AlfalfaGEDB | Msa0329710

M. sativa cultivar zhongmu-4 / Msa0329710

KEGG: K06892
GO: -
PFAM: PF14226.9

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0329710	GAU49603.1	82.315	311	50	1	1	306	50	360	0.0	535

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0329710	sp\|Q9LE86\|S8H_ARATH	57.566	304	119	2	3	302	58	355	1.77e-131	380

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0004350	Msa0329710	0.807637	4.586280e-50	-8.615850e-47
Msa0006700	Msa0329710	0.820515	6.587108e-53	-8.615850e-47
Msa0008330	Msa0329710	0.800594	1.339668e-48	-8.615850e-47
Msa0008850	Msa0329710	0.844049	9.614413e-59	-8.615850e-47
Msa0012440	Msa0329710	0.800107	1.683338e-48	-8.615850e-47
Msa0017120	Msa0329710	0.838067	3.583916e-57	-8.615850e-47
Msa0020630	Msa0329710	0.833319	5.710829e-56	-8.615850e-47
Msa0022640	Msa0329710	0.803411	3.531460e-49	-8.615850e-47
Msa0027540	Msa0329710	0.811303	7.491441e-51	-8.615850e-47
Msa0030000	Msa0329710	0.806315	8.733337e-50	-8.615850e-47
Msa0030030	Msa0329710	0.825977	3.491537e-54	-8.615850e-47
Msa0030590	Msa0329710	0.824964	6.066892e-54	-8.615850e-47
Msa0030730	Msa0329710	0.810714	1.004790e-50	-8.615850e-47
Msa0033650	Msa0329710	0.807280	5.459198e-50	-8.615850e-47
Msa0036150	Msa0329710	0.804198	2.423495e-49	-8.615850e-47
Msa0037820	Msa0329710	0.808177	3.520417e-50	-8.615850e-47
Msa0039200	Msa0329710	0.809469	1.863695e-50	-8.615850e-47
Msa0040190	Msa0329710	0.812888	3.378888e-51	-8.615850e-47
Msa0051100	Msa0329710	0.802939	4.421982e-49	-8.615850e-47
Msa0055280	Msa0329710	0.837135	6.212703e-57	-8.615850e-47
Msa0056040	Msa0329710	0.800953	1.131352e-48	-8.615850e-47
Msa0056550	Msa0329710	0.806545	7.808475e-50	-8.615850e-47
Msa0059960	Msa0329710	-0.813609	2.347127e-51	-8.615850e-47
Msa0060600	Msa0329710	0.824775	6.724347e-54	-8.615850e-47
Msa0062750	Msa0329710	0.812513	4.081932e-51	-8.615850e-47
Msa0065390	Msa0329710	0.803408	3.535876e-49	-8.615850e-47
Msa0068410	Msa0329710	0.807979	3.878806e-50	-8.615850e-47
Msa0075310	Msa0329710	0.808158	3.552951e-50	-8.615850e-47
Msa0075850	Msa0329710	0.840995	6.212397e-58	-8.615850e-47
Msa0084680	Msa0329710	0.807597	4.676697e-50	-8.615850e-47
Msa0086090	Msa0329710	0.812687	3.739534e-51	-8.615850e-47
Msa0086820	Msa0329710	0.808292	3.327137e-50	-8.615850e-47
Msa0089210	Msa0329710	0.815456	9.159308e-52	-8.615850e-47
Msa0094100	Msa0329710	0.800782	1.226193e-48	-8.615850e-47
Msa0094420	Msa0329710	0.845907	3.030282e-59	-8.615850e-47
Msa0101060	Msa0329710	0.838125	3.461981e-57	-8.615850e-47
Msa0102800	Msa0329710	0.804631	1.968861e-49	-8.615850e-47
Msa0103060	Msa0329710	0.817795	2.739312e-52	-8.615850e-47
Msa0105340	Msa0329710	0.819573	1.081988e-52	-8.615850e-47
Msa0110710	Msa0329710	0.803813	2.914226e-49	-8.615850e-47
Msa0114250	Msa0329710	0.822773	1.979376e-53	-8.615850e-47
Msa0128370	Msa0329710	0.821756	3.409172e-53	-8.615850e-47
Msa0130250	Msa0329710	0.816066	6.695759e-52	-8.615850e-47
Msa0133670	Msa0329710	0.812114	4.989718e-51	-8.615850e-47
Msa0133880	Msa0329710	0.816438	5.528986e-52	-8.615850e-47
Msa0134040	Msa0329710	0.800687	1.282138e-48	-8.615850e-47
Msa0134550	Msa0329710	0.806274	8.907793e-50	-8.615850e-47
Msa0140910	Msa0329710	0.804969	1.673493e-49	-8.615850e-47
Msa0141550	Msa0329710	0.830998	2.141412e-55	-8.615850e-47
Msa0141670	Msa0329710	0.858034	1.086284e-62	-8.615850e-47
Msa0147550	Msa0329710	0.827132	1.852068e-54	-8.615850e-47
Msa0149500	Msa0329710	0.818553	1.846277e-52	-8.615850e-47
Msa0151690	Msa0329710	0.822483	2.312255e-53	-8.615850e-47
Msa0157020	Msa0329710	0.823054	1.702349e-53	-8.615850e-47
Msa0159750	Msa0329710	0.832238	1.059249e-55	-8.615850e-47
Msa0161680	Msa0329710	0.801367	9.310229e-49	-8.615850e-47
Msa0162030	Msa0329710	0.811408	7.108496e-51	-8.615850e-47
Msa0162050	Msa0329710	0.836527	8.881391e-57	-8.615850e-47
Msa0162070	Msa0329710	0.823687	1.210924e-53	-8.615850e-47
Msa0164360	Msa0329710	0.829040	6.429110e-55	-8.615850e-47
Msa0164660	Msa0329710	0.820866	5.469039e-53	-8.615850e-47
Msa0168100	Msa0329710	0.803028	4.239315e-49	-8.615850e-47
Msa0168390	Msa0329710	0.825590	4.315685e-54	-8.615850e-47
Msa0169960	Msa0329710	0.831476	1.633246e-55	-8.615850e-47
Msa0170680	Msa0329710	0.806534	7.851585e-50	-8.615850e-47
Msa0174560	Msa0329710	0.807222	5.617358e-50	-8.615850e-47
Msa0175530	Msa0329710	0.812699	3.717209e-51	-8.615850e-47
Msa0181290	Msa0329710	0.825107	5.614588e-54	-8.615850e-47
Msa0184120	Msa0329710	0.804662	1.939995e-49	-8.615850e-47
Msa0185390	Msa0329710	0.821301	4.343284e-53	-8.615850e-47
Msa0193760	Msa0329710	0.808562	2.914454e-50	-8.615850e-47
Msa0194570	Msa0329710	0.825683	4.101348e-54	-8.615850e-47
Msa0197750	Msa0329710	-0.800693	1.278349e-48	-8.615850e-47
Msa0203180	Msa0329710	0.810598	1.064505e-50	-8.615850e-47
Msa0203640	Msa0329710	0.807532	4.826571e-50	-8.615850e-47
Msa0207000	Msa0329710	0.810538	1.096515e-50	-8.615850e-47
Msa0207180	Msa0329710	0.821494	3.919761e-53	-8.615850e-47
Msa0208520	Msa0329710	0.816497	5.363061e-52	-8.615850e-47
Msa0211010	Msa0329710	0.813707	2.233291e-51	-8.615850e-47
Msa0212370	Msa0329710	0.828629	8.081927e-55	-8.615850e-47
Msa0213080	Msa0329710	0.839997	1.133695e-57	-8.615850e-47
Msa0213650	Msa0329710	0.805880	1.078194e-49	-8.615850e-47
Msa0217470	Msa0329710	0.832507	9.089410e-56	-8.615850e-47
Msa0221800	Msa0329710	0.845963	2.925734e-59	-8.615850e-47
Msa0222070	Msa0329710	0.827240	1.744929e-54	-8.615850e-47
Msa0222120	Msa0329710	0.827710	1.346324e-54	-8.615850e-47
Msa0223100	Msa0329710	0.812360	4.409331e-51	-8.615850e-47
Msa0227290	Msa0329710	0.826126	3.219605e-54	-8.615850e-47
Msa0227490	Msa0329710	0.826113	3.241251e-54	-8.615850e-47
Msa0227500	Msa0329710	0.845688	3.473615e-59	-8.615850e-47
Msa0230400	Msa0329710	0.804006	2.657152e-49	-8.615850e-47
Msa0251670	Msa0329710	0.805320	1.413178e-49	-8.615850e-47
Msa0252180	Msa0329710	0.819962	8.814457e-53	-8.615850e-47
Msa0252820	Msa0329710	0.847184	1.357449e-59	-8.615850e-47
Msa0253370	Msa0329710	0.828399	9.189357e-55	-8.615850e-47
Msa0253980	Msa0329710	0.821893	3.169548e-53	-8.615850e-47
Msa0256170	Msa0329710	0.825176	5.407851e-54	-8.615850e-47
Msa0257310	Msa0329710	0.817432	3.308410e-52	-8.615850e-47
Msa0260970	Msa0329710	0.820311	7.336225e-53	-8.615850e-47
Msa0263620	Msa0329710	0.827355	1.637414e-54	-8.615850e-47
Msa0265210	Msa0329710	0.842007	3.363402e-58	-8.615850e-47
Msa0274780	Msa0329710	0.803281	3.757531e-49	-8.615850e-47
Msa0277280	Msa0329710	-0.800793	1.219944e-48	-8.615850e-47
Msa0281570	Msa0329710	0.832164	1.105384e-55	-8.615850e-47
Msa0282170	Msa0329710	0.841282	5.223691e-58	-8.615850e-47
Msa0284780	Msa0329710	0.803852	2.859932e-49	-8.615850e-47
Msa0284870	Msa0329710	0.835749	1.399561e-56	-8.615850e-47
Msa0286790	Msa0329710	0.817801	2.730915e-52	-8.615850e-47
Msa0291040	Msa0329710	0.870997	9.555177e-67	-8.615850e-47
Msa0292180	Msa0329710	0.836113	1.131677e-56	-8.615850e-47
Msa0293080	Msa0329710	0.811199	7.889821e-51	-8.615850e-47
Msa0295520	Msa0329710	0.829827	4.139509e-55	-8.615850e-47
Msa0296610	Msa0329710	0.833098	6.483088e-56	-8.615850e-47
Msa0298940	Msa0329710	0.821390	4.141794e-53	-8.615850e-47
Msa0298970	Msa0329710	0.806950	6.412500e-50	-8.615850e-47
Msa0301180	Msa0329710	0.822945	1.805498e-53	-8.615850e-47
Msa0306130	Msa0329710	0.858756	6.622122e-63	-8.615850e-47
Msa0315480	Msa0329710	0.819753	9.840163e-53	-8.615850e-47
Msa0320540	Msa0329710	0.846226	2.481097e-59	-8.615850e-47
Msa0323630	Msa0329710	0.848464	6.028384e-60	-8.615850e-47
Msa0325470	Msa0329710	0.828369	9.342339e-55	-8.615850e-47
Msa0326540	Msa0329710	0.806697	7.254595e-50	-8.615850e-47
Msa0329710	Msa0330270	0.834852	2.359100e-56	-8.615850e-47
Msa0329710	Msa0330400	0.823773	1.156426e-53	-8.615850e-47
Msa0329710	Msa0331780	0.858936	5.847753e-63	-8.615850e-47
Msa0329710	Msa0336270	0.826626	2.446246e-54	-8.615850e-47
Msa0329710	Msa0338570	0.809643	1.710109e-50	-8.615850e-47
Msa0329710	Msa0339870	0.826882	2.125529e-54	-8.615850e-47
Msa0329710	Msa0340550	0.814172	1.763854e-51	-8.615850e-47
Msa0329710	Msa0342200	0.809064	2.275424e-50	-8.615850e-47
Msa0329710	Msa0344070	0.825457	4.640122e-54	-8.615850e-47
Msa0329710	Msa0352000	0.809801	1.581412e-50	-8.615850e-47
Msa0329710	Msa0362430	0.803937	2.745760e-49	-8.615850e-47
Msa0329710	Msa0363460	0.810167	1.318601e-50	-8.615850e-47
Msa0329710	Msa0371540	0.826684	2.369935e-54	-8.615850e-47
Msa0329710	Msa0371610	0.848983	4.327766e-60	-8.615850e-47
Msa0329710	Msa0380430	0.800069	1.712902e-48	-8.615850e-47
Msa0329710	Msa0382560	0.811391	7.168855e-51	-8.615850e-47
Msa0329710	Msa0409820	0.817536	3.134704e-52	-8.615850e-47
Msa0329710	Msa0411000	0.831653	1.477446e-55	-8.615850e-47
Msa0329710	Msa0413740	0.818600	1.801343e-52	-8.615850e-47
Msa0329710	Msa0414070	0.803115	4.066190e-49	-8.615850e-47
Msa0329710	Msa0416990	0.808366	3.208990e-50	-8.615850e-47
Msa0329710	Msa0418000	0.868943	4.483981e-66	-8.615850e-47
Msa0329710	Msa0419620	-0.849038	4.179104e-60	-8.615850e-47
Msa0329710	Msa0420070	0.815516	8.883553e-52	-8.615850e-47
Msa0329710	Msa0423600	0.827238	1.746970e-54	-8.615850e-47
Msa0329710	Msa0427050	0.824463	7.962670e-54	-8.615850e-47
Msa0329710	Msa0431520	0.802495	5.461633e-49	-8.615850e-47
Msa0329710	Msa0431830	0.815871	7.403133e-52	-8.615850e-47
Msa0329710	Msa0437710	0.809207	2.120934e-50	-8.615850e-47
Msa0329710	Msa0440110	0.830528	2.791004e-55	-8.615850e-47
Msa0329710	Msa0455230	0.810849	9.394129e-51	-8.615850e-47
Msa0329710	Msa0458790	0.821234	4.499381e-53	-8.615850e-47
Msa0329710	Msa0459120	0.816698	4.836560e-52	-8.615850e-47
Msa0329710	Msa0463020	0.803662	3.132027e-49	-8.615850e-47
Msa0329710	Msa0466100	0.831460	1.648830e-55	-8.615850e-47
Msa0329710	Msa0471090	0.806173	9.355834e-50	-8.615850e-47
Msa0329710	Msa0473450	0.803535	3.328624e-49	-8.615850e-47
Msa0329710	Msa0482680	0.801698	7.964553e-49	-8.615850e-47
Msa0329710	Msa0485280	0.805126	1.551449e-49	-8.615850e-47
Msa0329710	Msa0486860	0.804097	2.544048e-49	-8.615850e-47
Msa0329710	Msa0498830	0.803346	3.641599e-49	-8.615850e-47
Msa0329710	Msa0502500	0.820411	6.956406e-53	-8.615850e-47
Msa0329710	Msa0502910	0.817349	3.453871e-52	-8.615850e-47
Msa0329710	Msa0504730	0.806480	8.059939e-50	-8.615850e-47
Msa0329710	Msa0505390	0.816821	4.539166e-52	-8.615850e-47
Msa0329710	Msa0505660	0.810098	1.364496e-50	-8.615850e-47
Msa0329710	Msa0508610	0.827439	1.563437e-54	-8.615850e-47
Msa0329710	Msa0508650	0.825113	5.595253e-54	-8.615850e-47
Msa0329710	Msa0509970	0.816922	4.307292e-52	-8.615850e-47
Msa0329710	Msa0511720	-0.823220	1.557378e-53	-8.615850e-47
Msa0329710	Msa0511890	0.843038	1.791124e-58	-8.615850e-47
Msa0329710	Msa0517340	0.814314	1.641085e-51	-8.615850e-47
Msa0329710	Msa0524050	0.831087	2.035947e-55	-8.615850e-47
Msa0329710	Msa0524090	0.816040	6.788822e-52	-8.615850e-47
Msa0329710	Msa0524120	0.843516	1.335644e-58	-8.615850e-47
Msa0329710	Msa0525240	0.831374	1.730802e-55	-8.615850e-47
Msa0329710	Msa0530210	0.821181	4.628885e-53	-8.615850e-47
Msa0329710	Msa0530930	0.813115	3.014382e-51	-8.615850e-47
Msa0329710	Msa0542040	0.804179	2.446029e-49	-8.615850e-47
Msa0329710	Msa0546380	0.833014	6.802757e-56	-8.615850e-47
Msa0329710	Msa0547050	0.800777	1.228882e-48	-8.615850e-47
Msa0329710	Msa0549740	0.811752	5.983509e-51	-8.615850e-47
Msa0329710	Msa0553520	0.822748	2.006496e-53	-8.615850e-47
Msa0329710	Msa0557630	0.816031	6.820213e-52	-8.615850e-47
Msa0329710	Msa0558890	0.834981	2.188548e-56	-8.615850e-47
Msa0329710	Msa0574170	0.848961	4.389969e-60	-8.615850e-47
Msa0329710	Msa0575250	0.837213	5.935534e-57	-8.615850e-47
Msa0329710	Msa0576420	0.830645	2.614069e-55	-8.615850e-47
Msa0329710	Msa0576600	0.807354	5.266511e-50	-8.615850e-47
Msa0329710	Msa0579340	0.853584	2.170125e-61	-8.615850e-47
Msa0329710	Msa0581340	0.809531	1.807005e-50	-8.615850e-47
Msa0329710	Msa0583590	0.815764	7.822603e-52	-8.615850e-47
Msa0329710	Msa0594180	0.806571	7.710273e-50	-8.615850e-47
Msa0329710	Msa0598250	0.875033	4.236345e-68	-8.615850e-47
Msa0329710	Msa0600390	0.806582	7.670489e-50	-8.615850e-47
Msa0329710	Msa0606060	0.841012	6.149422e-58	-8.615850e-47
Msa0329710	Msa0607280	0.808498	3.007770e-50	-8.615850e-47
Msa0329710	Msa0611550	0.812464	4.183575e-51	-8.615850e-47
Msa0329710	Msa0614230	0.836975	6.828071e-57	-8.615850e-47
Msa0329710	Msa0619330	0.847258	1.295423e-59	-8.615850e-47
Msa0329710	Msa0620640	0.830475	2.875744e-55	-8.615850e-47
Msa0329710	Msa0620750	0.800594	1.339701e-48	-8.615850e-47
Msa0329710	Msa0621770	0.824108	9.647222e-54	-8.615850e-47
Msa0329710	Msa0621890	0.851464	8.726904e-61	-8.615850e-47
Msa0329710	Msa0622340	0.807798	4.238554e-50	-8.615850e-47
Msa0329710	Msa0622390	0.840622	7.784720e-58	-8.615850e-47
Msa0329710	Msa0626230	0.837848	4.079276e-57	-8.615850e-47
Msa0329710	Msa0630970	0.808605	2.852317e-50	-8.615850e-47
Msa0329710	Msa0635990	0.828169	1.043896e-54	-8.615850e-47
Msa0329710	Msa0640880	0.800579	1.349078e-48	-8.615850e-47
Msa0329710	Msa0642910	0.810882	9.241281e-51	-8.615850e-47
Msa0329710	Msa0646390	0.806493	8.008328e-50	-8.615850e-47
Msa0329710	Msa0647000	0.866826	2.146243e-65	-8.615850e-47
Msa0329710	Msa0648300	0.810280	1.246671e-50	-8.615850e-47
Msa0329710	Msa0650650	0.854152	1.488704e-61	-8.615850e-47
Msa0329710	Msa0650740	0.845728	3.389176e-59	-8.615850e-47
Msa0329710	Msa0651790	0.807217	5.631226e-50	-8.615850e-47
Msa0329710	Msa0652980	0.803775	2.967759e-49	-8.615850e-47
Msa0329710	Msa0653710	0.861703	8.513902e-64	-8.615850e-47
Msa0329710	Msa0654060	0.877155	7.884689e-69	-8.615850e-47
Msa0329710	Msa0656270	0.808755	2.650465e-50	-8.615850e-47
Msa0329710	Msa0656680	0.806981	6.316379e-50	-8.615850e-47
Msa0329710	Msa0662850	0.809388	1.939354e-50	-8.615850e-47
Msa0329710	Msa0663090	0.815948	7.116674e-52	-8.615850e-47
Msa0329710	Msa0665910	-0.825170	5.423025e-54	-8.615850e-47
Msa0329710	Msa0678890	0.804175	2.450750e-49	-8.615850e-47
Msa0329710	Msa0681890	0.818567	1.832455e-52	-8.615850e-47
Msa0329710	Msa0686610	0.831466	1.643113e-55	-8.615850e-47
Msa0329710	Msa0694250	0.803463	3.444298e-49	-8.615850e-47
Msa0329710	Msa0697140	0.804045	2.607741e-49	-8.615850e-47
Msa0329710	Msa0700070	0.816053	6.742404e-52	-8.615850e-47
