AlfalfaGEDB | Msa1298100

M. sativa cultivar zhongmu-4 / Msa1298100

KEGG: K07874
GO: GO:0000003 GO:0000139 GO:0000902 GO:0000904 GO:0003006 GO:0005575 GO:0005622 GO:0005623 GO:0005737 GO:0005773 GO:0005783 GO:0005789 GO:0005794 GO:0005829 GO:0005886 GO:0005911 GO:0006810 GO:0006888 GO:0007275 GO:0008150 GO:0009506 GO:0009555 GO:0009653 GO:0009826 GO:0009856 GO:0009860 GO:0009932 GO:0009987 GO:0012505 GO:0016020 GO:0016043 GO:0016049 GO:0016192 GO:0022414 GO:0030054 GO:0030154 GO:0031090 GO:0031984 GO:0032501 GO:0032502 GO:0032989 GO:0040007 GO:0042175 GO:0043226 GO:0043227 GO:0043229 GO:0043231 GO:0044422 GO:0044424 GO:0044425 GO:0044431 GO:0044432 GO:0044444 GO:0044446 GO:0044464 GO:0044706 GO:0046907 GO:0048193 GO:0048229 GO:0048468 GO:0048588 GO:0048589 GO:0048856 GO:0048868 GO:0048869 GO:0051179 GO:0051234 GO:0051641 GO:0051649 GO:0051704 GO:0055044 GO:0060560 GO:0071840 GO:0071944 GO:0098588 GO:0098791 GO:0098827
PFAM: PF00071.25

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1298100	XP_024638503.1	100.000	202	0	0	1	202	1	202	1.43e-148	421

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1298100	sp\|Q05737\|YPTM2_MAIZE	91.626	203	16	1	1	202	1	203	1.08e-139	391

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1298100	I3SMC0	100.000	202	0	0	1	202	1	202	6.84e-149	421

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0000910	Msa1298100	0.807216	5.632565e-50	-8.615850e-47
Msa0003220	Msa1298100	0.800264	1.563717e-48	-8.615850e-47
Msa0007850	Msa1298100	0.809296	2.030112e-50	-8.615850e-47
Msa0008200	Msa1298100	0.825435	4.693904e-54	-8.615850e-47
Msa0010770	Msa1298100	0.813623	2.330617e-51	-8.615850e-47
Msa0010910	Msa1298100	0.826074	3.311622e-54	-8.615850e-47
Msa0012710	Msa1298100	0.806638	7.462892e-50	-8.615850e-47
Msa0016540	Msa1298100	0.804438	2.160346e-49	-8.615850e-47
Msa0017320	Msa1298100	0.828273	9.854768e-55	-8.615850e-47
Msa0020390	Msa1298100	0.828099	1.085251e-54	-8.615850e-47
Msa0029630	Msa1298100	0.855198	7.411174e-62	-8.615850e-47
Msa0030300	Msa1298100	0.861773	8.103420e-64	-8.615850e-47
Msa0030480	Msa1298100	0.849520	3.067085e-60	-8.615850e-47
Msa0030530	Msa1298100	0.835944	1.249171e-56	-8.615850e-47
Msa0033880	Msa1298100	0.846099	2.685959e-59	-8.615850e-47
Msa0036540	Msa1298100	0.838491	2.786531e-57	-8.615850e-47
Msa0041690	Msa1298100	0.829603	4.693395e-55	-8.615850e-47
Msa0043500	Msa1298100	0.815425	9.304768e-52	-8.615850e-47
Msa0043650	Msa1298100	0.825473	4.598194e-54	-8.615850e-47
Msa0045550	Msa1298100	0.801183	1.015219e-48	-8.615850e-47
Msa0047250	Msa1298100	0.802442	5.600561e-49	-8.615850e-47
Msa0047640	Msa1298100	0.865035	7.903941e-65	-8.615850e-47
Msa0051630	Msa1298100	0.842952	1.888215e-58	-8.615850e-47
Msa0051740	Msa1298100	0.855419	6.387993e-62	-8.615850e-47
Msa0051750	Msa1298100	0.836010	1.202139e-56	-8.615850e-47
Msa0056270	Msa1298100	0.806293	8.825579e-50	-8.615850e-47
Msa0068000	Msa1298100	0.817531	3.142057e-52	-8.615850e-47
Msa0068020	Msa1298100	0.820367	7.119492e-53	-8.615850e-47
Msa0074750	Msa1298100	0.862285	5.648500e-64	-8.615850e-47
Msa0077900	Msa1298100	0.878886	1.953793e-69	-8.615850e-47
Msa0079230	Msa1298100	0.815443	9.221100e-52	-8.615850e-47
Msa0079920	Msa1298100	0.843479	1.366526e-58	-8.615850e-47
Msa0081650	Msa1298100	0.820185	7.839808e-53	-8.615850e-47
Msa0081940	Msa1298100	0.876528	1.299719e-68	-8.615850e-47
Msa0082050	Msa1298100	0.865333	6.372944e-65	-8.615850e-47
Msa0089550	Msa1298100	0.809779	1.598306e-50	-8.615850e-47
Msa0090510	Msa1298100	0.834978	2.191735e-56	-8.615850e-47
Msa0090550	Msa1298100	0.849172	3.833731e-60	-8.615850e-47
Msa0091610	Msa1298100	0.819715	1.004060e-52	-8.615850e-47
Msa0093010	Msa1298100	0.852176	5.480146e-61	-8.615850e-47
Msa0095360	Msa1298100	0.822094	2.846586e-53	-8.615850e-47
