616427	Msa0050660:CDS
CTTAGTAGATTATTTAGATT+GGG	0.394466	1_2:+4617621	Msa0050660:three_prime_UTR
TTGCAGGGAGTGGTGGCATC+TGG	0.399814	1_2:+4616701	Msa0050660:intron
GCCCTGCAGTTTGGTTATGC+TGG	0.404103	1_2:+4615115	Msa0050660:CDS
TAATTGGACATTGTTTGTCT+TGG	0.407693	1_2:+4616418	Msa0050660:CDS
GCCATGTTGGCCCTGCAGTT+TGG	0.410120	1_2:+4615106	Msa0050660:CDS
ACAAATTGTGACTCTTAAAC+GGG	0.414592	1_2:+4617913	Msa0050660:three_prime_UTR
GCTACAACAAAAGTTTGAAC+AGG	0.438205	1_2:-4616791	None:intergenic
AACAGGATTACAGCAAATCA+AGG	0.453990	1_2:+4615965	Msa0050660:intron
GCAATGATGTTCCTATAGAC+AGG	0.454821	1_2:-4615193	None:intergenic
TTGAAAGAAATGCTCAGGCT+TGG	0.458050	1_2:+4616556	Msa0050660:CDS
ATGGGAACATGTTGTAATAG+TGG	0.458354	1_2:+4617661	Msa0050660:three_prime_UTR
GGACTTGGACTATATATAGT+TGG	0.461139	1_2:-4616276	None:intergenic
CCCTGCCATTACATTTCTCA+TGG	0.470693	1_2:+4616051	Msa0050660:CDS
AATTTCTCAAGATTAGAATT+GGG	0.471413	1_2:+4617840	Msa0050660:three_prime_UTR
CCAAGTAGTCACTTAAATAG+TGG	0.472865	1_2:+4616297	Msa0050660:CDS
ATTGTCCCAAAATCAATCAT+TGG	0.475219	1_2:-4616345	None:intergenic
TTCAAGAGCTGCACTTAACA+TGG	0.475828	1_2:+4615150	Msa0050660:CDS
TTAATTACTAAAGCTAATAG+TGG	0.477006	1_2:+4618043	Msa0050660:three_prime_UTR
AAGTCCAAAGAAACATGTAT+AGG	0.477885	1_2:-4616505	None:intergenic
CAAATATGGTGCATTGATAG+AGG	0.486474	1_2:+4616740	Msa0050660:CDS
GACGAGCAGGATACTTCTTA+AGG	0.487109	1_2:-4616470	None:intergenic
GATGGAATTGCTAAAGTAGC+AGG	0.489379	1_2:+4616204	Msa0050660:CDS
TTGGTTAATTAGGAAAAGAA+AGG	0.496181	1_2:-4614914	None:intergenic
TTTAAGTGACTACTTGGACT+TGG	0.498895	1_2:-4616291	None:intergenic
AGAAATAAGCAAATGGAAGA+AGG	0.501047	1_2:-4615225	None:intergenic
TGGACTATACTTTGTGCTGT+GGG	0.502383	1_2:+4617377	Msa0050660:CDS
TTCTCATGGCAGTCATACTA+AGG	0.503575	1_2:+4616065	Msa0050660:CDS
TTTAGGAGAAGAGTTCTACT+TGG	0.503735	1_2:+4616832	Msa0050660:CDS
GCCATGAGAAATGTAATGGC+AGG	0.506658	1_2:-4616052	None:intergenic
GTTAATTAGGAAAAGAAAGG+TGG	0.513729	1_2:-4614911	None:intergenic
AGGTTTCTACTTGCTTGGGT+TGG	0.514004	1_2:+4615985	Msa0050660:CDS
ATAGTGGATGTCACTAAAAG+TGG	0.518080	1_2:+4617677	Msa0050660:three_prime_UTR
AGGAAAAGAAAGGTGGGAAG+TGG	0.518388	1_2:-4614904	None:intergenic
AACCAGCATAACCAAACTGC+AGG	0.522465	1_2:-4615117	None:intergenic
AGTATGGTAATTGGCAAGCA+TGG	0.522694	1_2:+4617875	Msa0050660:three_prime_UTR
GAGAAGAGTTCTACTTGGGC+GGG	0.532422	1_2:+4616837	Msa0050660:CDS
ATGTCACTTGGTGATGCAAA+GGG	0.532729	1_2:+4616366	Msa0050660:CDS
GTGAGATTGAATCGAAAGGA+TGG	0.534056	1_2:+4616186	Msa0050660:CDS
TGTATTGCTGATGCAAAGGT+AGG	0.537203	1_2:-4616019	None:intergenic
CTCAAGATTAGAATTGGGAG+TGG	0.539135	1_2:+4617845	Msa0050660:three_prime_UTR
CTGGACTATACTTTGTGCTG+TGG	0.541801	1_2:+4617376	Msa0050660:CDS
GAAGTGACAGAAAGACGAGC+AGG	0.543364	1_2:-4616483	None:intergenic
TGATACACTGCAACAAACAC+TGG	0.547318	1_2:-4616767	None:intergenic
TTAATTCAATTATTCTACAA+TGG	0.548981	1_2:+4615015	Msa0050660:exon
CATCATTATCATGACATGGA+AGG	0.551192	1_2:+4617812	Msa0050660:three_prime_UTR