Msa0329710	Msa0701770	0.804342	2.261545e-49	-8.615850e-47
Msa0329710	Msa0707780	0.843405	1.429778e-58	-8.615850e-47
Msa0329710	Msa0714020	0.806349	8.590018e-50	-8.615850e-47
Msa0329710	Msa0714600	0.803145	4.008794e-49	-8.615850e-47
Msa0329710	Msa0719340	0.831097	2.024822e-55	-8.615850e-47
Msa0329710	Msa0720270	0.821896	3.164720e-53	-8.615850e-47
Msa0329710	Msa0722930	0.827496	1.514839e-54	-8.615850e-47
Msa0329710	Msa0723140	0.823678	1.216922e-53	-8.615850e-47
Msa0329710	Msa0724050	0.853530	2.249209e-61	-8.615850e-47
Msa0329710	Msa0726610	0.831117	2.002327e-55	-8.615850e-47
Msa0329710	Msa0730180	0.831041	2.089769e-55	-8.615850e-47
Msa0329710	Msa0731710	0.801398	9.173478e-49	-8.615850e-47
Msa0329710	Msa0733000	0.836160	1.101038e-56	-8.615850e-47
Msa0329710	Msa0738870	0.800232	1.587312e-48	-8.615850e-47
Msa0329710	Msa0739570	0.834227	3.386769e-56	-8.615850e-47
Msa0329710	Msa0739610	0.825752	3.949997e-54	-8.615850e-47
Msa0329710	Msa0740420	0.861896	7.433563e-64	-8.615850e-47
Msa0329710	Msa0743640	0.851337	9.478348e-61	-8.615850e-47
Msa0329710	Msa0756480	0.833758	4.436769e-56	-8.615850e-47
Msa0329710	Msa0760840	0.800912	1.153561e-48	-8.615850e-47
Msa0329710	Msa0760890	0.820742	5.839789e-53	-8.615850e-47
Msa0329710	Msa0761760	0.810421	1.162213e-50	-8.615850e-47
Msa0329710	Msa0763880	0.857892	1.197149e-62	-8.615850e-47
Msa0329710	Msa0763910	0.841131	5.724291e-58	-8.615850e-47
Msa0329710	Msa0770430	0.818442	1.956366e-52	-8.615850e-47
Msa0329710	Msa0772020	0.819350	1.216379e-52	-8.615850e-47
Msa0329710	Msa0772150	0.855065	8.100881e-62	-8.615850e-47
Msa0329710	Msa0772210	0.830551	2.756069e-55	-8.615850e-47
Msa0329710	Msa0780140	0.802363	5.814450e-49	-8.615850e-47
Msa0329710	Msa0782330	0.869773	2.408027e-66	-8.615850e-47
Msa0329710	Msa0792510	0.839052	1.995779e-57	-8.615850e-47
Msa0329710	Msa0793060	0.835380	1.735377e-56	-8.615850e-47
Msa0329710	Msa0796450	0.827122	1.862281e-54	-8.615850e-47
Msa0329710	Msa0801390	0.831209	1.900780e-55	-8.615850e-47
Msa0329710	Msa0802300	0.809468	1.864320e-50	-8.615850e-47
Msa0329710	Msa0807730	0.806360	8.542581e-50	-8.615850e-47
Msa0329710	Msa0810020	0.814150	1.784137e-51	-8.615850e-47
Msa0329710	Msa0811510	0.824115	9.615467e-54	-8.615850e-47
Msa0329710	Msa0820670	0.856865	2.409399e-62	-8.615850e-47
Msa0329710	Msa0824770	0.827695	1.357347e-54	-8.615850e-47
Msa0329710	Msa0828570	0.807606	4.656664e-50	-8.615850e-47
Msa0329710	Msa0833940	0.800122	1.671287e-48	-8.615850e-47
Msa0329710	Msa0835510	0.810185	1.307121e-50	-8.615850e-47
Msa0329710	Msa0843280	0.810765	9.794082e-51	-8.615850e-47
Msa0329710	Msa0844100	0.820368	7.119239e-53	-8.615850e-47
Msa0329710	Msa0846640	0.805433	1.338233e-49	-8.615850e-47
Msa0329710	Msa0851740	0.818061	2.385763e-52	-8.615850e-47
Msa0329710	Msa0855520	0.800408	1.461919e-48	-8.615850e-47
Msa0329710	Msa0860270	0.863409	2.541612e-64	-8.615850e-47
Msa0329710	Msa0861800	0.803045	4.204408e-49	-8.615850e-47
Msa0329710	Msa0863760	0.852384	4.784295e-61	-8.615850e-47
Msa0329710	Msa0864950	0.806422	8.290708e-50	-8.615850e-47
Msa0329710	Msa0870620	0.830032	3.690743e-55	-8.615850e-47
Msa0329710	Msa0870630	0.845846	3.147055e-59	-8.615850e-47
Msa0329710	Msa0870690	0.820247	7.587742e-53	-8.615850e-47
Msa0329710	Msa0877420	0.813212	2.870075e-51	-8.615850e-47
Msa0329710	Msa0886980	0.830844	2.335554e-55	-8.615850e-47
Msa0329710	Msa0887070	0.851636	7.798655e-61	-8.615850e-47
Msa0329710	Msa0897390	0.800059	1.721214e-48	-8.615850e-47
Msa0329710	Msa0903730	0.867220	1.606801e-65	-8.615850e-47
Msa0329710	Msa0906720	0.805487	1.303742e-49	-8.615850e-47
Msa0329710	Msa0908170	0.801997	6.912986e-49	-8.615850e-47
Msa0329710	Msa0925160	0.815532	8.811688e-52	-8.615850e-47
Msa0329710	Msa0930330	0.801779	7.663387e-49	-8.615850e-47
Msa0329710	Msa0937940	0.808596	2.865816e-50	-8.615850e-47
Msa0329710	Msa0950410	0.808184	3.508600e-50	-8.615850e-47
Msa0329710	Msa0951710	0.832978	6.942091e-56	-8.615850e-47
Msa0329710	Msa0952990	0.811834	5.741582e-51	-8.615850e-47
Msa0329710	Msa0955260	0.800450	1.433242e-48	-8.615850e-47
Msa0329710	Msa0958020	0.802209	6.252168e-49	-8.615850e-47
Msa0329710	Msa0961420	-0.801143	1.034714e-48	-8.615850e-47
Msa0329710	Msa0964680	0.815651	8.288633e-52	-8.615850e-47
Msa0329710	Msa0971860	0.804117	2.519731e-49	-8.615850e-47
Msa0329710	Msa0973130	0.820130	8.070736e-53	-8.615850e-47
Msa0329710	Msa0973230	0.843297	1.528214e-58	-8.615850e-47
Msa0329710	Msa0978000	0.846643	1.909407e-59	-8.615850e-47
Msa0329710	Msa0979550	0.807106	5.942666e-50	-8.615850e-47
Msa0329710	Msa0980440	0.804138	2.494946e-49	-8.615850e-47
Msa0329710	Msa0988480	0.851271	9.891253e-61	-8.615850e-47
Msa0329710	Msa0988790	0.831085	2.038249e-55	-8.615850e-47
Msa0329710	Msa1000470	0.811488	6.826640e-51	-8.615850e-47
Msa0329710	Msa1002040	0.823233	1.546337e-53	-8.615850e-47
Msa0329710	Msa1004210	0.806368	8.508944e-50	-8.615850e-47
Msa0329710	Msa1008490	0.809738	1.631118e-50	-8.615850e-47
Msa0329710	Msa1008960	0.805349	1.393534e-49	-8.615850e-47
Msa0329710	Msa1009000	0.803511	3.366339e-49	-8.615850e-47
Msa0329710	Msa1014270	0.808004	3.832221e-50	-8.615850e-47
Msa0329710	Msa1014350	0.809189	2.140178e-50	-8.615850e-47
Msa0329710	Msa1016110	0.815903	7.283389e-52	-8.615850e-47
Msa0329710	Msa1018720	0.800366	1.490782e-48	-8.615850e-47
Msa0329710	Msa1020710	0.801626	8.239415e-49	-8.615850e-47
Msa0329710	Msa1024140	0.811270	7.613267e-51	-8.615850e-47
Msa0329710	Msa1024580	0.825053	5.780933e-54	-8.615850e-47
Msa0329710	Msa1028460	0.803381	3.581792e-49	-8.615850e-47
Msa0329710	Msa1030280	0.802667	5.031034e-49	-8.615850e-47
Msa0329710	Msa1032350	0.859211	4.838300e-63	-8.615850e-47
Msa0329710	Msa1033160	0.830998	2.141651e-55	-8.615850e-47
Msa0329710	Msa1033560	0.809418	1.911253e-50	-8.615850e-47
Msa0329710	Msa1036350	0.819485	1.133364e-52	-8.615850e-47
Msa0329710	Msa1037060	-0.807345	5.289219e-50	-8.615850e-47
Msa0329710	Msa1038320	0.834712	2.558190e-56	-8.615850e-47
Msa0329710	Msa1043870	0.811581	6.517660e-51	-8.615850e-47
Msa0329710	Msa1044040	0.850334	1.816474e-60	-8.615850e-47
Msa0329710	Msa1046610	0.810762	9.810166e-51	-8.615850e-47
Msa0329710	Msa1048710	0.803755	2.996784e-49	-8.615850e-47
Msa0329710	Msa1055260	0.811352	7.308765e-51	-8.615850e-47
Msa0329710	Msa1055280	0.813536	2.435991e-51	-8.615850e-47
Msa0329710	Msa1055360	0.812129	4.952109e-51	-8.615850e-47
Msa0329710	Msa1063180	0.826874	2.134658e-54	-8.615850e-47
Msa0329710	Msa1069300	0.847047	1.480118e-59	-8.615850e-47
Msa0329710	Msa1072350	0.862623	4.445233e-64	-8.615850e-47
Msa0329710	Msa1073500	0.823387	1.424005e-53	-8.615850e-47
Msa0329710	Msa1076630	0.811091	8.327956e-51	-8.615850e-47
Msa0329710	Msa1079610	0.849762	2.625902e-60	-8.615850e-47
Msa0329710	Msa1080430	0.806700	7.243549e-50	-8.615850e-47
Msa0329710	Msa1081600	0.819588	1.073469e-52	-8.615850e-47
Msa0329710	Msa1081700	0.807778	4.279481e-50	-8.615850e-47
Msa0329710	Msa1089530	0.819124	1.368997e-52	-8.615850e-47
Msa0329710	Msa1093390	0.819238	1.289899e-52	-8.615850e-47
Msa0329710	Msa1106560	0.806916	6.519249e-50	-8.615850e-47
Msa0329710	Msa1107970	0.812978	3.228966e-51	-8.615850e-47
Msa0329710	Msa1108530	0.826986	2.006712e-54	-8.615850e-47
Msa0329710	Msa1108780	0.804152	2.477755e-49	-8.615850e-47
Msa0329710	Msa1113850	0.806193	9.266275e-50	-8.615850e-47
Msa0329710	Msa1115580	0.802251	6.130142e-49	-8.615850e-47
Msa0329710	Msa1118140	0.864024	1.636487e-64	-8.615850e-47
Msa0329710	Msa1120540	0.837128	6.239445e-57	-8.615850e-47
Msa0329710	Msa1122510	0.806525	7.884514e-50	-8.615850e-47
Msa0329710	Msa1123340	0.800119	1.673958e-48	-8.615850e-47
Msa0329710	Msa1124440	0.803111	4.073873e-49	-8.615850e-47
Msa0329710	Msa1130650	0.821204	4.572153e-53	-8.615850e-47
Msa0329710	Msa1133660	0.835825	1.339304e-56	-8.615850e-47
Msa0329710	Msa1135870	0.803747	3.007165e-49	-8.615850e-47
Msa0329710	Msa1136140	0.804511	2.085379e-49	-8.615850e-47
Msa0329710	Msa1138600	0.833593	4.878015e-56	-8.615850e-47
Msa0329710	Msa1140010	0.822939	1.810958e-53	-8.615850e-47
Msa0329710	Msa1151960	0.822292	2.561625e-53	-8.615850e-47
Msa0329710	Msa1152280	0.840512	8.314602e-58	-8.615850e-47
Msa0329710	Msa1159360	0.823868	1.098458e-53	-8.615850e-47
Msa0329710	Msa1160400	0.806745	7.086154e-50	-8.615850e-47
Msa0329710	Msa1161160	0.826613	2.464319e-54	-8.615850e-47
Msa0329710	Msa1161760	0.801603	8.331304e-49	-8.615850e-47
Msa0329710	Msa1164800	-0.812451	4.211232e-51	-8.615850e-47
Msa0329710	Msa1166180	0.818492	1.905636e-52	-8.615850e-47
Msa0329710	Msa1166280	0.817812	2.715889e-52	-8.615850e-47
Msa0329710	Msa1166370	0.811339	7.357448e-51	-8.615850e-47
Msa0329710	Msa1168130	0.811236	7.742776e-51	-8.615850e-47
Msa0329710	Msa1171340	0.800100	1.688497e-48	-8.615850e-47
Msa0329710	Msa1172590	0.817005	4.125576e-52	-8.615850e-47
Msa0329710	Msa1186210	0.805628	1.218047e-49	-8.615850e-47
Msa0329710	Msa1186580	0.810998	8.721762e-51	-8.615850e-47
Msa0329710	Msa1195860	0.808288	3.334573e-50	-8.615850e-47
Msa0329710	Msa1201990	0.859873	3.060498e-63	-8.615850e-47
Msa0329710	Msa1204120	0.810159	1.323841e-50	-8.615850e-47
Msa0329710	Msa1208070	0.804798	1.816697e-49	-8.615850e-47
Msa0329710	Msa1214900	0.817136	3.855107e-52	-8.615850e-47
Msa0329710	Msa1218650	0.806023	1.005807e-49	-8.615850e-47
Msa0329710	Msa1220230	0.837410	5.283877e-57	-8.615850e-47
Msa0329710	Msa1220460	-0.804690	1.913913e-49	-8.615850e-47
Msa0329710	Msa1220480	-0.805324	1.410540e-49	-8.615850e-47
Msa0329710	Msa1221200	-0.812708	3.700323e-51	-8.615850e-47
Msa0329710	Msa1221260	0.809490	1.844042e-50	-8.615850e-47
Msa0329710	Msa1221570	-0.826997	1.995335e-54	-8.615850e-47
Msa0329710	Msa1226600	0.808951	2.406345e-50	-8.615850e-47
Msa0329710	Msa1231520	0.831970	1.234242e-55	-8.615850e-47
Msa0329710	Msa1244830	0.801876	7.320723e-49	-8.615850e-47
Msa0329710	Msa1246420	0.831300	1.804651e-55	-8.615850e-47
Msa0329710	Msa1248400	0.842464	2.545183e-58	-8.615850e-47
Msa0329710	Msa1254770	0.849957	2.316064e-60	-8.615850e-47
Msa0329710	Msa1254800	0.847504	1.108939e-59	-8.615850e-47
Msa0329710	Msa1262310	0.837980	3.773482e-57	-8.615850e-47
Msa0329710	Msa1264560	0.822718	2.039065e-53	-8.615850e-47
Msa0329710	Msa1265310	0.800592	1.340768e-48	-8.615850e-47
Msa0329710	Msa1265960	0.825008	5.925513e-54	-8.615850e-47
Msa0329710	Msa1272960	0.821764	3.394040e-53	-8.615850e-47
Msa0329710	Msa1276080	0.800353	1.499620e-48	-8.615850e-47
Msa0329710	Msa1281720	0.816360	5.757316e-52	-8.615850e-47
Msa0329710	Msa1287160	0.872033	4.339270e-67	-8.615850e-47
Msa0329710	Msa1287340	0.872634	2.736298e-67	-8.615850e-47
Msa0329710	Msa1289340	0.829738	4.351429e-55	-8.615850e-47
Msa0329710	Msa1295010	0.828335	9.518133e-55	-8.615850e-47
Msa0329710	Msa1297090	0.805101	1.570470e-49	-8.615850e-47
Msa0329710	Msa1302150	0.830247	3.269872e-55	-8.615850e-47
Msa0329710	Msa1302160	0.835896	1.285050e-56	-8.615850e-47
Msa0329710	Msa1306200	0.816613	5.053385e-52	-8.615850e-47
Msa0329710	Msa1317710	0.816751	4.704429e-52	-8.615850e-47
Msa0329710	Msa1321000	0.837673	4.524908e-57	-8.615850e-47
Msa0329710	Msa1323060	0.812741	3.639039e-51	-8.615850e-47
Msa0329710	Msa1325980	0.827409	1.589804e-54	-8.615850e-47
Msa0329710	Msa1326000	0.820759	5.789218e-53	-8.615850e-47
Msa0329710	Msa1327820	0.851718	7.395285e-61	-8.615850e-47
Msa0329710	Msa1329990	0.864218	1.423938e-64	-8.615850e-47
Msa0329710	Msa1335970	-0.813508	2.469919e-51	-8.615850e-47
Msa0329710	Msa1337190	0.810765	9.797819e-51	-8.615850e-47
Msa0329710	Msa1343770	0.807152	5.812146e-50	-8.615850e-47
Msa0329710	Msa1354040	0.800714	1.265825e-48	-8.615850e-47
Msa0329710	Msa1355260	0.852413	4.691256e-61	-8.615850e-47
Msa0329710	Msa1358870	-0.804900	1.729726e-49	-8.615850e-47
Msa0329710	Msa1361190	0.807330	5.328152e-50	-8.615850e-47
Msa0329710	Msa1367940	0.843611	1.259466e-58	-8.615850e-47
Msa0329710	Msa1369700	0.801513	8.689169e-49	-8.615850e-47
Msa0329710	Msa1373910	0.838006	3.716002e-57	-8.615850e-47
Msa0329710	Msa1373950	0.832682	8.221334e-56	-8.615850e-47
Msa0329710	Msa1381130	0.818688	1.720394e-52	-8.615850e-47
Msa0329710	Msa1385620	0.818161	2.264414e-52	-8.615850e-47
Msa0329710	Msa1386520	0.806744	7.088345e-50	-8.615850e-47
Msa0329710	Msa1387090	0.812966	3.248456e-51	-8.615850e-47
Msa0329710	Msa1397540	0.849376	3.365196e-60	-8.615850e-47
Msa0329710	Msa1405180	0.822053	2.909553e-53	-8.615850e-47
Msa0329710	Msa1405470	0.807307	5.388803e-50	-8.615850e-47
Msa0329710	Msa1405770	0.827987	1.154559e-54	-8.615850e-47
Msa0329710	Msa1407710	0.813331	2.701509e-51	-8.615850e-47
Msa0329710	Msa1418200	0.826745	2.291705e-54	-8.615850e-47
Msa0329710	Msa1419110	0.817863	2.643964e-52	-8.615850e-47
Msa0329710	Msa1422750	0.803784	2.955070e-49	-8.615850e-47
Msa0329710	Msa1428420	0.817487	3.215652e-52	-8.615850e-47
Msa0329710	Msa1428440	0.812284	4.580801e-51	-8.615850e-47
Msa0329710	Msa1429830	0.804169	2.457356e-49	-8.615850e-47
Msa0329710	Msa1431000	0.833426	5.369530e-56	-8.615850e-47
Msa0329710	Msa1435040	0.806284	8.865354e-50	-8.615850e-47
Msa0329710	Msa1435470	0.804156	2.473414e-49	-8.615850e-47
Msa0329710	Msa1435670	0.832661	8.323455e-56	-8.615850e-47
Msa0329710	Msa1439230	0.815083	1.108533e-51	-8.615850e-47
Msa0329710	Msa1439670	0.815762	7.827986e-52	-8.615850e-47
Msa0329710	Msa1447440	0.804107	2.531513e-49	-8.615850e-47
Msa0329710	Msa1447560	0.815398	9.435450e-52	-8.615850e-47
Msa0329710	Msa1450020	0.845472	3.976935e-59	-8.615850e-47
Msa0329710	Msa1458920	0.808318	3.284582e-50	-8.615850e-47
Msa0329710	Msa1460510	0.802104	6.572134e-49	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0329710	MtrunA17_Chr2g0311631	81.935	310	52	1	1	306	55	364	0.0	525
Msa0329710	MtrunA17_Chr3g0093761	44.839	310	152	5	1	303	56	353	2.36e-89	270
Msa0329710	MtrunA17_Chr3g0093741	45.016	311	151	5	1	303	56	354	7.77e-89	269
Msa0329710	MtrunA17_Chr3g0093751	43.730	311	155	5	1	303	56	354	1.11e-87	266
Msa0329710	MtrunA17_Chr7g0265351	42.222	315	154	6	1	303	39	337	3.89e-82	251
Msa0329710	MtrunA17_Chr2g0311641	84.071	113	14	1	1	109	55	167	6.06e-63	196
Msa0329710	MtrunA17_Chr8g0348081	36.909	317	174	7	1	303	60	364	7.27e-59	192
Msa0329710	MtrunA17_Chr8g0336851	36.250	320	172	8	1	303	60	364	2.71e-57	188