Msa0095770	Msa1298100	0.830276	3.217795e-55	-8.615850e-47
Msa0098400	Msa1298100	0.815879	7.373935e-52	-8.615850e-47
Msa0100160	Msa1298100	0.800590	1.341874e-48	-8.615850e-47
Msa0103790	Msa1298100	0.831079	2.045297e-55	-8.615850e-47
Msa0106620	Msa1298100	0.834895	2.300007e-56	-8.615850e-47
Msa0106710	Msa1298100	0.825742	3.971934e-54	-8.615850e-47
Msa0111080	Msa1298100	0.822314	2.530940e-53	-8.615850e-47
Msa0115370	Msa1298100	0.816011	6.889483e-52	-8.615850e-47
Msa0604290	Msa1298100	0.801646	8.163459e-49	-8.615850e-47
Msa0605510	Msa1298100	0.829939	3.886983e-55	-8.615850e-47
Msa0606080	Msa1298100	0.843493	1.354931e-58	-8.615850e-47
Msa0608270	Msa1298100	0.839067	1.978084e-57	-8.615850e-47
Msa0610250	Msa1298100	0.851428	8.931917e-61	-8.615850e-47
Msa0614510	Msa1298100	0.812346	4.440398e-51	-8.615850e-47
Msa0616450	Msa1298100	0.824480	7.888017e-54	-8.615850e-47
Msa0616640	Msa1298100	0.835996	1.211909e-56	-8.615850e-47
Msa0617170	Msa1298100	0.802423	5.650958e-49	-8.615850e-47
Msa0618950	Msa1298100	0.845912	3.020846e-59	-8.615850e-47
Msa0618970	Msa1298100	0.830801	2.393563e-55	-8.615850e-47
Msa0620230	Msa1298100	0.820929	5.289392e-53	-8.615850e-47
Msa0620330	Msa1298100	0.801974	6.988505e-49	-8.615850e-47
Msa0621600	Msa1298100	0.811682	6.195475e-51	-8.615850e-47
Msa0622120	Msa1298100	0.824633	7.261063e-54	-8.615850e-47
Msa0622790	Msa1298100	0.837255	5.788352e-57	-8.615850e-47
Msa0628420	Msa1298100	0.852554	4.277583e-61	-8.615850e-47
Msa0633570	Msa1298100	0.813502	2.477806e-51	-8.615850e-47
Msa0640940	Msa1298100	0.834064	3.719642e-56	-8.615850e-47
Msa0642970	Msa1298100	0.844336	8.051898e-59	-8.615850e-47
Msa0644030	Msa1298100	0.864603	1.079494e-64	-8.615850e-47
Msa0646470	Msa1298100	0.842063	3.250521e-58	-8.615850e-47
Msa0647030	Msa1298100	0.831385	1.720432e-55	-8.615850e-47
Msa0647430	Msa1298100	0.817988	2.477681e-52	-8.615850e-47
Msa0648830	Msa1298100	0.843853	1.085531e-58	-8.615850e-47
Msa0651560	Msa1298100	0.807581	4.712502e-50	-8.615850e-47
Msa0652690	Msa1298100	0.845739	3.365022e-59	-8.615850e-47
Msa0655920	Msa1298100	0.831059	2.069164e-55	-8.615850e-47
Msa0657120	Msa1298100	0.824102	9.679953e-54	-8.615850e-47
Msa0658680	Msa1298100	0.835536	1.585240e-56	-8.615850e-47
Msa0659790	Msa1298100	0.835615	1.513809e-56	-8.615850e-47
Msa0660040	Msa1298100	0.820341	7.220475e-53	-8.615850e-47
Msa0662630	Msa1298100	0.855819	4.885451e-62	-8.615850e-47
Msa0679360	Msa1298100	0.838744	2.397075e-57	-8.615850e-47
Msa0682680	Msa1298100	0.809799	1.582435e-50	-8.615850e-47
Msa0686080	Msa1298100	0.806850	6.733822e-50	-8.615850e-47
Msa0689440	Msa1298100	0.851762	7.185250e-61	-8.615850e-47
Msa0690310	Msa1298100	0.805647	1.206755e-49	-8.615850e-47
Msa0695130	Msa1298100	0.812653	3.804109e-51	-8.615850e-47
Msa0697680	Msa1298100	0.806613	7.555754e-50	-8.615850e-47
Msa0697720	Msa1298100	0.853778	1.907734e-61	-8.615850e-47
Msa0698100	Msa1298100	0.801612	8.295617e-49	-8.615850e-47
Msa0699780	Msa1298100	0.848938	4.453825e-60	-8.615850e-47
Msa0701100	Msa1298100	0.846930	1.593274e-59	-8.615850e-47
Msa0703440	Msa1298100	0.858246	9.400180e-63	-8.615850e-47
Msa0705390	Msa1298100	0.866442	2.842576e-65	-8.615850e-47
Msa0705990	Msa1298100	0.805880	1.078031e-49	-8.615850e-47
Msa0707010	Msa1298100	0.808632	2.815626e-50	-8.615850e-47
Msa0709120	Msa1298100	0.856814	2.494863e-62	-8.615850e-47
Msa0712560	Msa1298100	0.809511	1.825183e-50	-8.615850e-47
Msa0726080	Msa1298100	0.839840	1.245587e-57	-8.615850e-47
Msa0727530	Msa1298100	0.825331	4.970206e-54	-8.615850e-47
Msa0743530	Msa1298100	0.846175	2.561719e-59	-8.615850e-47
Msa0746170	Msa1298100	0.834347	3.158341e-56	-8.615850e-47
Msa0746210	Msa1298100	0.830321	3.136758e-55	-8.615850e-47
Msa0750810	Msa1298100	0.821152	4.699678e-53	-8.615850e-47
Msa0752700	Msa1298100	0.836714	7.959452e-57	-8.615850e-47