TATTAATTTGCAGGGAGTGG+TGG	0.551473	1_2:+4616694	Msa0050660:intron
GTATTGCTGATGCAAAGGTA+GGG	0.556287	1_2:-4616018	None:intergenic
TTAGGAGAAGAGTTCTACTT+GGG	0.557775	1_2:+4616833	Msa0050660:CDS
GCAGGATACTTCTTAAGGAC+AGG	0.559573	1_2:-4616465	None:intergenic
ATCATTATCATGACATGGAA+GGG	0.562114	1_2:+4617813	Msa0050660:three_prime_UTR
AGAGAAGAAATTATTTGCAA+AGG	0.564376	1_2:+4617410	Msa0050660:CDS
TAAAGCAATAGAAGCCATGA+TGG	0.564411	1_2:-4616813	None:intergenic
TCAGCTGCATGTGGCCATGT+TGG	0.564609	1_2:+4615093	Msa0050660:CDS
ACCAAACTGCAGGGCCAACA+TGG	0.565314	1_2:-4615107	None:intergenic
CAGCTTCTTCTAAGAGAATG+TGG	0.569037	1_2:+4615050	Msa0050660:CDS
AATGTCACTTGGTGATGCAA+AGG	0.570694	1_2:+4616365	Msa0050660:CDS
GGTGCAGTGTTGATAGTAGC+TGG	0.570883	1_2:+4617357	Msa0050660:CDS
TAGTGGATGTCACTAAAAGT+GGG	0.571839	1_2:+4617678	Msa0050660:three_prime_UTR
TCTGTTGAAGAAGATAGGAA+TGG	0.578628	1_2:-4617507	None:intergenic
TTAATTAGGAAAAGAAAGGT+GGG	0.579788	1_2:-4614910	None:intergenic
TCAGTGATTACATTATATCA+GGG	0.580478	1_2:+4616252	Msa0050660:CDS
TAATTACTAAAGCTAATAGT+GGG	0.588040	1_2:+4618044	Msa0050660:three_prime_UTR
TGATGCTTTAGCGTGGCTTG+CGG	0.596033	1_2:-4617475	None:intergenic
CAATGATGTTCCTATAGACA+GGG	0.596068	1_2:-4615192	None:intergenic
ATATATATATAAAAGCATAT+GGG	0.599668	1_2:-4617724	None:intergenic
GACTGCCATGAGAAATGTAA+TGG	0.601131	1_2:-4616056	None:intergenic
GTTCTGTATTGCTGATGCAA+AGG	0.604446	1_2:-4616023	None:intergenic
ATAATGACCTAGATGCATGC+TGG	0.606908	1_2:+4617993	Msa0050660:three_prime_UTR
GGAGAAGAGTTCTACTTGGG+CGG	0.607421	1_2:+4616836	Msa0050660:CDS
GTGCAGCTCTTGAAACAACA+TGG	0.618096	1_2:-4615141	None:intergenic
AGGAAGTTTAAATTAATCGG+TGG	0.623492	1_2:-4615695	None:intergenic
GCAAGTGAGATTGAATCGAA+AGG	0.625916	1_2:+4616182	Msa0050660:CDS
TCAAGAGCTGCACTTAACAT+GGG	0.631283	1_2:+4615151	Msa0050660:CDS
CCATGAGAAATGTAATGGCA+GGG	0.635566	1_2:-4616051	None:intergenic
TATCACAACACACACAAGCA+TGG	0.644681	1_2:-4617575	None:intergenic
TAGTCATCATTATCATGACA+TGG	0.647380	1_2:+4617808	Msa0050660:three_prime_UTR
CATATGGGACTAATTTCACA+AGG	0.653189	1_2:-4617709	None:intergenic
TATTGCTGATGCAAAGGTAG+GGG	0.668908	1_2:-4616017	None:intergenic
ATATGGTGCATTGATAGAGG+AGG	0.677817	1_2:+4616743	Msa0050660:CDS
ACCAGCATAACCAAACTGCA+GGG	0.678569	1_2:-4615116	None:intergenic
GGACTATACTTTGTGCTGTG+GGG	0.683443	1_2:+4617378	Msa0050660:CDS
GAGTGAGTGATGCTTTAGCG+TGG	0.695699	1_2:-4617482	None:intergenic
AGTGGATGTCACTAAAAGTG+GGG	0.697940	1_2:+4617679	Msa0050660:three_prime_UTR
CAAATTGTGACTCTTAAACG+GGG	0.725158	1_2:+4617914	Msa0050660:three_prime_UTR

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	AAATTAATTTTATAAATTAA+AGG	+	chr1_2:4615838-4615857	Msa0050660:intron	0.0%
!!!	AAAAATTATTAAAGGTATAA+AGG	-	chr1_2:4615933-4615952	None:intergenic	10.0%
!!	TCAACATAAAAAATTATTAA+AGG	-	chr1_2:4615941-4615960	None:intergenic	10.0%
!!!	ATTTTTTTTTATTAATTTGC+AGG	+	chr1_2:4616685-4616704	Msa0050660:intron	10.0%