Msa0329710	MtrunA17_Chr8g0336781	37.618	319	170	10	1	303	95	400	2.65e-56	187
Msa0329710	MtrunA17_Chr7g0225881	35.065	308	183	6	1	299	67	366	3.64e-56	186
Msa0329710	MtrunA17_Chr8g0345831	33.119	311	191	6	1	303	42	343	2.40e-55	182
Msa0329710	MtrunA17_Chr2g0311831	33.654	312	190	6	1	303	68	371	3.03e-55	183
Msa0329710	MtrunA17_Chr2g0311761	32.588	313	193	8	1	303	68	372	3.65e-55	183
Msa0329710	MtrunA17_Chr4g0045411	36.577	298	166	5	1	280	30	322	4.76e-55	182
Msa0329710	MtrunA17_Chr4g0066121	35.906	298	166	6	1	284	60	346	6.15e-55	182
Msa0329710	MtrunA17_Chr8g0336761	35.443	316	180	8	1	303	60	364	9.77e-55	182
Msa0329710	MtrunA17_Chr1g0184241	33.007	306	195	2	1	303	69	367	7.18e-54	179
Msa0329710	MtrunA17_Chr8g0336631	34.713	314	186	7	1	303	60	365	7.94e-54	179
Msa0329710	MtrunA17_Chr1g0179801	33.123	317	193	5	1	305	66	375	7.68e-53	177
Msa0329710	MtrunA17_Chr4g0045441	34.268	321	179	7	1	296	26	339	2.06e-52	175
Msa0329710	MtrunA17_Chr8g0336861	34.796	319	180	10	1	303	60	366	1.52e-51	173
Msa0329710	MtrunA17_Chr1g0162351	34.727	311	169	8	1	284	69	372	1.91e-51	174
Msa0329710	MtrunA17_Chr7g0265221	31.481	324	191	7	1	303	67	380	6.31e-51	172
Msa0329710	MtrunA17_Chr8g0336751	34.395	314	185	9	1	303	94	397	7.78e-51	172
Msa0329710	MtrunA17_Chr3g0109041	31.090	312	197	8	1	299	42	348	9.86e-51	171
Msa0329710	MtrunA17_Chr3g0128001	35.783	313	180	7	1	304	38	338	1.24e-50	170
Msa0329710	MtrunA17_Chr4g0006371	35.354	297	170	7	1	283	62	350	3.48e-50	170
Msa0329710	MtrunA17_Chr2g0296371	32.278	316	192	8	1	303	50	356	7.96e-50	169
Msa0329710	MtrunA17_Chr2g0311921	34.694	294	174	8	1	284	54	339	8.64e-50	169
Msa0329710	MtrunA17_Chr1g0162321	33.762	311	172	8	1	284	69	372	8.83e-50	169
Msa0329710	MtrunA17_Chr7g0266651	31.949	313	198	5	1	305	59	364	1.95e-49	168
Msa0329710	MtrunA17_Chr3g0126741	33.673	294	173	7	1	283	59	341	2.06e-49	168
Msa0329710	MtrunA17_Chr5g0412681	34.304	309	176	7	1	298	33	325	2.35e-48	164
Msa0329710	MtrunA17_Chr3g0113641	34.343	297	172	7	1	283	50	337	3.42e-48	164
Msa0329710	MtrunA17_Chr7g0242551	34.343	297	173	7	1	283	54	342	3.49e-48	164
Msa0329710	MtrunA17_Chr7g0239111	33.651	315	184	10	1	303	55	356	3.52e-48	164
Msa0329710	MtrunA17_Chr3g0125201	34.507	284	156	8	1	270	3	270	6.14e-48	162
Msa0329710	MtrunA17_Chr5g0437181	34.680	297	171	7	1	283	49	336	1.02e-47	163
Msa0329710	MtrunA17_Chr5g0412651	33.113	302	181	6	1	289	38	331	1.19e-47	163
Msa0329710	MtrunA17_Chr1g0161041	36.334	311	177	9	1	302	96	394	1.35e-47	164
Msa0329710	MtrunA17_Chr1g0167951	33.651	315	185	8	1	303	53	355	1.70e-47	162
Msa0329710	MtrunA17_Chr5g0412671	32.797	311	186	7	1	298	38	338	2.57e-47	162
Msa0329710	MtrunA17_Chr1g0167911	32.673	303	186	7	1	294	54	347	3.36e-47	162
Msa0329710	MtrunA17_Chr1g0161081	35.110	319	170	11	1	302	73	371	3.57e-47	162
Msa0329710	MtrunA17_Chr1g0162361	34.812	293	166	6	1	276	27	311	5.04e-47	161
Msa0329710	MtrunA17_Chr6g0472861	31.987	297	183	6	1	287	70	357	6.14e-47	162
Msa0329710	MtrunA17_Chr1g0167961	34.694	294	169	8	1	282	69	351	1.12e-46	161
Msa0329710	MtrunA17_Chr8g0354261	31.546	317	197	7	1	305	68	376	1.52e-46	160
Msa0329710	MtrunA17_Chr8g0375571	30.503	318	200	7	1	306	45	353	1.57e-46	160
Msa0329710	MtrunA17_Chr4g0045451	34.098	305	169	7	1	280	26	323	2.01e-46	160
Msa0329710	MtrunA17_Chr1g0161111	34.286	315	178	9	1	302	132	430	2.31e-46	161
Msa0329710	MtrunA17_Chr2g0311861	31.068	309	182	5	1	303	64	347	3.05e-46	159
Msa0329710	MtrunA17_Chr1g0187831	31.190	311	190	7	1	298	70	369	5.71e-46	159
Msa0329710	MtrunA17_Chr5g0424201	30.903	288	178	6	9	284	49	327	1.49e-45	157
Msa0329710	MtrunA17_Chr1g0187811	30.421	309	196	7	1	298	188	488	1.53e-45	160
Msa0329710	MtrunA17_Chr6g0455481	33.226	310	180	9	4	299	42	338	1.72e-45	157
Msa0329710	MtrunA17_Chr2g0311701	30.820	305	184	7	1	289	69	362	5.09e-45	157
Msa0329710	MtrunA17_Chr8g0354241	31.230	317	198	8	1	305	68	376	8.36e-45	156
Msa0329710	MtrunA17_Chr4g0045471	33.910	289	166	6	15	284	46	328	9.41e-45	155
Msa0329710	MtrunA17_Chr2g0311611	98.592	71	1	0	154	224	1	71	1.03e-44	146
Msa0329710	MtrunA17_Chr1g0184111	32.000	300	188	4	1	292	37	328	1.05e-44	155
Msa0329710	MtrunA17_Chr1g0184161	31.650	297	186	6	1	289	38	325	1.60e-44	154
Msa0329710	MtrunA17_Chr1g0187821	30.065	306	199	5	1	298	67	365	1.83e-44	155
Msa0329710	MtrunA17_Chr8g0371931	35.055	271	163	6	1	263	39	304	2.25e-44	155
Msa0329710	MtrunA17_Chr1g0184121	33.224	304	171	6	1	288	37	324	2.28e-44	154
Msa0329710	MtrunA17_Chr5g0420981	31.046	306	197	7	1	299	53	351	2.79e-44	154
Msa0329710	MtrunA17_Chr7g0239101	32.595	316	190	9	1	305	55	358	4.44e-44	154
Msa0329710	MtrunA17_Chr5g0420951	31.290	310	199	6	1	303	53	355	6.16e-44	153
Msa0329710	MtrunA17_Chr8g0365241	31.922	307	193	8	1	299	57	355	6.25e-44	153
Msa0329710	MtrunA17_Chr5g0423251	31.833	311	195	9	1	303	47	348	1.07e-43	152
Msa0329710	MtrunA17_Chr5g0423191	30.094	319	194	10	1	305	47	350	1.78e-43	152
Msa0329710	MtrunA17_Chr3g0102041	32.721	272	168	7	1	263	39	304	2.04e-43	152
Msa0329710	MtrunA17_Chr8g0375601	31.329	316	197	9	1	305	48	354	2.30e-43	152
Msa0329710	MtrunA17_Chr7g0239121	31.132	318	189	11	1	303	51	353	5.42e-43	151
Msa0329710	MtrunA17_Chr7g0239071	32.632	285	168	7	31	303	29	301	5.54e-43	150
Msa0329710	MtrunA17_Chr2g0314381	29.712	313	201	8	1	303	77	380	1.02e-42	150
Msa0329710	MtrunA17_Chr2g0311711	30.667	300	186	9	1	288	67	356	1.05e-42	150
Msa0329710	MtrunA17_Chr4g0045431	31.511	311	181	9	1	286	26	329	1.11e-42	150
Msa0329710	MtrunA17_Chr1g0167931	32.907	313	152	11	1	303	54	318	1.29e-42	149
Msa0329710	MtrunA17_Chr7g0239821	33.121	314	187	10	1	303	64	365	1.30e-42	150
Msa0329710	MtrunA17_Chr4g0055591	29.545	308	195	7	1	298	61	356	1.57e-42	150
Msa0329710	MtrunA17_Chr5g0426891	29.936	314	199	8	1	303	39	342	3.66e-42	148
Msa0329710	MtrunA17_Chr8g0375671	30.599	317	199	8	1	305	52	359	5.86e-42	148
Msa0329710	MtrunA17_Chr8g0371921	35.039	254	154	5	16	263	56	304	1.21e-41	147
Msa0329710	MtrunA17_Chr2g0314401	30.159	315	197	11	1	303	51	354	1.27e-41	147
Msa0329710	MtrunA17_Chr5g0421011	28.571	322	195	9	1	305	47	350	1.58e-41	147
Msa0329710	MtrunA17_Chr5g0421091	30.063	316	199	7	1	305	45	349	1.62e-41	147
Msa0329710	MtrunA17_Chr5g0424211	32.632	285	166	7	1	271	42	314	1.64e-41	146
Msa0329710	MtrunA17_Chr7g0235951	29.375	320	196	8	1	303	67	373	1.94e-41	147
Msa0329710	MtrunA17_Chr7g0250511	31.290	310	199	5	1	303	49	351	2.26e-41	146
Msa0329710	MtrunA17_Chr5g0421101	30.380	316	197	8	1	305	47	350	3.38e-41	146
Msa0329710	MtrunA17_Chr2g0314391	28.662	314	203	9	1	303	70	373	3.52e-41	146
Msa0329710	MtrunA17_Chr2g0285931	33.099	284	157	7	21	283	42	313	3.58e-41	145
Msa0329710	MtrunA17_Chr5g0423221	31.447	318	188	11	1	303	71	373	3.66e-41	146
Msa0329710	MtrunA17_Chr5g0420901	30.449	312	202	6	1	305	46	349	4.04e-41	146
Msa0329710	MtrunA17_Chr1g0184151	31.229	301	182	6	1	289	38	325	5.92e-41	145
Msa0329710	MtrunA17_Chr2g0311691	31.000	300	180	8	1	284	63	351	7.28e-41	145
Msa0329710	MtrunA17_Chr5g0423201	28.296	311	207	6	1	303	47	349	8.35e-41	145
Msa0329710	MtrunA17_Chr4g0064781	31.410	312	192	10	1	303	50	348	9.86e-41	145
Msa0329710	MtrunA17_Chr5g0420941	29.904	311	203	5	1	304	45	347	1.07e-40	145
Msa0329710	MtrunA17_Chr2g0311681	31.000	300	180	9	1	284	63	351	1.55e-40	145
Msa0329710	MtrunA17_Chr8g0358941	28.125	320	200	6	1	303	27	333	1.87e-40	144
Msa0329710	MtrunA17_Chr4g0050031	31.447	318	190	8	1	303	62	366	2.73e-40	144
Msa0329710	MtrunA17_Chr5g0398291	33.447	293	167	10	1	275	47	329	2.91e-40	144
Msa0329710	MtrunA17_Chr1g0191201	32.323	297	174	8	2	280	54	341	3.75e-40	144
Msa0329710	MtrunA17_Chr2g0313111	28.707	317	193	8	1	303	28	325	5.21e-40	142
Msa0329710	MtrunA17_Chr2g0311741	30.293	307	177	7	1	289	27	314	6.35e-40	142
Msa0329710	MtrunA17_Chr5g0439011	34.050	279	160	6	1	269	5	269	1.12e-39	141
Msa0329710	MtrunA17_Chr5g0405411	32.463	268	161	5	6	263	47	304	1.14e-39	142
Msa0329710	MtrunA17_Chr1g0184101	31.000	300	182	7	1	288	38	324	1.17e-39	142
Msa0329710	MtrunA17_Chr5g0421041	29.936	314	201	10	1	305	45	348	2.64e-39	141
Msa0329710	MtrunA17_Chr2g0289341	30.263	304	193	8	1	296	4	296	2.65e-39	140
Msa0329710	MtrunA17_Chr1g0204181	33.333	285	159	5	13	280	77	347	4.90e-39	141
Msa0329710	MtrunA17_Chr8g0375681	30.496	282	174	7	33	303	15	285	1.20e-38	138
Msa0329710	MtrunA17_Chr6g0474391	32.632	285	161	5	13	280	82	352	2.72e-38	139
Msa0329710	MtrunA17_Chr3g0130391	31.525	295	179	5	2	280	67	354	2.76e-38	139
Msa0329710	MtrunA17_Chr8g0375701	31.208	298	180	9	18	303	71	355	7.13e-38	137
Msa0329710	MtrunA17_Chr2g0332191	30.667	300	175	8	1	284	52	334	9.09e-38	137
Msa0329710	MtrunA17_Chr3g0121141	31.058	293	181	9	1	285	4	283	1.08e-37	135
Msa0329710	MtrunA17_Chr8g0351101	31.348	319	187	6	1	299	54	360	2.85e-37	136
Msa0329710	MtrunA17_Chr8g0364471	28.662	314	196	9	1	298	67	368	4.01e-37	135
Msa0329710	MtrunA17_Chr4g0045461	30.592	304	180	6	1	280	26	322	5.68e-37	135
Msa0329710	MtrunA17_Chr5g0423211	28.972	321	199	11	1	306	47	353	1.00e-36	134
Msa0329710	MtrunA17_Chr7g0236011	30.818	318	186	11	1	299	67	369	3.05e-36	133
Msa0329710	MtrunA17_Chr4g0052251	30.693	303	172	8	1	283	29	313	4.10e-35	129
Msa0329710	MtrunA17_Chr8g0370711	28.981	314	201	10	1	303	52	354	4.25e-35	130
Msa0329710	MtrunA17_Chr2g0311621	93.651	63	4	0	1	63	55	117	5.47e-35	123
Msa0329710	MtrunA17_Chr7g0235981	29.964	277	177	6	36	303	59	327	5.98e-35	129
Msa0329710	MtrunA17_Chr3g0125421	30.104	289	160	7	21	285	59	329	7.33e-35	129
Msa0329710	MtrunA17_Chr8g0336801	40.132	152	81	3	155	303	12	156	1.08e-34	123
Msa0329710	MtrunA17_Chr3g0126761	37.222	180	103	3	107	284	42	213	1.53e-34	125
Msa0329710	MtrunA17_Chr1g0162191	28.713	303	201	8	1	295	47	342	1.80e-34	128
Msa0329710	MtrunA17_Chr3g0087031	29.630	297	192	9	1	289	60	347	2.14e-34	128
Msa0329710	MtrunA17_Chr7g0220011	29.054	296	186	8	4	287	39	322	3.40e-34	127
Msa0329710	MtrunA17_Chr7g0232161	34.118	255	143	10	1	243	60	301	3.80e-34	127
Msa0329710	MtrunA17_Chr5g0420721	30.290	241	152	7	72	305	21	252	4.85e-34	125
Msa0329710	MtrunA17_Chr7g0239091	27.974	311	199	6	1	304	160	452	5.18e-34	129
Msa0329710	MtrunA17_Chr7g0220001	29.293	297	189	7	1	288	41	325	8.45e-34	126
Msa0329710	MtrunA17_Chr8g0370721	26.814	317	204	9	1	303	52	354	1.14e-33	126
Msa0329710	MtrunA17_Chr3g0092531	31.419	296	176	7	1	283	6	287	1.29e-33	125
Msa0329710	MtrunA17_Chr7g0247991	30.769	299	187	8	1	287	67	357	1.91e-33	126
Msa0329710	MtrunA17_Chr8g0335411	30.124	322	191	10	1	303	67	373	5.57e-33	124
Msa0329710	MtrunA17_Chr3g0114861	32.542	295	174	9	1	283	40	321	6.07e-33	124
Msa0329710	MtrunA17_Chr2g0319491	28.621	290	189	6	1	282	33	312	8.86e-33	123
Msa0329710	MtrunA17_Chr3g0145171	28.435	313	204	8	1	303	52	354	9.31e-33	124
Msa0329710	MtrunA17_Chr4g0068891	29.139	302	175	8	1	283	20	301	6.74e-32	120
Msa0329710	MtrunA17_Chr1g0148771	28.276	290	187	7	1	284	63	337	1.11e-31	121
Msa0329710	MtrunA17_Chr5g0420881	37.908	153	87	2	154	305	1	146	8.79e-31	113
Msa0329710	MtrunA17_Chr3g0145181	28.309	272	173	9	24	284	75	335	1.61e-30	117
Msa0329710	MtrunA17_Chr1g0194321	27.184	309	184	9	1	283	20	313	2.63e-30	117
Msa0329710	MtrunA17_Chr4g0066991	27.036	307	190	7	1	298	67	348	6.12e-30	116
Msa0329710	MtrunA17_Chr8g0384481	28.956	297	187	7	1	282	59	346	1.08e-29	116
Msa0329710	MtrunA17_Chr3g0145201	27.660	282	179	9	15	285	701	968	1.67e-29	118
Msa0329710	MtrunA17_Chr4g0011311	27.948	229	153	4	1	224	67	288	8.75e-29	112
Msa0329710	MtrunA17_Chr6g0488511	27.987	318	190	11	1	303	3	296	2.93e-27	108
Msa0329710	MtrunA17_Chr4g0075471	36.686	169	93	5	124	289	3	160	4.17e-27	103
Msa0329710	MtrunA17_Chr3g0114871	31.356	236	138	7	1	224	42	265	5.85e-27	106
Msa0329710	MtrunA17_Chr8g0384461	27.483	302	192	11	1	285	47	338	1.70e-26	107
Msa0329710	MtrunA17_Chr7g0247741	28.333	300	192	8	22	306	29	320	3.28e-26	105
Msa0329710	MtrunA17_Chr2g0314371	26.148	283	166	11	1	251	52	323	4.44e-26	105
Msa0329710	MtrunA17_Chr8g0336871	35.000	180	93	6	126	298	7	169	1.55e-25	100
Msa0329710	MtrunA17_Chr5g0394071	36.364	165	96	2	120	282	13	170	1.72e-25	100
Msa0329710	MtrunA17_Chr8g0362741	28.643	199	131	4	29	224	83	273	1.20e-24	100
Msa0329710	MtrunA17_Chr1g0170631	32.843	204	122	7	107	305	1	194	1.21e-24	98.6
Msa0329710	MtrunA17_Chr6g0486831	29.167	312	192	12	4	292	24	329	1.37e-24	101
Msa0329710	MtrunA17_Chr4g0053251	28.097	331	182	11	1	290	8	323	1.43e-23	98.6
Msa0329710	MtrunA17_Chr8g0348951	28.289	304	188	8	21	305	27	319	1.49e-23	98.2
Msa0329710	MtrunA17_Chr4g0064771	32.039	206	111	7	109	295	10	205	4.54e-23	94.7
Msa0329710	MtrunA17_Chr7g0233661	36.424	151	87	2	134	282	1	144	6.55e-23	92.8
Msa0329710	MtrunA17_Chr8g0389941	25.159	314	200	9	4	292	37	340	2.21e-22	95.5
Msa0329710	MtrunA17_Chr3g0092581	36.986	146	77	4	139	283	28	159	2.49e-22	92.0
Msa0329710	MtrunA17_Chr3g0105281	29.588	267	157	12	1	254	34	282	5.40e-22	94.0
Msa0329710	MtrunA17_Chr4g0037611	33.533	167	97	5	121	282	3	160	1.67e-21	89.7
Msa0329710	MtrunA17_Chr8g0336831	33.871	186	112	7	1	177	60	243	4.72e-21	90.1
Msa0329710	MtrunA17_Chr2g0293931	29.808	208	111	8	92	281	1	191	3.94e-19	84.0
Msa0329710	MtrunA17_Chr8g0364171	35.385	130	77	2	95	224	4	126	5.77e-19	81.6
Msa0329710	MtrunA17_Chr4g0004071	26.298	289	176	8	1	270	9	279	9.54e-19	84.7
Msa0329710	MtrunA17_Chr1g0161101	42.857	112	46	4	155	264	407	502	1.65e-18	85.5
Msa0329710	MtrunA17_Chr4g0055911	25.079	315	210	11	1	298	9	314	2.38e-17	80.9
Msa0329710	MtrunA17_Chr4g0055871	23.824	319	210	9	1	301	9	312	4.33e-16	77.4
Msa0329710	MtrunA17_Chr4g0004061	25.965	285	183	6	1	270	9	280	4.77e-16	77.4
Msa0329710	MtrunA17_Chr5g0407731	27.119	295	181	12	1	283	33	305	2.99e-15	75.1
Msa0329710	MtrunA17_Chr5g0407781	24.916	297	185	9	1	283	5	277	3.16e-15	74.7
Msa0329710	MtrunA17_Chr1g0167921	44.928	69	31	1	155	223	95	156	2.22e-14	70.1
Msa0329710	MtrunA17_Chr2g0319521	33.010	103	62	1	122	224	29	124	3.94e-14	68.6
Msa0329710	MtrunA17_Chr8g0375581	36.000	75	40	2	147	220	18	85	1.04e-13	65.9
Msa0329710	MtrunA17_Chr1g0158011	28.736	174	111	4	114	282	75	240	7.91e-13	67.4
Msa0329710	MtrunA17_Chr4g0009561	30.075	133	86	2	172	303	192	318	8.82e-13	67.8
Msa0329710	MtrunA17_Chr3g0138351	25.939	293	183	10	11	285	23	299	6.00e-12	65.5
Msa0329710	MtrunA17_Chr8g0336791	34.400	125	73	5	1	117	60	183	1.41e-11	62.4
Msa0329710	MtrunA17_Chr1g0148781	22.884	319	215	10	1	298	8	316	8.24e-11	62.0