Msa0756110	Msa1298100	0.811377	7.216185e-51	-8.615850e-47
Msa0758250	Msa1298100	0.814250	1.695080e-51	-8.615850e-47
Msa0764920	Msa1298100	0.801648	8.153752e-49	-8.615850e-47
Msa0767500	Msa1298100	0.806823	6.821972e-50	-8.615850e-47
Msa0779260	Msa1298100	0.811979	5.338382e-51	-8.615850e-47
Msa0784480	Msa1298100	0.810256	1.261795e-50	-8.615850e-47
Msa0789560	Msa1298100	0.826599	2.483451e-54	-8.615850e-47
Msa0794970	Msa1298100	0.835773	1.380348e-56	-8.615850e-47
Msa0797930	Msa1298100	0.837373	5.402200e-57	-8.615850e-47
Msa0800370	Msa1298100	0.829242	5.745064e-55	-8.615850e-47
Msa0811040	Msa1298100	0.807948	3.938588e-50	-8.615850e-47
Msa0822170	Msa1298100	0.842646	2.277258e-58	-8.615850e-47
Msa0822180	Msa1298100	0.825781	3.888112e-54	-8.615850e-47
Msa0829220	Msa1298100	0.805214	1.487466e-49	-8.615850e-47
Msa0830660	Msa1298100	0.817922	2.565233e-52	-8.615850e-47
Msa0831100	Msa1298100	0.850771	1.369055e-60	-8.615850e-47
Msa0832700	Msa1298100	0.802685	4.990102e-49	-8.615850e-47
Msa0835960	Msa1298100	0.802662	5.044138e-49	-8.615850e-47
Msa0836500	Msa1298100	0.803304	3.715523e-49	-8.615850e-47
Msa0838370	Msa1298100	0.828847	7.158507e-55	-8.615850e-47
Msa0839450	Msa1298100	0.810346	1.206617e-50	-8.615850e-47
Msa0125450	Msa1298100	0.851337	9.475036e-61	-8.615850e-47
Msa0125540	Msa1298100	0.831567	1.551934e-55	-8.615850e-47
Msa0125790	Msa1298100	0.821236	4.493829e-53	-8.615850e-47
Msa0126880	Msa1298100	0.852302	5.046159e-61	-8.615850e-47
Msa0127850	Msa1298100	0.851243	1.007551e-60	-8.615850e-47
Msa0128430	Msa1298100	0.868527	6.112202e-66	-8.615850e-47
Msa0131700	Msa1298100	0.804236	2.379590e-49	-8.615850e-47
Msa0136120	Msa1298100	0.841106	5.811278e-58	-8.615850e-47
Msa0137510	Msa1298100	0.883467	4.379774e-71	-8.615850e-47
Msa0139670	Msa1298100	0.855253	7.141122e-62	-8.615850e-47
Msa0141400	Msa1298100	0.807192	5.698690e-50	-8.615850e-47
Msa0142410	Msa1298100	0.840995	6.214117e-58	-8.615850e-47
Msa0142500	Msa1298100	0.844953	5.492009e-59	-8.615850e-47
Msa0144420	Msa1298100	0.864886	8.806000e-65	-8.615850e-47
Msa0144430	Msa1298100	0.899060	2.880287e-77	-8.615850e-47
Msa0146080	Msa1298100	0.881655	2.003662e-70	-8.615850e-47
Msa0146420	Msa1298100	0.805128	1.550153e-49	-8.615850e-47
Msa0147980	Msa1298100	0.826449	2.695928e-54	-8.615850e-47
Msa0149440	Msa1298100	0.856378	3.350675e-62	-8.615850e-47
Msa0150260	Msa1298100	0.832448	9.398343e-56	-8.615850e-47
Msa0154920	Msa1298100	0.827209	1.775358e-54	-8.615850e-47
Msa0170430	Msa1298100	0.807696	4.455666e-50	-8.615850e-47
Msa0171980	Msa1298100	0.855264	7.087095e-62	-8.615850e-47
Msa0173800	Msa1298100	0.801541	8.576497e-49	-8.615850e-47
Msa0174000	Msa1298100	0.837175	6.069815e-57	-8.615850e-47
Msa0182990	Msa1298100	0.811819	5.783664e-51	-8.615850e-47
Msa0183420	Msa1298100	0.804992	1.655118e-49	-8.615850e-47
Msa0183870	Msa1298100	0.860005	2.791721e-63	-8.615850e-47
Msa0183910	Msa1298100	0.839205	1.821111e-57	-8.615850e-47
Msa0187490	Msa1298100	0.827993	1.150570e-54	-8.615850e-47
Msa0190870	Msa1298100	0.802278	6.052756e-49	-8.615850e-47
Msa0191070	Msa1298100	0.843285	1.539791e-58	-8.615850e-47
Msa0192640	Msa1298100	0.807419	5.102029e-50	-8.615850e-47
Msa0194080	Msa1298100	0.806074	9.814927e-50	-8.615850e-47
Msa0202410	Msa1298100	0.806846	6.746217e-50	-8.615850e-47
Msa0209080	Msa1298100	0.806128	9.560689e-50	-8.615850e-47
Msa0210260	Msa1298100	0.847107	1.425431e-59	-8.615850e-47
Msa0217670	Msa1298100	0.835024	2.134818e-56	-8.615850e-47
Msa0220990	Msa1298100	0.812766	3.593240e-51	-8.615850e-47
Msa0223330	Msa1298100	0.818025	2.431033e-52	-8.615850e-47
Msa0225670	Msa1298100	0.810634	1.045397e-50	-8.615850e-47
Msa0230610	Msa1298100	0.816592	5.108929e-52	-8.615850e-47
Msa0233370	Msa1298100	0.841999	3.380161e-58	-8.615850e-47
Msa0237200	Msa1298100	0.811478	6.861606e-51	-8.615850e-47