!!!	TTTTTTTTTATTAATTTGCA+GGG	+	chr1_2:4616686-4616705	Msa0050660:intron	10.0%
!!!	GAGTTTTTTTTTTTTTTTAT+GGG	+	chr1_2:4617643-4617662	Msa0050660:three_prime_UTR	10.0%
!!!	ATATATATATAAAAGCATAT+GGG	-	chr1_2:4617727-4617746	None:intergenic	10.0%
!!!	TATATATATATAAAAGCATA+TGG	-	chr1_2:4617728-4617747	None:intergenic	10.0%
!!	TTAATTCAATTATTCTACAA+TGG	+	chr1_2:4615015-4615034	Msa0050660:exon	15.0%
!!	AATATTAATGAAATTGTTAG+AGG	-	chr1_2:4615270-4615289	None:intergenic	15.0%
!!	ATAATGTACAAAAATTTCAT+AGG	-	chr1_2:4615298-4615317	None:intergenic	15.0%
!!	AATCCAATATAAAAAAACTT+TGG	-	chr1_2:4615335-4615354	None:intergenic	15.0%
!!!	TTTTTTATGTTGAATTAAAC+AGG	+	chr1_2:4615948-4615967	Msa0050660:intron	15.0%
!!!	AAATTTTGCATGAATTTTTT+TGG	-	chr1_2:4616147-4616166	None:intergenic	15.0%
!!	TATCATAAACATTTGAATTA+AGG	-	chr1_2:4616886-4616905	None:intergenic	15.0%
!!!	AAGTTTTTGTTACTAATTTA+GGG	+	chr1_2:4617168-4617187	Msa0050660:intron	15.0%
!!	TGAATAAAGTAAAATCAAAA+GGG	-	chr1_2:4617304-4617323	None:intergenic	15.0%
!!	ATGAATAAAGTAAAATCAAA+AGG	-	chr1_2:4617305-4617324	None:intergenic	15.0%
!!!	GGAGTTTTTTTTTTTTTTTA+TGG	+	chr1_2:4617642-4617661	Msa0050660:three_prime_UTR	15.0%
!!	TATGTTAGTTAATTTCTTTA+TGG	+	chr1_2:4617746-4617765	Msa0050660:three_prime_UTR	15.0%
!!!	CAACCAAAGTTTTTTTATAT+TGG	+	chr1_2:4615329-4615348	Msa0050660:intron	20.0%
!!!	AACGTGTCAATTTTTATAAA+AGG	-	chr1_2:4615450-4615469	None:intergenic	20.0%
!!!	GAACAATATTTTGTGTAATT+GGG	+	chr1_2:4616226-4616245	Msa0050660:CDS	20.0%
!!!	AACAATATTTTGTGTAATTG+GGG	+	chr1_2:4616227-4616246	Msa0050660:CDS	20.0%
!!	GTATTTACTAAACAACTTAT+CGG	+	chr1_2:4617044-4617063	Msa0050660:intron	20.0%
!!!	TTTGATTGCGATTTTATTTT+TGG	+	chr1_2:4617078-4617097	Msa0050660:intron	20.0%
!!!	CAAGTTTTTGTTACTAATTT+AGG	+	chr1_2:4617167-4617186	Msa0050660:intron	20.0%
!!	TCTTAGTAGATTATTTAGAT+TGG	+	chr1_2:4617620-4617639	Msa0050660:three_prime_UTR	20.0%
!!	CTTAGTAGATTATTTAGATT+GGG	+	chr1_2:4617621-4617640	Msa0050660:three_prime_UTR	20.0%
!!!	TTTCTTTATGGTTTGATTTA+CGG	+	chr1_2:4617758-4617777	Msa0050660:three_prime_UTR	20.0%
!!	AAATTTCTCAAGATTAGAAT+TGG	+	chr1_2:4617839-4617858	Msa0050660:three_prime_UTR	20.0%
!!	AATTTCTCAAGATTAGAATT+GGG	+	chr1_2:4617840-4617859	Msa0050660:three_prime_UTR	20.0%
!!	TTAATTACTAAAGCTAATAG+TGG	+	chr1_2:4618043-4618062	Msa0050660:three_prime_UTR	20.0%
!!	TAATTACTAAAGCTAATAGT+GGG	+	chr1_2:4618044-4618063	Msa0050660:three_prime_UTR	20.0%
!	TTAATTAGGAAAAGAAAGGT+GGG	-	chr1_2:4614913-4614932	None:intergenic	25.0%
!	TTGGTTAATTAGGAAAAGAA+AGG	-	chr1_2:4614917-4614936	None:intergenic	25.0%
!!	TTTTCCAAGAAATAAGCAAA+TGG	-	chr1_2:4615235-4615254	None:intergenic	25.0%
!	TAATGAAATTGTTAGAGGAA+TGG	-	chr1_2:4615265-4615284	None:intergenic	25.0%
!!	TATTTAGTTCCCGTTAAAAT+GGG	-	chr1_2:4615478-4615497	None:intergenic	25.0%
!!	ATATTTAGTTCCCGTTAAAA+TGG	-	chr1_2:4615479-4615498	None:intergenic	25.0%
!	CAGAGGAAGTTTAAATTAAT+CGG	-	chr1_2:4615701-4615720	None:intergenic	25.0%