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0329710	AT3G12900.1	57.566	304	119	2	3	302	58	355	1.80e-132	380
Msa0329710	AT3G13610.1	46.753	308	151	4	1	303	62	361	7.58e-103	305
Msa0329710	AT1G55290.1	44.481	308	158	4	1	303	62	361	4.07e-97	291
Msa0329710	AT5G12270.1	41.479	311	167	8	1	303	56	359	9.94e-71	223
Msa0329710	AT4G10500.1	36.334	311	180	6	1	302	44	345	3.11e-57	188
Msa0329710	AT4G10490.1	32.911	316	193	6	1	306	42	348	1.20e-54	181
Msa0329710	AT2G36690.2	34.295	312	189	6	1	304	61	364	4.30e-53	178
Msa0329710	AT2G36690.1	34.295	312	189	6	1	304	61	364	4.30e-53	178
Msa0329710	AT3G55970.1	36.789	299	164	9	1	283	52	341	6.12e-53	177
Msa0329710	AT2G30830.1	34.237	295	181	6	15	303	71	358	1.35e-51	174
Msa0329710	AT1G06640.1	34.951	309	182	9	1	298	64	364	1.73e-51	174
Msa0329710	AT5G43450.1	33.115	305	189	6	1	298	61	357	2.51e-51	173
Msa0329710	AT5G59530.1	33.228	316	189	9	1	303	58	364	2.57e-50	171
Msa0329710	AT2G30840.1	34.354	294	177	9	15	300	75	360	4.83e-50	170
Msa0329710	AT5G59540.1	32.381	315	192	9	1	303	61	366	1.24e-49	169
Msa0329710	AT1G06650.2	34.603	315	185	10	1	303	64	369	2.15e-49	168
Msa0329710	AT5G43440.1	34.505	313	186	10	1	303	62	365	2.45e-49	168
Msa0329710	AT1G03410.2	34.437	302	171	7	1	287	57	346	4.09e-48	165
Msa0329710	AT1G77330.1	32.667	300	172	7	1	285	3	287	4.35e-48	163
Msa0329710	AT1G03410.1	34.437	302	171	7	1	287	94	383	7.47e-48	165
Msa0329710	AT1G04350.1	33.333	312	190	10	1	303	58	360	1.04e-47	164
Msa0329710	AT3G19010.1	32.399	321	186	6	1	303	28	335	3.61e-47	162
Msa0329710	AT3G19010.4	32.399	321	186	6	1	303	28	335	3.61e-47	162
Msa0329710	AT1G06645.1	35.333	300	173	11	13	303	92	379	3.86e-47	162
Msa0329710	AT1G06620.1	31.833	311	197	6	1	303	62	365	4.59e-46	159
Msa0329710	AT1G04380.1	33.119	311	190	9	1	303	45	345	5.12e-46	159
Msa0329710	AT2G30840.3	34.014	294	172	10	15	300	75	354	5.95e-46	159
Msa0329710	AT3G61400.1	34.722	288	162	9	14	287	80	355	8.26e-45	156
Msa0329710	AT3G21420.1	33.121	314	193	8	1	303	55	362	1.21e-44	155
Msa0329710	AT3G19000.1	34.539	304	171	7	1	283	32	328	1.62e-44	155
Msa0329710	AT3G11180.2	35.484	279	157	8	1	267	95	362	2.48e-44	156
Msa0329710	AT5G05600.1	34.007	297	173	7	1	283	62	349	3.06e-44	155
Msa0329710	AT3G11180.1	35.484	279	157	8	1	267	95	362	3.16e-44	155
Msa0329710	AT5G08640.2	32.192	292	181	6	2	283	41	325	9.11e-44	152
Msa0329710	AT5G08640.1	32.192	292	181	6	2	283	41	325	9.11e-44	152
Msa0329710	AT3G51240.1	35.018	277	155	9	1	263	38	303	1.26e-43	153
Msa0329710	AT2G25450.1	32.166	314	193	9	1	303	55	359	1.52e-43	152
Msa0329710	AT2G38240.1	33.333	312	183	9	1	299	48	347	1.54e-43	152
Msa0329710	AT1G17010.1	29.299	314	202	9	1	303	54	358	1.62e-43	152
Msa0329710	AT4G25300.1	30.312	320	191	9	1	303	52	356	3.71e-43	152
Msa0329710	AT1G15550.1	31.186	295	179	7	1	284	57	338	4.79e-43	151
Msa0329710	AT1G17020.1	28.438	320	198	9	1	303	53	358	4.95e-43	151
Msa0329710	AT1G03400.1	32.558	301	171	8	17	304	66	347	1.04e-42	150
Msa0329710	AT3G19010.3	32.899	307	173	7	1	303	28	305	1.53e-42	149
Msa0329710	AT5G24530.1	33.443	305	171	9	1	285	38	330	7.30e-42	148
Msa0329710	AT1G78550.1	29.206	315	200	9	1	303	53	356	9.95e-42	148
Msa0329710	AT4G16330.2	29.487	312	189	11	1	299	67	360	1.41e-41	147
Msa0329710	AT1G78440.1	30.556	324	183	10	1	302	18	321	1.19e-40	144
Msa0329710	AT1G30040.1	32.971	276	166	5	20	283	44	312	3.87e-40	143
Msa0329710	AT3G60290.1	30.945	307	196	8	1	299	52	350	4.61e-40	144
Msa0329710	AT4G22880.1	29.487	312	190	9	1	293	47	347	6.59e-40	143
Msa0329710	AT4G22880.2	29.487	312	190	9	1	293	47	347	6.59e-40	143
Msa0329710	AT4G22880.3	29.487	312	190	9	1	293	47	347	6.59e-40	143
Msa0329710	AT1G62380.1	32.441	299	176	9	1	289	7	289	6.60e-40	142
Msa0329710	AT5G43450.2	35.683	227	134	4	1	223	61	279	2.82e-39	139
Msa0329710	AT4G25420.1	33.453	278	165	4	21	285	83	353	4.28e-39	141
Msa0329710	AT1G78550.2	29.474	285	179	8	30	303	5	278	6.12e-39	139
Msa0329710	AT1G12010.1	31.373	306	184	9	1	296	7	296	7.77e-39	139
Msa0329710	AT2G44800.1	29.936	314	204	7	1	306	52	357	9.74e-39	140
Msa0329710	AT1G80330.1	30.435	299	180	7	1	284	49	334	1.03e-38	140
Msa0329710	AT5G20400.1	29.618	314	200	9	1	303	45	348	1.35e-38	139
Msa0329710	AT3G55970.2	35.833	240	129	9	1	224	52	282	1.40e-38	138
Msa0329710	AT1G60980.1	31.834	289	168	5	13	285	75	350	2.30e-38	139
Msa0329710	AT1G05010.1	32.781	302	168	10	1	284	4	288	1.14e-37	136
Msa0329710	AT4G25310.1	30.132	302	177	9	18	303	70	353	1.19e-37	137
Msa0329710	AT5G51810.1	30.592	304	177	6	1	285	63	351	1.29e-37	137
Msa0329710	AT1G03400.2	29.787	329	171	8	17	304	66	375	4.54e-37	136
Msa0329710	AT1G06640.2	34.177	237	141	6	1	230	64	292	8.10e-37	134
Msa0329710	AT5G43440.2	36.910	233	131	8	1	226	62	285	8.51e-37	133
Msa0329710	AT2G34555.1	31.419	296	175	8	1	283	27	307	1.18e-36	134
Msa0329710	AT5G07200.1	31.724	290	157	6	21	285	81	354	3.58e-36	134
Msa0329710	AT3G19000.2	33.597	253	140	7	1	232	32	277	4.52e-36	131
Msa0329710	AT4G21200.1	33.077	260	157	6	1	254	42	290	4.70e-36	132
Msa0329710	AT1G80340.1	30.272	294	183	7	1	284	50	331	5.13e-36	132
Msa0329710	AT5G63590.1	30.405	296	181	9	1	283	14	297	9.93e-36	131
Msa0329710	AT3G51240.2	35.111	225	125	7	50	263	5	219	1.12e-35	130
Msa0329710	AT5G59540.2	33.476	233	137	7	1	224	61	284	1.18e-35	130
Msa0329710	AT1G06640.3	34.361	227	134	6	1	220	64	282	5.57e-35	128
Msa0329710	AT1G06620.2	34.061	229	139	4	1	224	62	283	6.77e-35	128
Msa0329710	AT4G16330.1	31.390	223	134	6	83	299	45	254	8.34e-35	127
Msa0329710	AT5G63600.1	29.000	300	187	7	1	290	33	316	1.41e-34	128
Msa0329710	AT5G07480.1	30.464	302	183	11	1	285	44	335	2.50e-34	128
Msa0329710	AT1G04380.2	35.065	231	135	6	1	226	45	265	2.87e-34	126
Msa0329710	AT2G30840.2	35.065	231	134	6	1	223	57	279	4.93e-34	126
Msa0329710	AT1G06650.1	33.478	230	138	6	1	223	64	285	6.48e-34	126
Msa0329710	AT5G63600.2	29.236	301	186	8	1	290	33	317	8.72e-34	126
Msa0329710	AT4G25300.2	32.394	213	125	5	102	303	58	262	1.48e-33	124
Msa0329710	AT3G61400.2	35.747	221	120	5	14	224	80	288	3.96e-33	124
Msa0329710	AT2G19590.1	30.375	293	175	10	1	284	11	283	6.11e-33	124
Msa0329710	AT1G49390.1	28.931	318	197	10	1	303	45	348	9.47e-33	124
Msa0329710	AT4G21690.1	28.523	298	187	9	3	284	46	333	3.37e-32	122
Msa0329710	AT1G44090.1	31.000	300	176	11	1	280	63	351	1.24e-31	122
Msa0329710	AT3G19010.2	32.099	243	142	5	1	225	28	265	2.44e-31	119
Msa0329710	AT5G43935.1	27.551	294	174	8	1	284	19	283	4.52e-31	118
Msa0329710	AT1G47990.1	31.438	299	175	10	1	283	15	299	2.06e-30	117
Msa0329710	AT5G05600.2	32.353	238	138	7	1	224	62	290	8.30e-30	115
Msa0329710	AT1G50960.1	30.584	291	174	11	1	277	40	316	8.96e-30	115
Msa0329710	AT1G49390.2	27.857	280	181	8	34	303	1	269	4.37e-29	112
Msa0329710	AT1G02400.1	27.815	302	183	9	1	283	24	309	1.22e-28	112
Msa0329710	AT5G20550.1	28.239	301	186	11	1	285	45	331	1.59e-28	112
Msa0329710	AT5G54000.2	27.586	290	189	8	24	303	71	349	5.80e-28	111
Msa0329710	AT3G46490.1	27.653	311	197	9	4	292	20	324	1.93e-27	109
Msa0329710	AT5G63595.1	29.084	251	148	6	1	247	25	249	1.96e-27	108
Msa0329710	AT2G19590.2	30.798	263	153	10	31	284	26	268	3.75e-27	108
Msa0329710	AT4G25420.2	34.101	217	123	4	21	224	83	292	3.43e-26	105
Msa0329710	AT5G51810.2	31.020	245	137	5	1	227	63	293	6.15e-26	104
Msa0329710	AT5G54000.1	26.786	280	184	8	34	303	1	269	9.34e-26	103
Msa0329710	AT3G49620.1	28.479	309	180	11	1	278	34	332	1.53e-25	104
Msa0329710	AT4G25310.2	27.797	295	165	9	18	303	70	325	2.32e-24	100
Msa0329710	AT3G49630.3	29.391	279	146	11	16	263	30	288	9.18e-24	99.4
Msa0329710	AT3G49630.1	29.225	284	140	10	16	263	34	292	9.43e-24	99.4
Msa0329710	AT1G30040.2	31.797	217	129	5	20	224	44	253	3.00e-23	97.1
Msa0329710	AT1G35190.1	27.152	302	185	8	18	292	26	319	6.10e-23	97.1
Msa0329710	AT3G50210.4	27.759	299	170	10	1	263	8	296	2.01e-22	95.9
Msa0329710	AT3G50210.1	27.759	299	170	10	1	263	8	296	2.01e-22	95.9
Msa0329710	AT3G50210.3	27.759	299	170	10	1	263	8	296	2.01e-22	95.9
Msa0329710	AT1G35190.2	27.835	291	174	9	18	292	26	296	3.40e-22	94.7
Msa0329710	AT3G46490.2	27.574	272	169	9	4	253	20	285	8.10e-22	94.0
Msa0329710	AT5G07480.2	28.340	247	154	9	70	303	9	245	3.48e-21	90.9
Msa0329710	AT3G46500.5	27.303	304	200	11	4	292	20	317	4.94e-21	92.0
Msa0329710	AT5G63580.2	32.365	241	127	8	1	224	19	240	1.82e-20	88.6
Msa0329710	AT4G23340.1	27.875	287	178	10	24	295	30	302	1.98e-20	90.1
Msa0329710	AT5G63580.1	32.000	250	133	10	1	233	19	248	3.00e-20	88.2
Msa0329710	AT5G51310.1	27.463	335	193	11	1	303	5	321	1.30e-19	87.8
Msa0329710	AT3G46500.7	27.778	270	174	11	1	255	17	280	1.75e-18	84.3
Msa0329710	AT4G23340.2	29.381	194	119	5	109	295	2	184	2.03e-18	82.4
Msa0329710	AT1G14120.2	26.838	272	172	10	1	262	8	262	3.83e-18	83.6
Msa0329710	AT1G14120.1	26.838	272	172	10	1	262	8	262	3.83e-18	83.6
Msa0329710	AT1G14120.3	26.838	272	172	10	1	262	8	262	3.83e-18	83.6
Msa0329710	AT3G46480.1	36.000	125	77	2	168	292	156	277	7.14e-18	82.4
Msa0329710	AT1G14130.1	29.779	272	164	12	1	262	9	263	3.84e-17	80.5
Msa0329710	AT3G50210.2	33.136	169	93	4	105	263	56	214	1.16e-16	78.6
Msa0329710	AT1G52820.1	26.056	284	183	9	1	270	12	282	1.24e-16	79.3
Msa0329710	AT3G49630.2	32.738	168	90	6	105	263	66	219	6.01e-16	76.6
Msa0329710	AT3G46500.10	28.505	214	140	6	89	292	33	243	7.14e-16	76.3
Msa0329710	AT3G46500.1	28.505	214	140	6	89	292	33	243	7.14e-16	76.3
Msa0329710	AT3G46500.4	29.121	182	123	4	114	292	3	181	7.19e-16	74.7
Msa0329710	AT1G02400.2	26.639	244	145	8	1	226	24	251	1.39e-15	75.5
Msa0329710	AT5G58660.1	25.000	288	166	11	1	254	34	305	4.25e-15	75.1
Msa0329710	AT4G16765.5	34.146	123	78	2	166	288	75	194	6.79e-15	72.4
Msa0329710	AT3G47190.1	24.460	278	165	10	1	254	32	288	1.63e-14	73.6
Msa0329710	AT4G16765.6	34.146	123	78	2	166	288	121	240	2.02e-14	72.0
Msa0329710	AT4G16765.1	34.146	123	78	2	166	288	121	240	2.02e-14	72.0
Msa0329710	AT4G16765.2	34.146	123	78	2	166	288	121	240	2.02e-14	72.0
Msa0329710	AT4G03070.1	25.743	303	197	9	1	287	14	304	4.69e-14	72.0
Msa0329710	AT4G16765.3	40.659	91	51	2	166	256	121	208	1.38e-13	69.3
Msa0329710	AT3G46500.3	29.944	177	111	6	89	255	33	206	1.41e-13	69.3
Msa0329710	AT3G46500.6	31.034	145	94	4	114	255	34	175	5.21e-13	67.0
Msa0329710	AT3G46500.8	31.034	145	94	4	114	255	34	175	5.21e-13	67.0
Msa0329710	AT1G15540.1	25.325	308	187	11	1	279	9	302	6.08e-13	68.6
Msa0329710	AT1G15540.4	25.325	308	187	11	1	279	9	302	6.08e-13	68.6
Msa0329710	AT1G15540.3	25.325	308	187	11	1	279	16	309	7.34e-13	68.6
Msa0329710	AT1G15540.2	25.325	308	187	11	1	279	12	305	7.49e-13	68.6
Msa0329710	AT1G52800.1	27.368	285	171	12	1	267	10	276	3.49e-12	66.2
Msa0329710	AT4G22870.1	28.723	94	66	1	201	293	10	103	8.91e-11	58.9