Msa0238030	Msa1298100	0.806547	7.802884e-50	-8.615850e-47
Msa1233850	Msa1298100	0.858753	6.633859e-63	-8.615850e-47
Msa1234620	Msa1298100	0.841029	6.087669e-58	-8.615850e-47
Msa1250110	Msa1298100	0.846459	2.143892e-59	-8.615850e-47
Msa1250730	Msa1298100	0.832848	7.477537e-56	-8.615850e-47
Msa1254620	Msa1298100	0.814859	1.243291e-51	-8.615850e-47
Msa1257070	Msa1298100	0.853235	2.732199e-61	-8.615850e-47
Msa1258780	Msa1298100	0.823667	1.224210e-53	-8.615850e-47
Msa1264420	Msa1298100	0.808172	3.528881e-50	-8.615850e-47
Msa1265590	Msa1298100	0.810420	1.162872e-50	-8.615850e-47
Msa1270660	Msa1298100	0.800641	1.310335e-48	-8.615850e-47
Msa1276150	Msa1298100	0.832512	9.060076e-56	-8.615850e-47
Msa1276970	Msa1298100	0.819710	1.006724e-52	-8.615850e-47
Msa1290450	Msa1298100	0.819662	1.032380e-52	-8.615850e-47
Msa1292020	Msa1298100	0.800976	1.119562e-48	-8.615850e-47
Msa1297530	Msa1298100	0.819935	8.940967e-53	-8.615850e-47
Msa1298100	Msa1304810	0.820124	8.093771e-53	-8.615850e-47
Msa1298100	Msa1304940	0.826842	2.172444e-54	-8.615850e-47
Msa1298100	Msa1307180	0.864290	1.352708e-64	-8.615850e-47
Msa1298100	Msa1315750	0.841012	6.148231e-58	-8.615850e-47
Msa1298100	Msa1316360	0.848851	4.708248e-60	-8.615850e-47
Msa1298100	Msa1327870	0.811052	8.487645e-51	-8.615850e-47
Msa1298100	Msa1330270	0.833579	4.917580e-56	-8.615850e-47
Msa1298100	Msa1336040	0.854825	9.509553e-62	-8.615850e-47
Msa1298100	Msa1336560	0.828997	6.584647e-55	-8.615850e-47
Msa1298100	Msa1337480	0.811725	6.064005e-51	-8.615850e-47
Msa1298100	Msa1344310	0.821944	3.083552e-53	-8.615850e-47
Msa1298100	Msa1349520	0.812354	4.423557e-51	-8.615850e-47
Msa1298100	Msa1356610	0.869178	3.762245e-66	-8.615850e-47
Msa1298100	Msa1357190	0.803761	2.987444e-49	-8.615850e-47
Msa1298100	Msa1359560	0.824855	6.437960e-54	-8.615850e-47
Msa1298100	Msa1362420	0.826158	3.162093e-54	-8.615850e-47
Msa1298100	Msa1364210	0.817216	3.699123e-52	-8.615850e-47
Msa1298100	Msa1366550	0.823765	1.161045e-53	-8.615850e-47
Msa1298100	Msa1369690	0.830757	2.453852e-55	-8.615850e-47
Msa1298100	Msa1369890	0.852786	3.673320e-61	-8.615850e-47
Msa1298100	Msa1370590	0.853858	1.809999e-61	-8.615850e-47
Msa1298100	Msa1373850	0.814410	1.562578e-51	-8.615850e-47
Msa1298100	Msa1374170	0.886262	3.984816e-72	-8.615850e-47
Msa1298100	Msa1376650	0.811398	7.143850e-51	-8.615850e-47
Msa1298100	Msa1381350	0.804772	1.840299e-49	-8.615850e-47
Msa1298100	Msa1382020	0.855738	5.158751e-62	-8.615850e-47
Msa1298100	Msa1382670	0.880091	7.302170e-70	-8.615850e-47
Msa1298100	Msa1384100	0.855164	7.581862e-62	-8.615850e-47
Msa1298100	Msa1389850	0.818609	1.792410e-52	-8.615850e-47
Msa1298100	Msa1391480	0.839385	1.635327e-57	-8.615850e-47
Msa1298100	Msa1391720	0.805222	1.481157e-49	-8.615850e-47
Msa1298100	Msa1393820	0.809018	2.327499e-50	-8.615850e-47
Msa1298100	Msa1395730	0.843802	1.119778e-58	-8.615850e-47
Msa1298100	Msa1398790	0.834635	2.675054e-56	-8.615850e-47
Msa1298100	Msa1400120	0.831153	1.961121e-55	-8.615850e-47
Msa1298100	Msa1407190	0.838846	2.255450e-57	-8.615850e-47
Msa1298100	Msa1411950	0.849897	2.407877e-60	-8.615850e-47
Msa1298100	Msa1411980	0.814588	1.427437e-51	-8.615850e-47
Msa1298100	Msa1412110	0.845706	3.434586e-59	-8.615850e-47
Msa1298100	Msa1413380	0.822534	2.250553e-53	-8.615850e-47
Msa1298100	Msa1416260	0.836427	9.419418e-57	-8.615850e-47
Msa1298100	Msa1418340	0.803280	3.758157e-49	-8.615850e-47
Msa1298100	Msa1421560	0.871455	6.747195e-67	-8.615850e-47
Msa1298100	Msa1421900	0.821573	3.758027e-53	-8.615850e-47
Msa1298100	Msa1428780	0.823099	1.662222e-53	-8.615850e-47
Msa1298100	Msa1432130	0.842156	3.071109e-58	-8.615850e-47
Msa1298100	Msa1434040	0.813609	2.347034e-51	-8.615850e-47
Msa1298100	Msa1437330	0.813267	2.791383e-51	-8.615850e-47
Msa1298100	Msa1442790	0.815408	9.389186e-52	-8.615850e-47