!!	GGAACAATATTTTGTGTAAT+TGG	+	chr1_2:4616225-4616244	Msa0050660:CDS	25.0%
!	ATCAGTGATTACATTATATC+AGG	+	chr1_2:4616251-4616270	Msa0050660:CDS	25.0%
!	TCAGTGATTACATTATATCA+GGG	+	chr1_2:4616252-4616271	Msa0050660:CDS	25.0%
!	TAATTTAAACCTAATAGTCG+TGG	-	chr1_2:4616633-4616652	None:intergenic	25.0%
!	TTGAATTAAGGATCGTAATT+AGG	-	chr1_2:4616874-4616893	None:intergenic	25.0%
!	GTAACAAAAACTTGATCATA+GGG	-	chr1_2:4617161-4617180	None:intergenic	25.0%
!	AGTAACAAAAACTTGATCAT+AGG	-	chr1_2:4617162-4617181	None:intergenic	25.0%
!	TTGAAGCAAAAAATCATCAT+AGG	+	chr1_2:4617207-4617226	Msa0050660:intron	25.0%
!	TAGGATATACTACTATTGAA+TGG	+	chr1_2:4617226-4617245	Msa0050660:intron	25.0%
!	ATAATACCCCTTTATATTAC+AGG	+	chr1_2:4617328-4617347	Msa0050660:intron	25.0%
!	AATGATCCTGTAATATAAAG+GGG	-	chr1_2:4617337-4617356	None:intergenic	25.0%
!	CAATGATCCTGTAATATAAA+GGG	-	chr1_2:4617338-4617357	None:intergenic	25.0%
!	AGAGAAGAAATTATTTGCAA+AGG	+	chr1_2:4617410-4617429	Msa0050660:CDS	25.0%
	GTTAATTAGGAAAAGAAAGG+TGG	-	chr1_2:4614914-4614933	None:intergenic	30.0%
!!	CAAACTAGTGTTGGTTAATT+AGG	-	chr1_2:4614927-4614946	None:intergenic	30.0%
	CTAATTAACCAACACTAGTT+TGG	+	chr1_2:4614925-4614944	Msa0050660:five_prime_UTR	30.0%
	TTTGCTAGGCTTCAATTATT+TGG	+	chr1_2:4614950-4614969	Msa0050660:five_prime_UTR	30.0%
!	TATTCTACAATGGCTGATTT+AGG	+	chr1_2:4615025-4615044	Msa0050660:exon	30.0%
	AGAAATAAGCAAATGGAAGA+AGG	-	chr1_2:4615228-4615247	None:intergenic	30.0%
!	TCTTCCATTTGCTTATTTCT+TGG	+	chr1_2:4615228-4615247	Msa0050660:CDS	30.0%
	TTCCTTAGCATATTCTCTTA+AGG	+	chr1_2:4615353-4615372	Msa0050660:intron	30.0%
!!	ACGTTTAGTTCCCATTTTAA+CGG	+	chr1_2:4615465-4615484	Msa0050660:intron	30.0%
!	TGTTTCTTTTCCTTTTGTTC+AGG	+	chr1_2:4615663-4615682	Msa0050660:intron	30.0%
	AGGAAGTTTAAATTAATCGG+TGG	-	chr1_2:4615698-4615717	None:intergenic	30.0%
!!!	TTCTTTTTTCTCGCACTTAT+TGG	+	chr1_2:4615725-4615744	Msa0050660:CDS	30.0%
!!!	TCTTTTTTCTCGCACTTATT+GGG	+	chr1_2:4615726-4615745	Msa0050660:CDS	30.0%
	TCATGCAAAATTTCATCAAC+AGG	+	chr1_2:4616154-4616173	Msa0050660:intron	30.0%
!!	ACAACACCAATGATTGATTT+TGG	+	chr1_2:4616339-4616358	Msa0050660:CDS	30.0%
!!	CAACACCAATGATTGATTTT+GGG	+	chr1_2:4616340-4616359	Msa0050660:CDS	30.0%
	ATTGTCCCAAAATCAATCAT+TGG	-	chr1_2:4616348-4616367	None:intergenic	30.0%
	CTTGGATGTCTTTATCTAAT+TGG	+	chr1_2:4616402-4616421	Msa0050660:CDS	30.0%
	TAATTGGACATTGTTTGTCT+TGG	+	chr1_2:4616418-4616437	Msa0050660:CDS	30.0%
	ACTTCCTATACATGTTTCTT+TGG	+	chr1_2:4616501-4616520	Msa0050660:CDS	30.0%
	AAGTCCAAAGAAACATGTAT+AGG	-	chr1_2:4616508-4616527	None:intergenic	30.0%
	GCAATTTCTTCTTATTGCTT+TGG	+	chr1_2:4616530-4616549	Msa0050660:CDS	30.0%
!!!	TTTTATTAATTTGCAGGGAG+TGG	+	chr1_2:4616691-4616710	Msa0050660:intron	30.0%
	TTGCATTTGCAGTACAAATA+TGG	+	chr1_2:4616726-4616745	Msa0050660:CDS	30.0%
	TAAGGATCGTAATTAGGATT+AGG	-	chr1_2:4616868-4616887	None:intergenic	30.0%
	GTATCATTACATAAGATACG+TGG	-	chr1_2:4616973-4616992	None:intergenic	30.0%