Find 76 sgRNAs with CRISPR-Local

Find 282 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TTGTGTTCCTTTAGATTTAA+TGG	0.153451	2_4:+43572578	Msa0329710:CDS
CCATCTTTCTTCACCAATTC+TGG	0.189153	2_4:-43576238	None:intergenic
ATGGGTTGTATGTATATCTT+TGG	0.249136	2_4:-43572412	None:intergenic
GATTATGTAGACAACTTCTT+TGG	0.251304	2_4:+43576292	Msa0329710:CDS
CGAGATGGGAATGGAGTTAA+AGG	0.299667	2_4:+43572361	Msa0329710:five_prime_UTR
AAAAGTTTAAAGATGAGATA+TGG	0.312204	2_4:+43572666	Msa0329710:CDS
GTTAAAGGCTTGGTAGATTC+AGG	0.314420	2_4:+43572376	Msa0329710:five_prime_UTR
ATGAAGATGCTCTTCAATAT+TGG	0.337615	2_4:+43572760	Msa0329710:CDS
ATTATGTAGACAACTTCTTT+GGG	0.345467	2_4:+43576293	Msa0329710:CDS
CTGGAAATTCCACCAATTCC+TGG	0.355964	2_4:+43574477	Msa0329710:CDS
CCGCAAACAACTTTCTTCTC+TGG	0.366427	2_4:-43572642	None:intergenic
CCCACAGTAAGATCTGGATT+TGG	0.375047	2_4:-43574345	None:intergenic
ATCAAATTTGTAAGATGAAA+AGG	0.379223	2_4:-43572250	None:intergenic
GAAATATTAATTGGTAAGCT+AGG	0.382920	2_4:+43574246	Msa0329710:CDS
TTCAGCTTTGATAAGTCAAT+TGG	0.383199	2_4:-43572477	None:intergenic
CAATGTTGGTGATGCTCTAC+AGG	0.387509	2_4:+43574512	Msa0329710:CDS
GATTGGCCCGTTACCAGAAT+TGG	0.402403	2_4:+43576225	Msa0329710:CDS
ATGACTAAAGCTCCAGGAAT+TGG	0.413667	2_4:-43574489	None:intergenic
CCACAGTAAGATCTGGATTT+GGG	0.418332	2_4:-43574344	None:intergenic
AGATCTGGATTTGGGCATGC+TGG	0.426908	2_4:-43574336	None:intergenic
CCAGAATTGGTGAAGAAAGA+TGG	0.433407	2_4:+43576238	Msa0329710:CDS
AGGACTTACTTGCACACATT+AGG	0.435005	2_4:-43572783	None:intergenic
TCTTCACCAATTCTGGTAAC+GGG	0.438747	2_4:-43576231	None:intergenic
GTTAGAGCAGCTGAAACTCT+TGG	0.442981	2_4:+43572534	Msa0329710:CDS
AGTGACTCCATTAAATCTAA+AGG	0.443276	2_4:-43572585	None:intergenic
AAAGTTTAAAGATGAGATAT+GGG	0.448781	2_4:+43572667	Msa0329710:CDS
ATGGAAAGACTATATCGTTA+TGG	0.461316	2_4:+43572725	Msa0329710:CDS
CCAGATCTTACTGTGGGTGC+AGG	0.463667	2_4:+43574351	Msa0329710:CDS
TCCCGAGAAAGAAAATGTTC+TGG	0.471707	2_4:+43572701	Msa0329710:CDS
GAACACAATGATTCACTACT+TGG	0.475517	2_4:-43572563	None:intergenic
CCAGAGAAGAAAGTTGTTTG+CGG	0.476958	2_4:+43572642	Msa0329710:CDS
TGACACTGCCATCACTTAGT+AGG	0.480031	2_4:-43572198	None:intergenic
TTCTTCACCAATTCTGGTAA+CGG	0.482565	2_4:-43576232	None:intergenic
CTGCTTCAAGATGGAGTTGG+TGG	0.486453	2_4:+43574405	Msa0329710:CDS
AGCTTTGATAAGTCAATTGG+TGG	0.497967	2_4:-43572474	None:intergenic
AGAAAGAAAATGTTCTGGAA+TGG	0.511521	2_4:+43572706	Msa0329710:CDS
TACAACTTTGCTGTACGAGA+TGG	0.512487	2_4:+43572346	Msa0329710:five_prime_UTR
GATCTGGATTTGGGCATGCT+GGG	0.521590	2_4:-43574335	None:intergenic
GTAGAGGATGACAATGATGT+TGG	0.532520	2_4:+43574441	Msa0329710:CDS
ATTGACTTATCAAAGCTGAA+TGG	0.534320	2_4:+43572480	Msa0329710:CDS
CCTGCACCCACAGTAAGATC+TGG	0.539005	2_4:-43574351	None:intergenic
ATTATCTTGTGATTGTGTGT+TGG	0.539258	2_4:-43572279	None:intergenic
ACTAAAGCTCCAGGAATTGG+TGG	0.545240	2_4:-43574486	None:intergenic
TCTCTGTTTGACAACCAAAG+AGG	0.545713	2_4:+43576532	Msa0329710:three_prime_UTR
TGTAAGATGAAAAGGAGAGA+AGG	0.547343	2_4:-43572242	None:intergenic
ACAACTTTGCTGTACGAGAT+GGG	0.547707	2_4:+43572347	Msa0329710:five_prime_UTR
CCTATGCCAACAGAGATGAT+TGG	0.551257	2_4:+43576208	Msa0329710:CDS
TGGGAATGGAGTTAAAGGCT+TGG	0.552017	2_4:+43572366	Msa0329710:five_prime_UTR
CCAATCATCTCTGTTGGCAT+AGG	0.556190	2_4:-43576208	None:intergenic
TAATTTAAGGTACTAAGCAA+TGG	0.558277	2_4:+43576109	Msa0329710:intron
CAAACAACTTTCTTCTCTGG+TGG	0.558311	2_4:-43572639	None:intergenic
TGTTGGACAAGGAGAATGGC+TGG	0.559004	2_4:+43574458	Msa0329710:CDS
TAAAGATTGAATAATATATG+TGG	0.560331	2_4:+43576455	Msa0329710:three_prime_UTR
AACGGGCCAATCATCTCTGT+TGG	0.572721	2_4:-43576214	None:intergenic
ATTGGTGAAGAAAGATGGAT+TGG	0.576023	2_4:+43576243	Msa0329710:CDS
TTTGCTGTACGAGATGGGAA+TGG	0.580173	2_4:+43572352	Msa0329710:five_prime_UTR
ATGATGTTGGACAAGGAGAA+TGG	0.585749	2_4:+43574454	Msa0329710:CDS
TAGTCTTATTGGTTTGAAGA+CGG	0.585823	2_4:+43574296	Msa0329710:CDS
ATCACAGTGCTGCTTCAAGA+TGG	0.589742	2_4:+43574396	Msa0329710:CDS
TGATTCTTTATCGCAAGATG+AGG	0.591282	2_4:-43576390	None:intergenic
GGAGCTTTAGTCATCAATGT+TGG	0.594241	2_4:+43574498	Msa0329710:CDS
TTATGTAGACAACTTCTTTG+GGG	0.595548	2_4:+43576294	Msa0329710:CDS
AATTGATACTCTGGATTGAG+TGG	0.602801	2_4:-43576170	None:intergenic
TATGTAGACAACTTCTTTGG+GGG	0.603572	2_4:+43576295	Msa0329710:CDS
ATTAATTGGTAAGCTAGGAG+TGG	0.604027	2_4:+43574251	Msa0329710:CDS
CAGATCTTACTGTGGGTGCA+GGG	0.607660	2_4:+43574352	Msa0329710:CDS
ACATTGATGACTAAAGCTCC+AGG	0.611867	2_4:-43574495	None:intergenic
CTCTCGGTCCTACTAAGTGA+TGG	0.614253	2_4:+43572190	None:intergenic
GCAGGGCGACATACAGACAC+AGG	0.614647	2_4:+43574369	Msa0329710:CDS
TCAATTGGTGGCATATCACA+TGG	0.615151	2_4:-43572462	None:intergenic
TGGTTTGCATGTTAAAGTAG+AGG	0.618791	2_4:+43574425	Msa0329710:CDS
CCAAATCCAGATCTTACTGT+GGG	0.629025	2_4:+43574345	Msa0329710:CDS
GTGCTGCTTCAAGATGGAGT+TGG	0.650740	2_4:+43574402	Msa0329710:CDS
CCCAAATCCAGATCTTACTG+TGG	0.653231	2_4:+43574344	Msa0329710:CDS
CAGGGCGACATACAGACACA+GGG	0.659766	2_4:+43574370	Msa0329710:CDS
GATGACAATGATGTTGGACA+AGG	0.680297	2_4:+43574447	Msa0329710:CDS