Msa1298100	Msa1444120	0.857982	1.125658e-62	-8.615850e-47
Msa1298100	Msa1446080	0.808996	2.353655e-50	-8.615850e-47
Msa1298100	Msa1447890	0.858477	8.018581e-63	-8.615850e-47
Msa1298100	Msa1450720	0.852778	3.691623e-61	-8.615850e-47
Msa1298100	Msa1458810	0.832443	9.425396e-56	-8.615850e-47
Msa1298100	Msa1459960	0.826668	2.391230e-54	-8.615850e-47
Msa1298100	Msa1462470	0.833684	4.630655e-56	-8.615850e-47
Msa1298100	Msa1463030	0.829341	5.434322e-55	-8.615850e-47
Msa0376280	Msa1298100	0.809011	2.336186e-50	-8.615850e-47
Msa0376600	Msa1298100	0.855470	6.175685e-62	-8.615850e-47
Msa0377450	Msa1298100	0.813041	3.128532e-51	-8.615850e-47
Msa0378970	Msa1298100	0.856911	2.336063e-62	-8.615850e-47
Msa0382310	Msa1298100	0.883110	5.920595e-71	-8.615850e-47
Msa0382370	Msa1298100	0.869136	3.880956e-66	-8.615850e-47
Msa0384670	Msa1298100	0.821502	3.902040e-53	-8.615850e-47
Msa0385500	Msa1298100	0.842181	3.024324e-58	-8.615850e-47
Msa0387050	Msa1298100	0.801029	1.091821e-48	-8.615850e-47
Msa0390480	Msa1298100	0.830478	2.870732e-55	-8.615850e-47
Msa0395980	Msa1298100	0.828844	7.173596e-55	-8.615850e-47
Msa0403490	Msa1298100	0.815331	9.765928e-52	-8.615850e-47
Msa0403770	Msa1298100	0.824753	6.804640e-54	-8.615850e-47
Msa0419720	Msa1298100	0.811518	6.726336e-51	-8.615850e-47
Msa0427580	Msa1298100	0.828937	6.810433e-55	-8.615850e-47
Msa0428580	Msa1298100	0.843820	1.107672e-58	-8.615850e-47
Msa0431210	Msa1298100	0.871932	4.686734e-67	-8.615850e-47
Msa0432160	Msa1298100	0.855995	4.338317e-62	-8.615850e-47
Msa0434570	Msa1298100	0.823786	1.148492e-53	-8.615850e-47
Msa0434770	Msa1298100	0.824265	8.861940e-54	-8.615850e-47
Msa0439890	Msa1298100	0.801317	9.533172e-49	-8.615850e-47
Msa0440510	Msa1298100	0.823272	1.514706e-53	-8.615850e-47
Msa0443430	Msa1298100	0.804691	1.913014e-49	-8.615850e-47
Msa0450400	Msa1298100	-0.808293	3.325608e-50	-8.615850e-47
Msa0472770	Msa1298100	0.817255	3.625893e-52	-8.615850e-47
Msa0474940	Msa1298100	0.835902	1.280645e-56	-8.615850e-47
Msa0476680	Msa1298100	0.852320	4.988178e-61	-8.615850e-47
Msa0478580	Msa1298100	0.803802	2.929545e-49	-8.615850e-47
Msa0480780	Msa1298100	0.849627	2.863736e-60	-8.615850e-47
Msa0481970	Msa1298100	0.839864	1.227436e-57	-8.615850e-47
Msa0482040	Msa1298100	0.803704	3.070778e-49	-8.615850e-47
Msa0980540	Msa1298100	0.837783	4.239122e-57	-8.615850e-47
Msa0985180	Msa1298100	0.812881	3.391149e-51	-8.615850e-47
Msa0985220	Msa1298100	0.819815	9.528563e-53	-8.615850e-47
Msa0995370	Msa1298100	0.815886	7.345367e-52	-8.615850e-47
Msa1025940	Msa1298100	0.806147	9.470985e-50	-8.615850e-47
Msa1030030	Msa1298100	0.864894	8.751848e-65	-8.615850e-47
Msa1034310	Msa1298100	0.800958	1.128888e-48	-8.615850e-47
Msa1034590	Msa1298100	0.812906	3.348329e-51	-8.615850e-47
Msa1034700	Msa1298100	0.801028	1.092037e-48	-8.615850e-47
Msa1034720	Msa1298100	0.804871	1.754297e-49	-8.615850e-47
Msa1037510	Msa1298100	0.815684	8.151213e-52	-8.615850e-47
Msa1037520	Msa1298100	0.818375	2.025657e-52	-8.615850e-47
Msa1039900	Msa1298100	0.841664	4.143814e-58	-8.615850e-47
Msa1042480	Msa1298100	0.800571	1.353827e-48	-8.615850e-47
Msa1042660	Msa1298100	0.837011	6.683844e-57	-8.615850e-47
Msa1043630	Msa1298100	0.828021	1.133036e-54	-8.615850e-47
Msa1063420	Msa1298100	0.801260	9.790894e-49	-8.615850e-47
Msa1070390	Msa1298100	0.808084	3.684793e-50	-8.615850e-47
Msa1072600	Msa1298100	0.813367	2.652702e-51	-8.615850e-47
Msa1074110	Msa1298100	0.856210	3.751932e-62	-8.615850e-47
Msa1074350	Msa1298100	0.827048	1.940309e-54	-8.615850e-47
Msa1080490	Msa1298100	0.804978	1.665992e-49	-8.615850e-47
Msa1089320	Msa1298100	0.816219	6.191009e-52	-8.615850e-47
Msa1089450	Msa1298100	0.822846	1.903757e-53	-8.615850e-47
Msa1089960	Msa1298100	0.826934	2.065271e-54	-8.615850e-47
Msa0240270	Msa1298100	0.803094	4.107963e-49	-8.615850e-47