	AATGACCTAAAGTGAGATAA+AGG	+	chr1_2:4617002-4617021	Msa0050660:intron	30.0%
	ATGACCTAAAGTGAGATAAA+GGG	+	chr1_2:4617003-4617022	Msa0050660:intron	30.0%
	AATACCCTTTATCTCACTTT+AGG	-	chr1_2:4617010-4617029	None:intergenic	30.0%
	CCAATGATCCTGTAATATAA+AGG	-	chr1_2:4617339-4617358	None:intergenic	30.0%
	CCTTTATATTACAGGATCAT+TGG	+	chr1_2:4617336-4617355	Msa0050660:intron	30.0%
!	CATTTTCTGTTGAAGAAGAT+AGG	-	chr1_2:4617515-4617534	None:intergenic	30.0%
	TAGTCATCATTATCATGACA+TGG	+	chr1_2:4617808-4617827	Msa0050660:three_prime_UTR	30.0%
	ATCATTATCATGACATGGAA+GGG	+	chr1_2:4617813-4617832	Msa0050660:three_prime_UTR	30.0%
!	GGTTTCAAAAGTATGGTAAT+TGG	+	chr1_2:4617866-4617885	Msa0050660:three_prime_UTR	30.0%
	CACAAATTGTGACTCTTAAA+CGG	+	chr1_2:4617912-4617931	Msa0050660:three_prime_UTR	30.0%
	ACAAATTGTGACTCTTAAAC+GGG	+	chr1_2:4617913-4617932	Msa0050660:three_prime_UTR	30.0%
	AGCAAAAACCAAACTAGTGT+TGG	-	chr1_2:4614936-4614955	None:intergenic	35.0%
!!!	ACACTAGTTTGGTTTTTGCT+AGG	+	chr1_2:4614936-4614955	Msa0050660:five_prime_UTR	35.0%
!	CATGCAGCTGAAATTTTTCA+GGG	-	chr1_2:4615084-4615103	None:intergenic	35.0%
!	ACATGCAGCTGAAATTTTTC+AGG	-	chr1_2:4615085-4615104	None:intergenic	35.0%
	TGAAAAATTTCAGCTGCATG+TGG	+	chr1_2:4615084-4615103	Msa0050660:CDS	35.0%
!!	AACTTGTTTTCCCTGTCTAT+AGG	+	chr1_2:4615182-4615201	Msa0050660:CDS	35.0%
	CAATGATGTTCCTATAGACA+GGG	-	chr1_2:4615195-4615214	None:intergenic	35.0%
	TGCCTTAAGAGAATATGCTA+AGG	-	chr1_2:4615358-4615377	None:intergenic	35.0%
!!	CGTTTAGTTCCCATTTTAAC+GGG	+	chr1_2:4615466-4615485	Msa0050660:intron	35.0%
!	TCTTTTCCTTTTGTTCAGGA+AGG	+	chr1_2:4615667-4615686	Msa0050660:intron	35.0%
	TAAGTGCGAGAAAAAAGAAC+TGG	-	chr1_2:4615724-4615743	None:intergenic	35.0%
	AACAGGATTACAGCAAATCA+AGG	+	chr1_2:4615965-4615984	Msa0050660:intron	35.0%
	AATCAAGGTTTCTACTTGCT+TGG	+	chr1_2:4615980-4615999	Msa0050660:CDS	35.0%
	ATCAAGGTTTCTACTTGCTT+GGG	+	chr1_2:4615981-4616000	Msa0050660:CDS	35.0%
	GGACTTGGACTATATATAGT+TGG	-	chr1_2:4616279-4616298	None:intergenic	35.0%
	TTTAAGTGACTACTTGGACT+TGG	-	chr1_2:4616294-4616313	None:intergenic	35.0%
	CCACTATTTAAGTGACTACT+TGG	-	chr1_2:4616300-4616319	None:intergenic	35.0%
	CCAAGTAGTCACTTAAATAG+TGG	+	chr1_2:4616297-4616316	Msa0050660:CDS	35.0%
	GTGATGCAAAGGGAAAAAAT+TGG	+	chr1_2:4616376-4616395	Msa0050660:CDS	35.0%
	AAGGGAAAAAATTGGACACT+TGG	+	chr1_2:4616384-4616403	Msa0050660:CDS	35.0%
!!	GGTTTTTGAAAGAAATGCTC+AGG	+	chr1_2:4616551-4616570	Msa0050660:CDS	35.0%
!	AGCTTTCACCATTTTATACG+CGG	+	chr1_2:4616599-4616618	Msa0050660:CDS	35.0%
	CTAACTAACCGCGTATAAAA+TGG	-	chr1_2:4616610-4616629	None:intergenic	35.0%
!	CAAATATGGTGCATTGATAG+AGG	+	chr1_2:4616740-4616759	Msa0050660:CDS	35.0%
	GCTACAACAAAAGTTTGAAC+AGG	-	chr1_2:4616794-4616813	None:intergenic	35.0%
!!	AACTTTTGTTGTAGCCATCA+TGG	+	chr1_2:4616799-4616818	Msa0050660:CDS	35.0%
	TAAAGCAATAGAAGCCATGA+TGG	-	chr1_2:4616816-4616835	None:intergenic	35.0%
	ATCATGGCTTCTATTGCTTT+AGG	+	chr1_2:4616815-4616834	Msa0050660:CDS	35.0%