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	AACAAAATATCTTAAATAAA+GGG	-	chr2_4:43574025-43574044	None:intergenic	10.0%
!!	AAACAAAATATCTTAAATAA+AGG	-	chr2_4:43574026-43574045	None:intergenic	10.0%
!!!	ATATAATAAATTAGTTTGTT+TGG	+	chr2_4:43574789-43574808	Msa0329710:intron	10.0%
!!	AAAAATTGAATATAAAAAAG+TGG	-	chr2_4:43575046-43575065	None:intergenic	10.0%
!!	AAAAATTGAATATAAAAAAG+TGG	-	chr2_4:43575046-43575065	None:intergenic	10.0%
!!	AAATAAAAAATTATAAGTGA+AGG	+	chr2_4:43575218-43575237	Msa0329710:intron	10.0%
!!	AATAAAAAATTATAAGTGAA+GGG	+	chr2_4:43575219-43575238	Msa0329710:intron	10.0%
!!	TTTATAAAGAAATTTAATAG+GGG	+	chr2_4:43575262-43575281	Msa0329710:intron	10.0%
!!	AATGATATACTTATTATTAT+AGG	-	chr2_4:43576018-43576037	None:intergenic	10.0%
!!	TATTCTAATGATTAAAAGAA+AGG	-	chr2_4:43572806-43572825	None:intergenic	15.0%
!!	AAAATCATAAATTACTACAA+AGG	+	chr2_4:43573129-43573148	Msa0329710:intron	15.0%
!!!	AGATATTTTGTTTATAATTG+TGG	+	chr2_4:43574033-43574052	Msa0329710:intron	15.0%
!!!	GACATTTTAGAAATATTAAT+TGG	+	chr2_4:43574237-43574256	Msa0329710:CDS	15.0%
!!	ATAAAAAATTATAAGTGAAG+GGG	+	chr2_4:43575220-43575239	Msa0329710:intron	15.0%
!!	TATGAAAAAAATATTCACTA+TGG	-	chr2_4:43575342-43575361	None:intergenic	15.0%
!!!	AATATTTGTCATTTACAAAA+TGG	-	chr2_4:43575889-43575908	None:intergenic	15.0%
!!	CTTAAATTAATATAGCAAAA+GGG	-	chr2_4:43576098-43576117	None:intergenic	15.0%
!!	TAAAGATTGAATAATATATG+TGG	+	chr2_4:43576455-43576474	Msa0329710:three_prime_UTR	15.0%
!!	ATCAAATTTGTAAGATGAAA+AGG	-	chr2_4:43572253-43572272	None:intergenic	20.0%
!!!	TAGTTTGTTGATTCTTTTAT+GGG	-	chr2_4:43572433-43572452	None:intergenic	20.0%
!!	AAAAGTTTAAAGATGAGATA+TGG	+	chr2_4:43572666-43572685	Msa0329710:CDS	20.0%
!!	AAAGTTTAAAGATGAGATAT+GGG	+	chr2_4:43572667-43572686	Msa0329710:CDS	20.0%
!!	CACATATTCCAAAAAATAAA+TGG	-	chr2_4:43572995-43573014	None:intergenic	20.0%
!!!	TTTTTACTACAACTGTTATT+CGG	-	chr2_4:43573072-43573091	None:intergenic	20.0%
!!	AATTACTACAAAGGAATTAT+CGG	+	chr2_4:43573138-43573157	Msa0329710:intron	20.0%
!!	GTTTATGGTAAAATATCTAT+TGG	-	chr2_4:43573942-43573961	None:intergenic	20.0%
!!	TAGCTTTCTCAATAAAATAA+TGG	-	chr2_4:43574122-43574141	None:intergenic	20.0%
!!!	TCAAAAATTGATAGTCTTAT+TGG	+	chr2_4:43574285-43574304	Msa0329710:CDS	20.0%
!!!	ATATTCTAAAAGATATTCCT+TGG	-	chr2_4:43574754-43574773	None:intergenic	20.0%
!!	TGTTTGGATAATGTTAAAAT+TGG	+	chr2_4:43574805-43574824	Msa0329710:intron	20.0%
!!!	TGTCAAAATTTAGCAATTTT+CGG	+	chr2_4:43574847-43574866	Msa0329710:intron	20.0%
!!!	TCAAATTCATAGTTTTTAGA+TGG	-	chr2_4:43574876-43574895	None:intergenic	20.0%
!!	TAAAAAATTATAAGTGAAGG+GGG	+	chr2_4:43575221-43575240	Msa0329710:intron	20.0%
!!!	TGTTTAACATTGCATTTTTA+AGG	-	chr2_4:43575476-43575495	None:intergenic	20.0%
!!!	TGCAAAATTGATAATAATCT+TGG	+	chr2_4:43575618-43575637	Msa0329710:intron	20.0%
!!	TTTCTCATCATTTAAACTAT+AGG	+	chr2_4:43575715-43575734	Msa0329710:intron	20.0%
!!!	TATATTGATGAATTTCCTTT+TGG	-	chr2_4:43575791-43575810	None:intergenic	20.0%
!!	ACATATATAACACATTTGAT+GGG	+	chr2_4:43575976-43575995	Msa0329710:intron	20.0%
!!	CCTTAAATTAATATAGCAAA+AGG	-	chr2_4:43576099-43576118	None:intergenic	20.0%
!!!	CCTTTTGCTATATTAATTTA+AGG	+	chr2_4:43576096-43576115	Msa0329710:intron	20.0%
!!!	TAAACTTTTAATTCATCTTG+TGG	+	chr2_4:43576432-43576451	Msa0329710:three_prime_UTR	20.0%
!!	AAGATAATTGCACATTTTCA+TGG	+	chr2_4:43572294-43572313	Msa0329710:five_prime_UTR	25.0%
!!!	GATTTTGAAGAGTTTAAAAC+TGG	-	chr2_4:43572322-43572341	None:intergenic	25.0%
!!!	CTAGTTTGTTGATTCTTTTA+TGG	-	chr2_4:43572434-43572453	None:intergenic	25.0%
!	TTGTGTTCCTTTAGATTTAA+TGG	+	chr2_4:43572578-43572597	Msa0329710:CDS	25.0%
!!!	ATTCGCAACCATTTATTTTT+TGG	+	chr2_4:43572984-43573003	Msa0329710:intron	25.0%
!	ACAGTTGTAGTAAAAAAAAG+TGG	+	chr2_4:43573076-43573095	Msa0329710:intron	25.0%
!	ATTACTACAAAGGAATTATC+GGG	+	chr2_4:43573139-43573158	Msa0329710:intron	25.0%
!	AGATTAAACACCTCAAAATA+TGG	+	chr2_4:43573307-43573326	Msa0329710:intron	25.0%
!	AACTAGCAAGTGTTTATATA+AGG	-	chr2_4:43573821-43573840	None:intergenic	25.0%
!!	TTATATAAACACTTGCTAGT+TGG	+	chr2_4:43573820-43573839	Msa0329710:intron	25.0%
!!!	GCTTTTTGATTAAGTAAAGA+AGG	-	chr2_4:43574059-43574078	None:intergenic	25.0%
!	AATCAAATATTTCCATTTGC+AGG	+	chr2_4:43574169-43574188	Msa0329710:intron	25.0%
!	ATCAAATATTTCCATTTGCA+GGG	+	chr2_4:43574170-43574189	Msa0329710:intron	25.0%
!	GAAATATTAATTGGTAAGCT+AGG	+	chr2_4:43574246-43574265	Msa0329710:CDS	25.0%
!	TTCCGAAATATTAAAACACA+CGG	-	chr2_4:43574673-43574692	None:intergenic	25.0%
!	ATTTGACATGTACACATATA+AGG	-	chr2_4:43574961-43574980	None:intergenic	25.0%
!	TATATGTGTACATGTCAAAT+TGG	+	chr2_4:43574961-43574980	Msa0329710:intron	25.0%
!	GAAAAAAATATTCACTATGG+TGG	-	chr2_4:43575339-43575358	None:intergenic	25.0%
!	TAGAAATATTACCCATATAG+AGG	-	chr2_4:43575375-43575394	None:intergenic	25.0%
!	TCTATATGGGTAATATTTCT+AGG	+	chr2_4:43575374-43575393	Msa0329710:intron	25.0%
!!	GTTATGATTTTCTTGATTTC+AGG	-	chr2_4:43575412-43575431	None:intergenic	25.0%
!!!	AAATTTGAGTTGGAATAGTT+GGG	-	chr2_4:43575553-43575572	None:intergenic	25.0%
!!!	AAAATTTGAGTTGGAATAGT+TGG	-	chr2_4:43575554-43575573	None:intergenic	25.0%
!	AGAGGATAAAAAATTTGAGT+TGG	-	chr2_4:43575563-43575582	None:intergenic	25.0%
!	GATTCAAAGGAATTTCTTAT+GGG	-	chr2_4:43575596-43575615	None:intergenic	25.0%
!	AGATTCAAAGGAATTTCTTA+TGG	-	chr2_4:43575597-43575616	None:intergenic	25.0%
!!	TCAATTTTGCAAAGATTCAA+AGG	-	chr2_4:43575609-43575628	None:intergenic	25.0%
!	ATAATAATCTTGGATTGTGA+GGG	+	chr2_4:43575628-43575647	Msa0329710:intron	25.0%
!	ATTAATCACCATCAGATAAA+TGG	+	chr2_4:43575668-43575687	Msa0329710:intron	25.0%
!!!	GAATTTCCTTTTGGTTTTTT+GGG	-	chr2_4:43575782-43575801	None:intergenic	25.0%
!!!	TGAATTTCCTTTTGGTTTTT+TGG	-	chr2_4:43575783-43575802	None:intergenic	25.0%
!	AAATTAAATTAGAGCGTGTT+AGG	-	chr2_4:43575866-43575885	None:intergenic	25.0%
!	GACATATATAACACATTTGA+TGG	+	chr2_4:43575975-43575994	Msa0329710:intron	25.0%
!	TAATATAGCAAAAGGGTTAT+TGG	-	chr2_4:43576091-43576110	None:intergenic	25.0%
!!	TAATTTAAGGTACTAAGCAA+TGG	+	chr2_4:43576109-43576128	Msa0329710:intron	25.0%
!	ATTATGTAGACAACTTCTTT+GGG	+	chr2_4:43576293-43576312	Msa0329710:CDS	25.0%
!!	TACATTAATCTTTTCCTCTT+TGG	-	chr2_4:43576549-43576568	None:intergenic	25.0%
	ATTATCTTGTGATTGTGTGT+TGG	-	chr2_4:43572282-43572301	None:intergenic	30.0%
!	ATGGGTTGTATGTATATCTT+TGG	-	chr2_4:43572415-43572434	None:intergenic	30.0%
!	TTCAGCTTTGATAAGTCAAT+TGG	-	chr2_4:43572480-43572499	None:intergenic	30.0%
!	ATTGACTTATCAAAGCTGAA+TGG	+	chr2_4:43572480-43572499	Msa0329710:CDS	30.0%
	TGGAAAAGAACATGAAAAAG+TGG	+	chr2_4:43572500-43572519	Msa0329710:CDS	30.0%
	AAAAGAACATGAAAAAGTGG+TGG	+	chr2_4:43572503-43572522	Msa0329710:CDS	30.0%
	AGTGACTCCATTAAATCTAA+AGG	-	chr2_4:43572588-43572607	None:intergenic	30.0%
!	TTCCAGAACATTTTCTTTCT+CGG	-	chr2_4:43572706-43572725	None:intergenic	30.0%
!!	AGAAAGAAAATGTTCTGGAA+TGG	+	chr2_4:43572706-43572725	Msa0329710:CDS	30.0%
	ATGGAAAGACTATATCGTTA+TGG	+	chr2_4:43572725-43572744	Msa0329710:CDS	30.0%
	ATGAAGATGCTCTTCAATAT+TGG	+	chr2_4:43572760-43572779	Msa0329710:CDS	30.0%
!!!	TGTTGTGTTTGTTTTTGTGT+GGG	-	chr2_4:43572893-43572912	None:intergenic	30.0%
	ATAAATGGTTGCGAATGTTT+AGG	-	chr2_4:43572980-43572999	None:intergenic	30.0%
!	AACGATTAAGCCATATTTTG+AGG	-	chr2_4:43573320-43573339	None:intergenic	30.0%
	TCGATGAAAACCAATCAATA+TGG	+	chr2_4:43573339-43573358	Msa0329710:intron	30.0%
!	TCTGTTTCTTTGGATATATC+CGG	+	chr2_4:43573583-43573602	Msa0329710:intron	30.0%
!!	ATACGTTTTGGATATTGGAT+CGG	+	chr2_4:43573606-43573625	Msa0329710:intron	30.0%
	CAAGTGTTTATATAAGGTTG+GGG	-	chr2_4:43573815-43573834	None:intergenic	30.0%
	GCAAGTGTTTATATAAGGTT+GGG	-	chr2_4:43573816-43573835	None:intergenic	30.0%
	AGCAAGTGTTTATATAAGGT+TGG	-	chr2_4:43573817-43573836	None:intergenic	30.0%
	AGTTAATTCTAGCGAAAAGT+TGG	-	chr2_4:43573913-43573932	None:intergenic	30.0%
	CTCAAGATAATAGTCGTTTA+TGG	-	chr2_4:43573957-43573976	None:intergenic	30.0%
	GACTATTATCTTGAGATAGA+GGG	+	chr2_4:43573962-43573981	Msa0329710:intron	30.0%
!!	TAGTCTTATTGGTTTGAAGA+CGG	+	chr2_4:43574296-43574315	Msa0329710:CDS	30.0%
!!	TACCATTTGAGTTGTACTTT+CGG	-	chr2_4:43574580-43574599	None:intergenic	30.0%
	CAAATGGTAAAAAAACTGCA+AGG	+	chr2_4:43574591-43574610	Msa0329710:intron	30.0%
!!!	CTCCGTGTGTTTTAATATTT+CGG	+	chr2_4:43574668-43574687	Msa0329710:intron	30.0%
!!	TTTTAAAAGCGTGTACTGTT+TGG	+	chr2_4:43574714-43574733	Msa0329710:intron	30.0%
!	TGGATGAAAGAATTTTACCA+AGG	+	chr2_4:43574734-43574753	Msa0329710:intron	30.0%
	GGACTATTTCGAAAGAAAAT+AGG	-	chr2_4:43574940-43574959	None:intergenic	30.0%
	TGAAACTTTCGAAAAGTTGA+AGG	-	chr2_4:43574998-43575017	None:intergenic	30.0%
	CAAGTCAAGTATGAAACTTT+CGG	-	chr2_4:43575009-43575028	None:intergenic	30.0%
!	AAAATATTCACTATGGTGGA+TGG	-	chr2_4:43575335-43575354	None:intergenic	30.0%
!!	TGGGTAATATTTCTAGGAAA+TGG	+	chr2_4:43575380-43575399	Msa0329710:intron	30.0%
!!	GATTTTCTTGATTTCAGGTA+TGG	-	chr2_4:43575407-43575426	None:intergenic	30.0%
!!	CATTGCATTTTTAAGGAAGT+GGG	-	chr2_4:43575469-43575488	None:intergenic	30.0%
!!	ACATTGCATTTTTAAGGAAG+TGG	-	chr2_4:43575470-43575489	None:intergenic	30.0%
	ATATACCTATCAAAGGAGAA+TGG	-	chr2_4:43575525-43575544	None:intergenic	30.0%
	GATAATAATCTTGGATTGTG+AGG	+	chr2_4:43575627-43575646	Msa0329710:intron	30.0%
	GAAATTCCCAAAAAACCAAA+AGG	+	chr2_4:43575773-43575792	Msa0329710:intron	30.0%
	GAAAAATGGAATTGATACTC+TGG	-	chr2_4:43576182-43576201	None:intergenic	30.0%
!	CTGAATATAGAGAAGTTTTG+TGG	+	chr2_4:43576266-43576285	Msa0329710:CDS	30.0%
	GATTATGTAGACAACTTCTT+TGG	+	chr2_4:43576292-43576311	Msa0329710:CDS	30.0%
	TTATGTAGACAACTTCTTTG+GGG	+	chr2_4:43576294-43576313	Msa0329710:CDS	30.0%
	AACAGAGAAGAAAAAAAGGA+AGG	-	chr2_4:43576520-43576539	None:intergenic	30.0%
	GTCAAACAGAGAAGAAAAAA+AGG	-	chr2_4:43576524-43576543	None:intergenic	30.0%
	GAAAAGGAGAGAAGGAAAAA+TGG	-	chr2_4:43572237-43572256	None:intergenic	35.0%
	TGTAAGATGAAAAGGAGAGA+AGG	-	chr2_4:43572245-43572264	None:intergenic	35.0%
!	AGCTTTGATAAGTCAATTGG+TGG	-	chr2_4:43572477-43572496	None:intergenic	35.0%
	GAACACAATGATTCACTACT+TGG	-	chr2_4:43572566-43572585	None:intergenic	35.0%
!	TCCAGAACATTTTCTTTCTC+GGG	-	chr2_4:43572705-43572724	None:intergenic	35.0%
!!!	CTGTTGTGTTTGTTTTTGTG+TGG	-	chr2_4:43572894-43572913	None:intergenic	35.0%
	ACACTAACCAAATTTGTGCA+AGG	+	chr2_4:43573202-43573221	Msa0329710:intron	35.0%
	TAGTCTACCTTGCACAAATT+TGG	-	chr2_4:43573212-43573231	None:intergenic	35.0%
!!	TGATCTGAGTTGTTTTATCC+TGG	-	chr2_4:43573250-43573269	None:intergenic	35.0%
	TGGTTACGTACCATATTGAT+TGG	-	chr2_4:43573352-43573371	None:intergenic	35.0%
	ACTCGTTAACATAAGTCGAA+GGG	+	chr2_4:43573419-43573438	Msa0329710:intron	35.0%
	ACATGAATCATCAACTGTGT+CGG	+	chr2_4:43573458-43573477	Msa0329710:intron	35.0%
	TTACGAACTCTGCCTATAAA+AGG	-	chr2_4:43573509-43573528	None:intergenic	35.0%
	TCCAATATCCAAAACGTATC+CGG	-	chr2_4:43573605-43573624	None:intergenic	35.0%
	GACTTAAAAATGTCCCACAT+TGG	-	chr2_4:43573855-43573874	None:intergenic	35.0%
	CGACTATTATCTTGAGATAG+AGG	+	chr2_4:43573961-43573980	Msa0329710:intron	35.0%