Msa0240900	Msa1298100	0.807248	5.546712e-50	-8.615850e-47
Msa0241830	Msa1298100	0.852364	4.846090e-61	-8.615850e-47
Msa0243090	Msa1298100	0.828427	9.046702e-55	-8.615850e-47
Msa0244970	Msa1298100	0.857560	1.501534e-62	-8.615850e-47
Msa0244980	Msa1298100	0.865356	6.264627e-65	-8.615850e-47
Msa0245430	Msa1298100	0.832267	1.042231e-55	-8.615850e-47
Msa0245580	Msa1298100	0.850248	1.919740e-60	-8.615850e-47
Msa0247060	Msa1298100	0.832976	6.951223e-56	-8.615850e-47
Msa0249580	Msa1298100	0.812241	4.680840e-51	-8.615850e-47
Msa0257490	Msa1298100	0.852379	4.798302e-61	-8.615850e-47
Msa0265600	Msa1298100	0.846890	1.634073e-59	-8.615850e-47
Msa0269470	Msa1298100	0.865918	4.165880e-65	-8.615850e-47
Msa0274970	Msa1298100	0.811400	7.134859e-51	-8.615850e-47
Msa0274980	Msa1298100	0.805234	1.473084e-49	-8.615850e-47
Msa0279850	Msa1298100	0.827943	1.183140e-54	-8.615850e-47
Msa0281530	Msa1298100	0.805012	1.639136e-49	-8.615850e-47
Msa0283420	Msa1298100	0.845538	3.816291e-59	-8.615850e-47
Msa0284180	Msa1298100	0.820190	7.819004e-53	-8.615850e-47
Msa0285330	Msa1298100	0.816973	4.194964e-52	-8.615850e-47
Msa0296790	Msa1298100	0.853083	3.020376e-61	-8.615850e-47
Msa0296920	Msa1298100	0.852341	4.918657e-61	-8.615850e-47
Msa0303460	Msa1298100	0.857899	1.191491e-62	-8.615850e-47
Msa0303520	Msa1298100	0.841946	3.490752e-58	-8.615850e-47
Msa0305620	Msa1298100	0.800832	1.197620e-48	-8.615850e-47
Msa0308440	Msa1298100	0.805809	1.115577e-49	-8.615850e-47
Msa0311720	Msa1298100	0.816830	4.518125e-52	-8.615850e-47
Msa0315680	Msa1298100	0.809031	2.313093e-50	-8.615850e-47
Msa0317970	Msa1298100	0.817597	3.037057e-52	-8.615850e-47
Msa0320470	Msa1298100	0.820396	7.011409e-53	-8.615850e-47
Msa0320590	Msa1298100	0.807382	5.193636e-50	-8.615850e-47
Msa0321690	Msa1298100	0.845160	4.829547e-59	-8.615850e-47
Msa0322240	Msa1298100	0.814390	1.578691e-51	-8.615850e-47
Msa0322900	Msa1298100	0.856951	2.273046e-62	-8.615850e-47
Msa0324240	Msa1298100	0.838228	3.257832e-57	-8.615850e-47
Msa0326560	Msa1298100	0.804795	1.819743e-49	-8.615850e-47
Msa0336450	Msa1298100	0.825046	5.801795e-54	-8.615850e-47
Msa0336540	Msa1298100	0.811482	6.848649e-51	-8.615850e-47
Msa0341690	Msa1298100	0.807671	4.510901e-50	-8.615850e-47
Msa0347950	Msa1298100	0.811993	5.300889e-51	-8.615850e-47
Msa0347990	Msa1298100	0.824762	6.772154e-54	-8.615850e-47
Msa0363060	Msa1298100	0.838016	3.693108e-57	-8.615850e-47
Msa0363640	Msa1298100	0.811746	5.999307e-51	-8.615850e-47
Msa1109780	Msa1298100	-0.879620	1.074083e-69	-8.615850e-47
Msa1123350	Msa1298100	0.899966	1.172899e-77	-8.615850e-47
Msa1126830	Msa1298100	0.824405	8.215989e-54	-8.615850e-47
Msa1127430	Msa1298100	0.862343	5.421697e-64	-8.615850e-47
Msa1127540	Msa1298100	0.809510	1.825724e-50	-8.615850e-47
Msa1127590	Msa1298100	0.821012	5.061407e-53	-8.615850e-47
Msa1128270	Msa1298100	0.826367	2.819758e-54	-8.615850e-47
Msa1128280	Msa1298100	0.817060	4.010576e-52	-8.615850e-47
Msa1130400	Msa1298100	0.802588	5.225342e-49	-8.615850e-47
Msa1130980	Msa1298100	0.803881	2.820449e-49	-8.615850e-47
Msa1131090	Msa1298100	0.840544	8.157659e-58	-8.615850e-47
Msa1131490	Msa1298100	0.801317	9.533172e-49	-8.615850e-47
Msa1137780	Msa1298100	0.803638	3.168394e-49	-8.615850e-47
Msa1154490	Msa1298100	0.808464	3.057299e-50	-8.615850e-47
Msa1156820	Msa1298100	0.831505	1.607213e-55	-8.615850e-47
Msa1158230	Msa1298100	0.826847	2.166431e-54	-8.615850e-47
Msa1162080	Msa1298100	0.815808	7.645919e-52	-8.615850e-47
Msa1163870	Msa1298100	0.817694	2.887913e-52	-8.615850e-47
Msa1163880	Msa1298100	0.803183	3.936985e-49	-8.615850e-47
Msa1165270	Msa1298100	0.827679	1.369678e-54	-8.615850e-47
Msa1165490	Msa1298100	0.812394	4.334244e-51	-8.615850e-47
Msa1165780	Msa1298100	0.829075	6.303926e-55	-8.615850e-47