	TTTAGGAGAAGAGTTCTACT+TGG	+	chr1_2:4616832-4616851	Msa0050660:CDS	35.0%
	TTAGGAGAAGAGTTCTACTT+GGG	+	chr1_2:4616833-4616852	Msa0050660:CDS	35.0%
	TAATTGCTTTGCGAGTGTTT+AGG	-	chr1_2:4616921-4616940	None:intergenic	35.0%
	TTATGTAATGATACCGCCTT+CGG	+	chr1_2:4616979-4616998	Msa0050660:intron	35.0%
	TCTGTTGAAGAAGATAGGAA+TGG	-	chr1_2:4617510-4617529	None:intergenic	35.0%
	ATGGGAACATGTTGTAATAG+TGG	+	chr1_2:4617661-4617680	Msa0050660:three_prime_UTR	35.0%
!!	ATAGTGGATGTCACTAAAAG+TGG	+	chr1_2:4617677-4617696	Msa0050660:three_prime_UTR	35.0%
!	TAGTGGATGTCACTAAAAGT+GGG	+	chr1_2:4617678-4617697	Msa0050660:three_prime_UTR	35.0%
	CATATGGGACTAATTTCACA+AGG	-	chr1_2:4617712-4617731	None:intergenic	35.0%
	CATCATTATCATGACATGGA+AGG	+	chr1_2:4617812-4617831	Msa0050660:three_prime_UTR	35.0%
	CAAATTGTGACTCTTAAACG+GGG	+	chr1_2:4617914-4617933	Msa0050660:three_prime_UTR	35.0%
!	ATTTTTACCAGCATGCATCT+AGG	-	chr1_2:4618003-4618022	None:intergenic	35.0%
!	CAGCTTCTTCTAAGAGAATG+TGG	+	chr1_2:4615050-4615069	Msa0050660:CDS	40.0%
	TTCAAGAGCTGCACTTAACA+TGG	+	chr1_2:4615150-4615169	Msa0050660:CDS	40.0%
	TCAAGAGCTGCACTTAACAT+GGG	+	chr1_2:4615151-4615170	Msa0050660:CDS	40.0%
	GCAATGATGTTCCTATAGAC+AGG	-	chr1_2:4615196-4615215	None:intergenic	40.0%
	TATTGCTGATGCAAAGGTAG+GGG	-	chr1_2:4616020-4616039	None:intergenic	40.0%
	GTATTGCTGATGCAAAGGTA+GGG	-	chr1_2:4616021-4616040	None:intergenic	40.0%
	TGTATTGCTGATGCAAAGGT+AGG	-	chr1_2:4616022-4616041	None:intergenic	40.0%
	GTTCTGTATTGCTGATGCAA+AGG	-	chr1_2:4616026-4616045	None:intergenic	40.0%
	CCATGAGAAATGTAATGGCA+GGG	-	chr1_2:4616054-4616073	None:intergenic	40.0%
	GACTGCCATGAGAAATGTAA+TGG	-	chr1_2:4616059-4616078	None:intergenic	40.0%
	TTCTCATGGCAGTCATACTA+AGG	+	chr1_2:4616065-4616084	Msa0050660:CDS	40.0%
	GCAAGTGAGATTGAATCGAA+AGG	+	chr1_2:4616182-4616201	Msa0050660:CDS	40.0%
	GTGAGATTGAATCGAAAGGA+TGG	+	chr1_2:4616186-4616205	Msa0050660:CDS	40.0%
	GATGGAATTGCTAAAGTAGC+AGG	+	chr1_2:4616204-4616223	Msa0050660:CDS	40.0%
!!!	GATTTTGGGACAATGTCACT+TGG	+	chr1_2:4616354-4616373	Msa0050660:CDS	40.0%
!!	AATGTCACTTGGTGATGCAA+AGG	+	chr1_2:4616365-4616384	Msa0050660:CDS	40.0%
!!	ATGTCACTTGGTGATGCAAA+GGG	+	chr1_2:4616366-4616385	Msa0050660:CDS	40.0%
	ATTGTTTGTCTTGGTCTGCT+TGG	+	chr1_2:4616427-4616446	Msa0050660:CDS	40.0%
	TTGAAAGAAATGCTCAGGCT+TGG	+	chr1_2:4616556-4616575	Msa0050660:CDS	40.0%
	GTTAGTTAGCCACGACTATT+AGG	+	chr1_2:4616621-4616640	Msa0050660:intron	40.0%
!!	TATTAATTTGCAGGGAGTGG+TGG	+	chr1_2:4616694-4616713	Msa0050660:intron	40.0%
!	ATATGGTGCATTGATAGAGG+AGG	+	chr1_2:4616743-4616762	Msa0050660:CDS	40.0%
	TGATACACTGCAACAAACAC+TGG	-	chr1_2:4616770-4616789	None:intergenic	40.0%
	TGGACTATACTTTGTGCTGT+GGG	+	chr1_2:4617377-4617396	Msa0050660:CDS	40.0%
	CACACAAGCATGGTACTATA+AGG	-	chr1_2:4617568-4617587	None:intergenic	40.0%
	TATCACAACACACACAAGCA+TGG	-	chr1_2:4617578-4617597	None:intergenic	40.0%
	AGTGGATGTCACTAAAAGTG+GGG	+	chr1_2:4617679-4617698	Msa0050660:three_prime_UTR	40.0%