!	GAGATAGAGGGAATATGTTT+TGG	+	chr2_4:43573974-43573993	Msa0329710:intron	35.0%
	ATTAATTGGTAAGCTAGGAG+TGG	+	chr2_4:43574251-43574270	Msa0329710:CDS	35.0%
!	TGGTTTGCATGTTAAAGTAG+AGG	+	chr2_4:43574425-43574444	Msa0329710:CDS	35.0%
!	TTCCGAAAGTACAACTCAAA+TGG	+	chr2_4:43574575-43574594	Msa0329710:intron	35.0%
	GATAGAAGAAACTTGGATGT+GGG	-	chr2_4:43575297-43575316	None:intergenic	35.0%
	TGATAGAAGAAACTTGGATG+TGG	-	chr2_4:43575298-43575317	None:intergenic	35.0%
	TTGCTGTGATAGAAGAAACT+TGG	-	chr2_4:43575304-43575323	None:intergenic	35.0%
	TACACTTGTTCTCCTCTATA+TGG	+	chr2_4:43575360-43575379	Msa0329710:intron	35.0%
	ACACTTGTTCTCCTCTATAT+GGG	+	chr2_4:43575361-43575380	Msa0329710:intron	35.0%
!!	ATAGAGGTGTTTGCAAAACA+AGG	-	chr2_4:43575444-43575463	None:intergenic	35.0%
	TTTAAGGAAGTGGGAAATAG+AGG	-	chr2_4:43575460-43575479	None:intergenic	35.0%
	TGGACTGTGAGTGAAAAATT+TGG	-	chr2_4:43575502-43575521	None:intergenic	35.0%
	GGATAGGATATACCTATCAA+AGG	-	chr2_4:43575532-43575551	None:intergenic	35.0%
	CAATGTAGCCATTTATCTGA+TGG	-	chr2_4:43575679-43575698	None:intergenic	35.0%
	TAATGGGGAAATGTGAAACT+TGG	-	chr2_4:43575744-43575763	None:intergenic	35.0%
!	AATTTCGCTTGGTGATAATG+GGG	-	chr2_4:43575759-43575778	None:intergenic	35.0%
!	GAATTTCGCTTGGTGATAAT+GGG	-	chr2_4:43575760-43575779	None:intergenic	35.0%
	TTACCATAGTTCACTAGTCA+TGG	-	chr2_4:43576054-43576073	None:intergenic	35.0%
	AATTGATACTCTGGATTGAG+TGG	-	chr2_4:43576173-43576192	None:intergenic	35.0%
	TTCTTCACCAATTCTGGTAA+CGG	-	chr2_4:43576235-43576254	None:intergenic	35.0%
	ATTGGTGAAGAAAGATGGAT+TGG	+	chr2_4:43576243-43576262	Msa0329710:CDS	35.0%
!!	ATATAGAGAAGTTTTGTGGC+AGG	+	chr2_4:43576270-43576289	Msa0329710:CDS	35.0%
	TATGTAGACAACTTCTTTGG+GGG	+	chr2_4:43576295-43576314	Msa0329710:CDS	35.0%
!	GATTTTGCAAAGATCAACTC+TGG	+	chr2_4:43576343-43576362	Msa0329710:CDS	35.0%
	TGATTCTTTATCGCAAGATG+AGG	-	chr2_4:43576393-43576412	None:intergenic	35.0%
!	TACAACTTTGCTGTACGAGA+TGG	+	chr2_4:43572346-43572365	Msa0329710:five_prime_UTR	40.0%
!	ACAACTTTGCTGTACGAGAT+GGG	+	chr2_4:43572347-43572366	Msa0329710:five_prime_UTR	40.0%
!	GTTAAAGGCTTGGTAGATTC+AGG	+	chr2_4:43572376-43572395	Msa0329710:five_prime_UTR	40.0%
!	TCAATTGGTGGCATATCACA+TGG	-	chr2_4:43572465-43572484	None:intergenic	40.0%
	CAAACAACTTTCTTCTCTGG+TGG	-	chr2_4:43572642-43572661	None:intergenic	40.0%
	CCAGAGAAGAAAGTTGTTTG+CGG	+	chr2_4:43572642-43572661	Msa0329710:CDS	40.0%
	TCCCGAGAAAGAAAATGTTC+TGG	+	chr2_4:43572701-43572720	Msa0329710:CDS	40.0%
	AGGACTTACTTGCACACATT+AGG	-	chr2_4:43572786-43572805	None:intergenic	40.0%
!!!	TGTGTTTGTTTTTGTGTGGG+TGG	-	chr2_4:43572890-43572909	None:intergenic	40.0%
	TTAGTGGCTATCCTAAGCTT+GGG	-	chr2_4:43572931-43572950	None:intergenic	40.0%
	TGTTTAGGCCAATTTCGTGT+CGG	-	chr2_4:43572965-43572984	None:intergenic	40.0%
	TAAAGAGAGTGACCTAATCG+TGG	-	chr2_4:43573170-43573189	None:intergenic	40.0%
!!	TCTGAGTTGTTTTATCCTGG+AGG	-	chr2_4:43573247-43573266	None:intergenic	40.0%
	TCTACTCCTTTCTATCCCTT+CGG	-	chr2_4:43573387-43573406	None:intergenic	40.0%
	GACTCGTTAACATAAGTCGA+AGG	+	chr2_4:43573418-43573437	Msa0329710:intron	40.0%
	TGTCGGTGTAAAGAATGAGT+GGG	+	chr2_4:43573475-43573494	Msa0329710:intron	40.0%
!	AACAGAAACGCGTTAGCTTA+AGG	-	chr2_4:43573569-43573588	None:intergenic	40.0%
!	CTAACGCGTTTCTGTTTCTT+TGG	+	chr2_4:43573573-43573592	Msa0329710:intron	40.0%
!	GGATATATCCGGATACGTTT+TGG	+	chr2_4:43573594-43573613	Msa0329710:intron	40.0%
!!	TCCGGATACGTTTTGGATAT+TGG	+	chr2_4:43573601-43573620	Msa0329710:intron	40.0%
	GATCGGATTCGTTACACTTT+CGG	+	chr2_4:43573623-43573642	Msa0329710:intron	40.0%
!	TAAACACTTGCTAGTTGGTG+TGG	+	chr2_4:43573825-43573844	Msa0329710:intron	40.0%
	CCACAGTAAGATCTGGATTT+GGG	-	chr2_4:43574347-43574366	None:intergenic	40.0%
	CCAAATCCAGATCTTACTGT+GGG	+	chr2_4:43574345-43574364	Msa0329710:CDS	40.0%
	GTAGAGGATGACAATGATGT+TGG	+	chr2_4:43574441-43574460	Msa0329710:CDS	40.0%
	GATGACAATGATGTTGGACA+AGG	+	chr2_4:43574447-43574466	Msa0329710:CDS	40.0%
	ATGATGTTGGACAAGGAGAA+TGG	+	chr2_4:43574454-43574473	Msa0329710:CDS	40.0%
	ATGACTAAAGCTCCAGGAAT+TGG	-	chr2_4:43574492-43574511	None:intergenic	40.0%
!	ACATTGATGACTAAAGCTCC+AGG	-	chr2_4:43574498-43574517	None:intergenic	40.0%
!	GGAGCTTTAGTCATCAATGT+TGG	+	chr2_4:43574498-43574517	Msa0329710:CDS	40.0%
	TACCTATCAAAGGAGAATGG+TGG	-	chr2_4:43575522-43575541	None:intergenic	40.0%
!	TGAGTTGGAATAGTTGGGAT+AGG	-	chr2_4:43575548-43575567	None:intergenic	40.0%
!!	CTTATGGGTTAGAAGCTTAG+AGG	-	chr2_4:43575581-43575600	None:intergenic	40.0%
	ATAATCTTGGATTGTGAGGG+AGG	+	chr2_4:43575631-43575650	Msa0329710:intron	40.0%
!	GGAATTTCGCTTGGTGATAA+TGG	-	chr2_4:43575761-43575780	None:intergenic	40.0%
!!!	GGTTTTTTGGGAATTTCGCT+TGG	-	chr2_4:43575770-43575789	None:intergenic	40.0%
!!	CACATTTGATGGGTTTCACT+TGG	+	chr2_4:43575986-43576005	Msa0329710:intron	40.0%
!!	ATTTGATGGGTTTCACTTGG+TGG	+	chr2_4:43575989-43576008	Msa0329710:intron	40.0%
!!	TTTGATGGGTTTCACTTGGT+GGG	+	chr2_4:43575990-43576009	Msa0329710:intron	40.0%
	GAACCATGACTAGTGAACTA+TGG	+	chr2_4:43576048-43576067	Msa0329710:intron	40.0%
	GGCATAGGATGAGTGAAAAA+TGG	-	chr2_4:43576196-43576215	None:intergenic	40.0%
	TCTTCACCAATTCTGGTAAC+GGG	-	chr2_4:43576234-43576253	None:intergenic	40.0%
	CCATCTTTCTTCACCAATTC+TGG	-	chr2_4:43576241-43576260	None:intergenic	40.0%
	CCAGAATTGGTGAAGAAAGA+TGG	+	chr2_4:43576238-43576257	Msa0329710:CDS	40.0%
!	TTCTTTGGGGGTTCTCATAA+AGG	+	chr2_4:43576307-43576326	Msa0329710:CDS	40.0%
	TCTCTGTTTGACAACCAAAG+AGG	+	chr2_4:43576532-43576551	Msa0329710:three_prime_UTR	40.0%
	TGACACTGCCATCACTTAGT+AGG	-	chr2_4:43572201-43572220	None:intergenic	45.0%
!	TTTGCTGTACGAGATGGGAA+TGG	+	chr2_4:43572352-43572371	Msa0329710:five_prime_UTR	45.0%
	CGAGATGGGAATGGAGTTAA+AGG	+	chr2_4:43572361-43572380	Msa0329710:five_prime_UTR	45.0%
	TGGGAATGGAGTTAAAGGCT+TGG	+	chr2_4:43572366-43572385	Msa0329710:five_prime_UTR	45.0%
	GTTAGAGCAGCTGAAACTCT+TGG	+	chr2_4:43572534-43572553	Msa0329710:CDS	45.0%
	CCGCAAACAACTTTCTTCTC+TGG	-	chr2_4:43572645-43572664	None:intergenic	45.0%
	TAGTGGCTATCCTAAGCTTG+GGG	-	chr2_4:43572930-43572949	None:intergenic	45.0%
	CTTAGTGGCTATCCTAAGCT+TGG	-	chr2_4:43572932-43572951	None:intergenic	45.0%
!!	GAGTTGTTTTATCCTGGAGG+CGG	-	chr2_4:43573244-43573263	None:intergenic	45.0%
	ACCACTCTTATCGAAACCGA+AGG	+	chr2_4:43573368-43573387	Msa0329710:intron	45.0%
	CCACTCTTATCGAAACCGAA+GGG	+	chr2_4:43573369-43573388	Msa0329710:intron	45.0%
	TCGAAACCGAAGGGATAGAA+AGG	+	chr2_4:43573378-43573397	Msa0329710:intron	45.0%
	ATAAGTCGAAGGGAGAAGAG+AGG	+	chr2_4:43573429-43573448	Msa0329710:intron	45.0%
!	GTGTCGGTGTAAAGAATGAG+TGG	+	chr2_4:43573474-43573493	Msa0329710:intron	45.0%
	GTCGGTGTAAAGAATGAGTG+GGG	+	chr2_4:43573476-43573495	Msa0329710:intron	45.0%
	TCGGTGTAAAGAATGAGTGG+GGG	+	chr2_4:43573477-43573496	Msa0329710:intron	45.0%
!	TGGGGGAACTCTCCTTTTAT+AGG	+	chr2_4:43573494-43573513	Msa0329710:intron	45.0%
	AAGTGCAACTTCCCTGCAAA+TGG	-	chr2_4:43574184-43574203	None:intergenic	45.0%
	CCCAAATCCAGATCTTACTG+TGG	+	chr2_4:43574344-43574363	Msa0329710:CDS	45.0%
	CCCACAGTAAGATCTGGATT+TGG	-	chr2_4:43574348-43574367	None:intergenic	45.0%
!!	ATCACAGTGCTGCTTCAAGA+TGG	+	chr2_4:43574396-43574415	Msa0329710:CDS	45.0%
	CTGGAAATTCCACCAATTCC+TGG	+	chr2_4:43574477-43574496	Msa0329710:CDS	45.0%
	ACTAAAGCTCCAGGAATTGG+TGG	-	chr2_4:43574489-43574508	None:intergenic	45.0%
!!	CAATGTTGGTGATGCTCTAC+AGG	+	chr2_4:43574512-43574531	Msa0329710:CDS	45.0%
!	GAGGTGTTTGCAAAACAAGG+AGG	-	chr2_4:43575441-43575460	None:intergenic	45.0%
	GTCCACCATTCTCCTTTGAT+AGG	+	chr2_4:43575517-43575536	Msa0329710:intron	45.0%
	CCAATCATCTCTGTTGGCAT+AGG	-	chr2_4:43576211-43576230	None:intergenic	45.0%
	CCTATGCCAACAGAGATGAT+TGG	+	chr2_4:43576208-43576227	Msa0329710:CDS	45.0%
!!!	TTTTTATAAAGAAATTTAAT+AGG	+	chr2_4:43575260-43575279	Msa0329710:intron	5.0%
!!!	TTTTATAAAGAAATTTAATA+GGG	+	chr2_4:43575261-43575280	Msa0329710:intron	5.0%
!!	ATATTTATTAATTACTATAA+TGG	+	chr2_4:43575912-43575931	Msa0329710:intron	5.0%
	CAACAAACACCCCCAAGCTT+AGG	+	chr2_4:43572917-43572936	Msa0329710:intron	50.0%
	AGTGGCTATCCTAAGCTTGG+GGG	-	chr2_4:43572929-43572948	None:intergenic	50.0%
!	GTCGGTGTCTGGTTTCTTAG+TGG	-	chr2_4:43572947-43572966	None:intergenic	50.0%
	ACCAGACACCGACACGAAAT+TGG	+	chr2_4:43572954-43572973	Msa0329710:intron	50.0%
!!	TATCGGGTTGAGCCACGATT+AGG	+	chr2_4:43573155-43573174	Msa0329710:intron	50.0%
	CCCTTCGGTTTCGATAAGAG+TGG	-	chr2_4:43573372-43573391	None:intergenic	50.0%
!	TTTTGACCCAATAGCCCGAC+CGG	+	chr2_4:43573704-43573723	Msa0329710:intron	50.0%
	GCTCACCAGTTCGCAAAAGT+GGG	+	chr2_4:43573761-43573780	Msa0329710:intron	50.0%
!!	GGATTCCCACTTTTGCGAAC+TGG	-	chr2_4:43573769-43573788	None:intergenic	50.0%
	TCGCAAAAGTGGGAATCCCA+AGG	+	chr2_4:43573771-43573790	Msa0329710:intron	50.0%
	CGCAAAAGTGGGAATCCCAA+GGG	+	chr2_4:43573772-43573791	Msa0329710:intron	50.0%
	TTGGTGTGGCTCACCAATGT+GGG	+	chr2_4:43573839-43573858	Msa0329710:intron	50.0%
	GATCTGGATTTGGGCATGCT+GGG	-	chr2_4:43574338-43574357	None:intergenic	50.0%
	AGATCTGGATTTGGGCATGC+TGG	-	chr2_4:43574339-43574358	None:intergenic	50.0%
	CAGATCTTACTGTGGGTGCA+GGG	+	chr2_4:43574352-43574371	Msa0329710:CDS	50.0%
!!	GTGCTGCTTCAAGATGGAGT+TGG	+	chr2_4:43574402-43574421	Msa0329710:CDS	50.0%
	CTGCTTCAAGATGGAGTTGG+TGG	+	chr2_4:43574405-43574424	Msa0329710:CDS	50.0%
	TGTTGGACAAGGAGAATGGC+TGG	+	chr2_4:43574458-43574477	Msa0329710:CDS	50.0%
	AACGGGCCAATCATCTCTGT+TGG	-	chr2_4:43576217-43576236	None:intergenic	50.0%
!	GATTGGCCCGTTACCAGAAT+TGG	+	chr2_4:43576225-43576244	Msa0329710:CDS	50.0%
!	GCCAATTTCGTGTCGGTGTC+TGG	-	chr2_4:43572958-43572977	None:intergenic	55.0%
	CGCTCACCAGTTCGCAAAAG+TGG	+	chr2_4:43573760-43573779	Msa0329710:intron	55.0%
	AAGGTTGGGGTGACCTCCAA+GGG	-	chr2_4:43573802-43573821	None:intergenic	55.0%
	TAAGGTTGGGGTGACCTCCA+AGG	-	chr2_4:43573803-43573822	None:intergenic	55.0%
	GTTGGTGTGGCTCACCAATG+TGG	+	chr2_4:43573838-43573857	Msa0329710:intron	55.0%
	CCTGCACCCACAGTAAGATC+TGG	-	chr2_4:43574354-43574373	None:intergenic	55.0%
	CCAGATCTTACTGTGGGTGC+AGG	+	chr2_4:43574351-43574370	Msa0329710:CDS	55.0%
	CAGGGCGACATACAGACACA+GGG	+	chr2_4:43574370-43574389	Msa0329710:CDS	55.0%
!	GTTTTATCCTGGAGGCGGCG+CGG	-	chr2_4:43573239-43573258	None:intergenic	60.0%
	TATATCACGCGCGACGACGC+CGG	-	chr2_4:43573726-43573745	None:intergenic	60.0%
!	GAATCCCAAGGGCACACCCT+TGG	+	chr2_4:43573783-43573802	Msa0329710:intron	60.0%
!	ACCTCCAAGGGTGTGCCCTT+GGG	-	chr2_4:43573790-43573809	None:intergenic	60.0%
	GCAGGGCGACATACAGACAC+AGG	+	chr2_4:43574369-43574388	Msa0329710:CDS	60.0%
	ACGACGCCGGTCGGGCTATT+GGG	-	chr2_4:43573713-43573732	None:intergenic	65.0%
!	TCCCAAGGGCACACCCTTGG+AGG	+	chr2_4:43573786-43573805	Msa0329710:intron	65.0%
!	GACCTCCAAGGGTGTGCCCT+TGG	-	chr2_4:43573791-43573810	None:intergenic	65.0%
	CTAACAACCGCGCCGCCTCC+AGG	+	chr2_4:43573229-43573248	Msa0329710:intron	70.0%
	GACGACGCCGGTCGGGCTAT+TGG	-	chr2_4:43573714-43573733	None:intergenic	70.0%
	TCACGCGCGACGACGCCGGT+CGG	-	chr2_4:43573722-43573741	None:intergenic	75.0%
!	CACGCGCGACGACGCCGGTC+GGG	-	chr2_4:43573721-43573740	None:intergenic	80.0%