Msa1178580	Msa1298100	0.837238	5.848798e-57	-8.615850e-47
Msa1194230	Msa1298100	0.833174	6.206704e-56	-8.615850e-47
Msa1197070	Msa1298100	0.821551	3.802687e-53	-8.615850e-47
Msa1201640	Msa1298100	0.813303	2.740303e-51	-8.615850e-47
Msa1205480	Msa1298100	0.815696	8.098711e-52	-8.615850e-47
Msa1205590	Msa1298100	0.836494	9.058049e-57	-8.615850e-47
Msa1206650	Msa1298100	0.935370	9.441570e-97	-8.615850e-47
Msa1209190	Msa1298100	0.818603	1.798426e-52	-8.615850e-47
Msa1209440	Msa1298100	0.806309	8.758785e-50	-8.615850e-47
Msa1209670	Msa1298100	0.801754	7.756221e-49	-8.615850e-47
Msa1214320	Msa1298100	0.807756	4.325815e-50	-8.615850e-47
Msa0482940	Msa1298100	0.851297	9.726783e-61	-8.615850e-47
Msa0484740	Msa1298100	0.827884	1.222577e-54	-8.615850e-47
Msa0485240	Msa1298100	0.804124	2.510913e-49	-8.615850e-47
Msa0489660	Msa1298100	0.803269	3.779199e-49	-8.615850e-47
Msa0491000	Msa1298100	0.842296	2.820193e-58	-8.615850e-47
Msa0511770	Msa1298100	0.809725	1.641936e-50	-8.615850e-47
Msa0514610	Msa1298100	0.810648	1.038214e-50	-8.615850e-47
Msa0517640	Msa1298100	0.823731	1.182678e-53	-8.615850e-47
Msa0518170	Msa1298100	0.832146	1.116544e-55	-8.615850e-47
Msa0520270	Msa1298100	0.879154	1.570874e-69	-8.615850e-47
Msa0521010	Msa1298100	0.848511	5.849524e-60	-8.615850e-47
Msa0526020	Msa1298100	0.831792	1.365506e-55	-8.615850e-47
Msa0527740	Msa1298100	0.811278	7.584083e-51	-8.615850e-47
Msa0529670	Msa1298100	0.809501	1.834298e-50	-8.615850e-47
Msa0530700	Msa1298100	0.820640	6.163472e-53	-8.615850e-47
Msa0531250	Msa1298100	0.849903	2.398133e-60	-8.615850e-47
Msa0534050	Msa1298100	0.805320	1.413144e-49	-8.615850e-47
Msa0534980	Msa1298100	0.857123	2.021724e-62	-8.615850e-47
Msa0542560	Msa1298100	0.808830	2.554542e-50	-8.615850e-47
Msa0544170	Msa1298100	0.856851	2.431762e-62	-8.615850e-47
Msa0544540	Msa1298100	0.802318	5.938208e-49	-8.615850e-47
Msa0544730	Msa1298100	0.863305	2.737424e-64	-8.615850e-47
Msa0547160	Msa1298100	0.838080	3.555223e-57	-8.615850e-47
Msa0547990	Msa1298100	0.877922	4.258792e-69	-8.615850e-47
Msa0560500	Msa1298100	0.875198	3.722470e-68	-8.615850e-47
Msa0562690	Msa1298100	0.828181	1.036858e-54	-8.615850e-47
Msa0566350	Msa1298100	0.826451	2.694066e-54	-8.615850e-47
Msa0566750	Msa1298100	0.824037	1.002452e-53	-8.615850e-47
Msa0569780	Msa1298100	0.856480	3.127861e-62	-8.615850e-47
Msa0569960	Msa1298100	0.801909	7.208430e-49	-8.615850e-47
Msa0572750	Msa1298100	0.826792	2.233481e-54	-8.615850e-47
Msa0581110	Msa1298100	0.826140	3.194979e-54	-8.615850e-47
Msa0583500	Msa1298100	0.818760	1.656395e-52	-8.615850e-47
Msa0583670	Msa1298100	0.864520	1.145857e-64	-8.615850e-47
Msa0585070	Msa1298100	0.854877	9.187152e-62	-8.615850e-47
Msa0588090	Msa1298100	0.840473	8.511763e-58	-8.615850e-47
Msa0593700	Msa1298100	0.823084	1.675437e-53	-8.615850e-47
Msa0597770	Msa1298100	0.813014	3.171680e-51	-8.615850e-47
Msa0600070	Msa1298100	0.822412	2.402136e-53	-8.615850e-47
Msa0600080	Msa1298100	0.815630	8.377196e-52	-8.615850e-47
Msa0600450	Msa1298100	0.833510	5.117301e-56	-8.615850e-47
Msa0844280	Msa1298100	0.869423	3.130614e-66	-8.615850e-47
Msa0844610	Msa1298100	0.811126	8.182754e-51	-8.615850e-47
Msa0846230	Msa1298100	0.838308	3.105704e-57	-8.615850e-47
Msa0855110	Msa1298100	0.808335	3.258440e-50	-8.615850e-47
Msa0858440	Msa1298100	0.826536	2.570356e-54	-8.615850e-47
Msa0865970	Msa1298100	0.827769	1.302660e-54	-8.615850e-47
Msa0866070	Msa1298100	0.824264	8.867981e-54	-8.615850e-47
Msa0870650	Msa1298100	0.813129	2.992494e-51	-8.615850e-47
Msa0877710	Msa1298100	0.800109	1.681399e-48	-8.615850e-47
Msa0880450	Msa1298100	0.834912	2.278271e-56	-8.615850e-47
Msa0883520	Msa1298100	0.810063	1.388884e-50	-8.615850e-47
Msa0903780	Msa1298100	0.841438	4.750554e-58	-8.615850e-47
Msa0905750	Msa1298100	0.831557	1.560318e-55	-8.615850e-47