	CTCAAGATTAGAATTGGGAG+TGG	+	chr1_2:4617845-4617864	Msa0050660:three_prime_UTR	40.0%
	TGGGAGTGGTTTCAAAAGTA+TGG	+	chr1_2:4617859-4617878	Msa0050660:three_prime_UTR	40.0%
	AGTATGGTAATTGGCAAGCA+TGG	+	chr1_2:4617875-4617894	Msa0050660:three_prime_UTR	40.0%
!	CTTAAACGGGGTCATCATTT+TGG	+	chr1_2:4617926-4617945	Msa0050660:three_prime_UTR	40.0%
	ATAATGACCTAGATGCATGC+TGG	+	chr1_2:4617993-4618012	Msa0050660:three_prime_UTR	40.0%
	AGGAAAAGAAAGGTGGGAAG+TGG	-	chr1_2:4614907-4614926	None:intergenic	45.0%
	ACCAGCATAACCAAACTGCA+GGG	-	chr1_2:4615119-4615138	None:intergenic	45.0%
	AACCAGCATAACCAAACTGC+AGG	-	chr1_2:4615120-4615139	None:intergenic	45.0%
	GTGCAGCTCTTGAAACAACA+TGG	-	chr1_2:4615144-4615163	None:intergenic	45.0%
	GTCTGTCCTTCCTGAACAAA+AGG	-	chr1_2:4615676-4615695	None:intergenic	45.0%
	CGAGAAAAAAGAACTGGCAG+AGG	-	chr1_2:4615718-4615737	None:intergenic	45.0%
	AGGTTTCTACTTGCTTGGGT+TGG	+	chr1_2:4615985-4616004	Msa0050660:CDS	45.0%
	CCCTGCCATTACATTTCTCA+TGG	+	chr1_2:4616051-4616070	Msa0050660:CDS	45.0%
	GCCATGAGAAATGTAATGGC+AGG	-	chr1_2:4616055-4616074	None:intergenic	45.0%
	GCAGGATACTTCTTAAGGAC+AGG	-	chr1_2:4616468-4616487	None:intergenic	45.0%
	GACGAGCAGGATACTTCTTA+AGG	-	chr1_2:4616473-4616492	None:intergenic	45.0%
!	CAGGCTTGGATTTTTCACTC+TGG	+	chr1_2:4616570-4616589	Msa0050660:CDS	45.0%
!	GCTTGGATTTTTCACTCTGG+TGG	+	chr1_2:4616573-4616592	Msa0050660:CDS	45.0%
	ACTTTAGGTCATTCCGAAGG+CGG	-	chr1_2:4616995-4617014	None:intergenic	45.0%
	CTCACTTTAGGTCATTCCGA+AGG	-	chr1_2:4616998-4617017	None:intergenic	45.0%
	CTGGACTATACTTTGTGCTG+TGG	+	chr1_2:4617376-4617395	Msa0050660:CDS	45.0%
	GGACTATACTTTGTGCTGTG+GGG	+	chr1_2:4617378-4617397	Msa0050660:CDS	45.0%
!!	AACGGGGTCATCATTTTGGT+CGG	+	chr1_2:4617930-4617949	Msa0050660:three_prime_UTR	45.0%
	GAAGTGACAGAAAGACGAGC+AGG	-	chr1_2:4616486-4616505	None:intergenic	50.0%
	GGAGAAGAGTTCTACTTGGG+CGG	+	chr1_2:4616836-4616855	Msa0050660:CDS	50.0%
	GAGAAGAGTTCTACTTGGGC+GGG	+	chr1_2:4616837-4616856	Msa0050660:CDS	50.0%
!!	GGTGCAGTGTTGATAGTAGC+TGG	+	chr1_2:4617357-4617376	Msa0050660:CDS	50.0%
	TGATGCTTTAGCGTGGCTTG+CGG	-	chr1_2:4617478-4617497	None:intergenic	50.0%
	GAGTGAGTGATGCTTTAGCG+TGG	-	chr1_2:4617485-4617504	None:intergenic	50.0%
	TCAGCTGCATGTGGCCATGT+TGG	+	chr1_2:4615093-4615112	Msa0050660:CDS	55.0%
	ACCAAACTGCAGGGCCAACA+TGG	-	chr1_2:4615110-4615129	None:intergenic	55.0%
	GCCCTGCAGTTTGGTTATGC+TGG	+	chr1_2:4615115-4615134	Msa0050660:CDS	55.0%
!	GATGCTTTAGCGTGGCTTGC+GGG	-	chr1_2:4617477-4617496	None:intergenic	55.0%
	GCCATGTTGGCCCTGCAGTT+TGG	+	chr1_2:4615106-4615125	Msa0050660:CDS	60.0%
	TTGCAGGGAGTGGTGGCATC+TGG	+	chr1_2:4616701-4616720	Msa0050660:intron	60.0%

Chromosome	Type	Strat	End	Strand	Name
chr1_2	gene	4614903	4618150	4614903	ID=Msa0050660;Name=Msa0050660
chr1_2	mRNA	4614903	4618150	4614903	ID=Msa0050660-mRNA-1;Parent=Msa0050660;Name=Msa0050660-mRNA-1;_AED=0.04;_eAED=0.04;_QI=131\|1\|1\|1\|1\|1\|6\|611\|395
chr1_2	exon	4614903	4615254	4614903	ID=Msa0050660-mRNA-1:exon:1222;Parent=Msa0050660-mRNA-1