Chromosome	Type	Strat	End	Strand	Name
chr2_4	gene	43572194	43576615	43572194	ID=Msa0329710;Name=Msa0329710
chr2_4	mRNA	43572194	43576615	43572194	ID=Msa0329710-mRNA-1;Parent=Msa0329710;Name=Msa0329710-mRNA-1;_AED=0.33;_eAED=0.33;_QI=277\|1\|1\|1\|1\|1\|3\|246\|306
chr2_4	exon	43572194	43572796	43572194	ID=Msa0329710-mRNA-1:exon:13254;Parent=Msa0329710-mRNA-1
chr2_4	exon	43574191	43574533	43574191	ID=Msa0329710-mRNA-1:exon:13255;Parent=Msa0329710-mRNA-1
chr2_4	exon	43576118	43576615	43576118	ID=Msa0329710-mRNA-1:exon:13256;Parent=Msa0329710-mRNA-1
chr2_4	five_prime_UTR	43572194	43572470	43572194	ID=Msa0329710-mRNA-1:five_prime_utr;Parent=Msa0329710-mRNA-1
chr2_4	CDS	43572471	43572796	43572471	ID=Msa0329710-mRNA-1:cds;Parent=Msa0329710-mRNA-1
chr2_4	CDS	43574191	43574533	43574191	ID=Msa0329710-mRNA-1:cds;Parent=Msa0329710-mRNA-1
chr2_4	CDS	43576118	43576369	43576118	ID=Msa0329710-mRNA-1:cds;Parent=Msa0329710-mRNA-1
chr2_4	three_prime_UTR	43576370	43576615	43576370	ID=Msa0329710-mRNA-1:three_prime_utr;Parent=Msa0329710-mRNA-1

Gene Sequence

>Msa0329710

ATGCCACCAATTGACTTATCAAAGCTGAATGGAAAAGAACATGAAAAAGTGGTGGATGAGATTGTTAGAGCAGCTGAAACTCTTGGATTCTTCCAAGTAGTGAATCATTGTGTTCCTTTAGATTTAATGGAGTCACTTAAAGATTCAGCACACACATTTTTCAATATGCCACCAGAGAAGAAAGTTGTTTGCGGAAAAAGTTTAAAGATGAGATATGGGACTAGCTTTGCTCCCGAGAAAGAAAATGTTCTGGAATGGAAAGACTATATCGTTATGGAGTATAGTAATGATGAAGATGCTCTTCAATATTGGCCTAATGTGTGCAAGGAAGTTGCACTTGAATATTTCAAGTTATCATCAAAGATAGTTAGAGACATTTTAGAAATATTAATTGGTAAGCTAGGAGTGGAAGTAGATGACTCAAAAATTGATAGTCTTATTGGTTTGAAGACGGTTAACATGAACTACTACCCAGCATGCCCAAATCCAGATCTTACTGTGGGTGCAGGGCGACATACAGACACAGGGAGCATCACAGTGCTGCTTCAAGATGGAGTTGGTGGTTTGCATGTTAAAGTAGAGGATGACAATGATGTTGGACAAGGAGAATGGCTGGAAATTCCACCAATTCCTGGAGCTTTAGTCATCAATGTTGGTGATGCTCTACAGGTACTAAGCAATGGAAAGTACAAGAGCTGTGAACATCGAGTAATGACAACATCCACTCAATCCAGAGTATCAATTCCATTTTTCACTCATCCTATGCCAACAGAGATGATTGGCCCGTTACCAGAATTGGTGAAGAAAGATGGATTGGCTGAATATAGAGAAGTTTTGTGGCAGGATTATGTAGACAACTTCTTTGGGGGTTCTCATAAAGGAAAGAAGACTCTTGATTTTGCAAAGATCAACTCTGGCTAA

Protein sequence

>Msa0329710

MPPIDLSKLNGKEHEKVVDEIVRAAETLGFFQVVNHCVPLDLMESLKDSAHTFFNMPPEKKVVCGKSLKMRYGTSFAPEKENVLEWKDYIVMEYSNDEDALQYWPNVCKEVALEYFKLSSKIVRDILEILIGKLGVEVDDSKIDSLIGLKTVNMNYYPACPNPDLTVGAGRHTDTGSITVLLQDGVGGLHVKVEDDNDVGQGEWLEIPPIPGALVINVGDALQVLSNGKYKSCEHRVMTTSTQSRVSIPFFTHPMPTEMIGPLPELVKKDGLAEYREVLWQDYVDNFFGGSHKGKKTLDFAKINSG*