chr1_2	exon	4615685	4615747	4615685	ID=Msa0050660-mRNA-1:exon:1223;Parent=Msa0050660-mRNA-1
chr1_2	exon	4615970	4616086	4615970	ID=Msa0050660-mRNA-1:exon:1224;Parent=Msa0050660-mRNA-1
chr1_2	exon	4616176	4616620	4616176	ID=Msa0050660-mRNA-1:exon:1225;Parent=Msa0050660-mRNA-1
chr1_2	exon	4616707	4616858	4616707	ID=Msa0050660-mRNA-1:exon:1226;Parent=Msa0050660-mRNA-1
chr1_2	exon	4617350	4618150	4617350	ID=Msa0050660-mRNA-1:exon:1227;Parent=Msa0050660-mRNA-1
chr1_2	five_prime_UTR	4614903	4615033	4614903	ID=Msa0050660-mRNA-1:five_prime_utr;Parent=Msa0050660-mRNA-1
chr1_2	CDS	4615034	4615254	4615034	ID=Msa0050660-mRNA-1:cds;Parent=Msa0050660-mRNA-1
chr1_2	CDS	4615685	4615747	4615685	ID=Msa0050660-mRNA-1:cds;Parent=Msa0050660-mRNA-1
chr1_2	CDS	4615970	4616086	4615970	ID=Msa0050660-mRNA-1:cds;Parent=Msa0050660-mRNA-1
chr1_2	CDS	4616176	4616620	4616176	ID=Msa0050660-mRNA-1:cds;Parent=Msa0050660-mRNA-1
chr1_2	CDS	4616707	4616858	4616707	ID=Msa0050660-mRNA-1:cds;Parent=Msa0050660-mRNA-1
chr1_2	CDS	4617350	4617539	4617350	ID=Msa0050660-mRNA-1:cds;Parent=Msa0050660-mRNA-1
chr1_2	three_prime_UTR	4617540	4618150	4617540	ID=Msa0050660-mRNA-1:three_prime_utr;Parent=Msa0050660-mRNA-1

Gene Sequence

>Msa0050660

ATGGCTGATTTAGGTTCAGCTTCTTCTAAGAGAATGTGGTGTTCTATCCCTGAAAAATTTCAGCTGCATGTGGCCATGTTGGCCCTGCAGTTTGGTTATGCTGGTTTCCATGTTGTTTCAAGAGCTGCACTTAACATGGGAGTTAGCAAACTTGTTTTCCCTGTCTATAGGAACATCATTGCTTTGCTTCTCCTTCTTCCATTTGCTTATTTCTTGGAAAAGAAGGACAGACCACCGATTAATTTAAACTTCCTCTGCCAGTTCTTTTTTCTCGCACTTATTGGGATTACAGCAAATCAAGGTTTCTACTTGCTTGGGTTGGATAACACATCCCCTACCTTTGCATCAGCAATACAGAACTCTGTCCCTGCCATTACATTTCTCATGGCAGTCATACTAAGGATAGAGCAAGTGAGATTGAATCGAAAGGATGGAATTGCTAAAGTAGCAGGAACAATATTTTGTGTAATTGGGGCATCAGTGATTACATTATATCAGGGACCAACTATATATAGTCCAAGTCCAAGTAGTCACTTAAATAGTGGCATAACAGAAGTAACAACAACAACACCAATGATTGATTTTGGGACAATGTCACTTGGTGATGCAAAGGGAAAAAATTGGACACTTGGATGTCTTTATCTAATTGGACATTGTTTGTCTTGGTCTGCTTGGCTTGTGTTTCAAGCACCTGTCCTTAAGAAGTATCCTGCTCGTCTTTCTGTCACTTCCTATACATGTTTCTTTGGACTTTTGCAATTTCTTCTTATTGCTTTGGTTTTTGAAAGAAATGCTCAGGCTTGGATTTTTCACTCTGGTGGTGAAGCTTTCACCATTTTATACGCGGGAGTGGTGGCATCTGGAATTGCATTTGCAGTACAAATATGGTGCATTGATAGAGGAGGTCCAGTGTTTGTTGCAGTGTATCAACCTGTTCAAACTTTTGTTGTAGCCATCATGGCTTCTATTGCTTTAGGAGAAGAGTTCTACTTGGGCGGGATCATTGGTGCAGTGTTGATAGTAGCTGGACTATACTTTGTGCTGTGGGGTAAAAGTGAAGAGAAGAAATTATTTGCAAAGGAACAGCTTGCAATTGCATCAACAGAACATAGCATCATTAGACCCGCAAGCCACGCTAAAGCATCACTCACTCAACCATTCCTATCTTCTTCAACAGAAAATGTTTGA

Protein sequence

>Msa0050660

MADLGSASSKRMWCSIPEKFQLHVAMLALQFGYAGFHVVSRAALNMGVSKLVFPVYRNIIALLLLLPFAYFLEKKDRPPINLNFLCQFFFLALIGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAVILRIEQVRLNRKDGIAKVAGTIFCVIGASVITLYQGPTIYSPSPSSHLNSGITEVTTTTPMIDFGTMSLGDAKGKNWTLGCLYLIGHCLSWSAWLVFQAPVLKKYPARLSVTSYTCFFGLLQFLLIALVFERNAQAWIFHSGGEAFTILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTFVVAIMASIALGEEFYLGGIIGAVLIVAGLYFVLWGKSEEKKLFAKEQLAIASTEHSIIRPASHAKASLTQPFLSSSTENV*