Msa0907850	Msa1298100	0.839548	1.484058e-57	-8.615850e-47
Msa0928120	Msa1298100	0.812597	3.914263e-51	-8.615850e-47
Msa0934140	Msa1298100	0.822901	1.848554e-53	-8.615850e-47
Msa0943170	Msa1298100	0.836675	8.143969e-57	-8.615850e-47
Msa0944200	Msa1298100	0.810733	9.954993e-51	-8.615850e-47
Msa0945240	Msa1298100	0.851325	9.555255e-61	-8.615850e-47
Msa0959520	Msa1298100	0.809245	2.081238e-50	-8.615850e-47
Msa0968440	Msa1298100	0.839852	1.236214e-57	-8.615850e-47
Msa0970530	Msa1298100	0.808633	2.813882e-50	-8.615850e-47
Msa0970600	Msa1298100	0.827332	1.658507e-54	-8.615850e-47
Msa0974950	Msa1298100	0.826845	2.169435e-54	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1298100	MtrunA17_Chr4g0055651	100.000	202	0	0	1	202	1	202	1.32e-152	421
Msa1298100	MtrunA17_Chr7g0250531	88.119	202	24	0	1	202	1	202	2.63e-137	382
Msa1298100	MtrunA17_Chr8g0335471	88.177	203	23	1	1	202	1	203	7.18e-135	376
Msa1298100	MtrunA17_Chr2g0276931	77.778	198	43	1	4	200	5	202	3.32e-116	328
Msa1298100	MtrunA17_Chr4g0030911	60.000	205	72	4	4	200	11	213	1.61e-86	254
Msa1298100	MtrunA17_Chr1g0212521	58.537	205	76	3	4	200	11	214	1.45e-85	251
Msa1298100	MtrunA17_Chr1g0182321	58.654	208	75	4	4	202	11	216	2.57e-85	251
Msa1298100	MtrunA17_Chr7g0263071	59.135	208	74	4	4	202	11	216	6.03e-85	250
Msa1298100	MtrunA17_Chr1g0182301	58.173	208	76	4	4	202	11	216	8.55e-85	249
Msa1298100	MtrunA17_Chr2g0327911	52.657	207	81	5	5	200	12	212	6.71e-72	217
Msa1298100	MtrunA17_Chr4g0032201	46.445	211	104	2	1	202	5	215	2.13e-66	203
Msa1298100	MtrunA17_Chr2g0276941	47.619	210	99	3	4	202	11	220	1.44e-63	196
Msa1298100	MtrunA17_Chr2g0290891	45.455	209	102	1	5	201	3	211	6.89e-62	191
Msa1298100	MtrunA17_Chr6g0458081	54.545	165	75	0	5	169	3	167	7.20e-62	191
Msa1298100	MtrunA17_Chr3g0112681	45.794	214	100	3	1	201	5	215	4.36e-61	189
Msa1298100	MtrunA17_Chr2g0315551	46.445	211	103	2	2	202	7	217	5.84e-61	189
Msa1298100	MtrunA17_Chr8g0384311	48.259	201	99	4	4	200	9	208	4.70e-60	186
Msa1298100	MtrunA17_Chr4g0046261	45.024	211	106	1	2	202	7	217	1.75e-59	185
Msa1298100	MtrunA17_Chr2g0283131	45.024	211	106	1	2	202	7	217	1.82e-59	185
Msa1298100	MtrunA17_Chr7g0234201	47.059	204	99	1	7	201	12	215	3.26e-59	184
Msa1298100	MtrunA17_Chr1g0189361	46.698	212	97	3	6	201	12	223	3.69e-59	185
Msa1298100	MtrunA17_Chr3g0123821	43.868	212	106	2	2	200	10	221	4.46e-59	184
Msa1298100	MtrunA17_Chr8g0381841	52.632	171	79	2	2	171	11	180	6.93e-59	184
Msa1298100	MtrunA17_Chr7g0265001	47.525	202	101	3	5	201	13	214	8.33e-59	184
Msa1298100	MtrunA17_Chr4g0040781	44.550	211	107	1	2	202	7	217	1.25e-58	183
Msa1298100	MtrunA17_Chr2g0325091	45.498	211	106	1	1	202	4	214	2.72e-58	182
Msa1298100	MtrunA17_Chr2g0319951	46.009	213	102	3	2	202	7	218	1.55e-57	181
Msa1298100	MtrunA17_Chr8g0349711	51.534	163	79	0	7	169	5	167	1.55e-57	180
Msa1298100	MtrunA17_Chr1g0159481	48.768	203	98	4	4	201	13	214	5.09e-57	179
Msa1298100	MtrunA17_Chr8g0346421	43.434	198	112	0	1	198	19	216	9.00e-57	179
Msa1298100	MtrunA17_Chr8g0349681	52.071	169	81	0	5	173	381	549	3.75e-56	186
Msa1298100	MtrunA17_Chr8g0349681	48.214	168	87	0	2	169	169	336	2.33e-51	174
Msa1298100	MtrunA17_Chr8g0349681	50.000	160	80	0	7	166	12	171	6.26e-50	170
Msa1298100	MtrunA17_Chr1g0180291	47.264	201	100	5	5	200	11	210	6.84e-56	176
Msa1298100	MtrunA17_Chr7g0275991	43.878	196	106	2	6	198	18	212	3.66e-55	175
Msa1298100	MtrunA17_Chr7g0231131	43.128	211	108	2	2	200	9	219	4.99e-55	174
Msa1298100	MtrunA17_Chr3g0130271	46.040	202	103	5	4	200	8	208	1.02e-54	173
Msa1298100	MtrunA17_Chr6g0482721	48.925	186	93	2	1	185	5	189	2.13e-54	172
Msa1298100	MtrunA17_Chr1g0197331	47.549	204	103	4	2	201	9	212	4.35e-54	171
Msa1298100	MtrunA17_Chr8g0351861	47.368	171	90	0	6	176	14	184	8.07e-54	171
Msa1298100	MtrunA17_Chr1g0174281	48.810	168	86	0	2	169	9	176	1.05e-53	171
Msa1298100	MtrunA17_Chr8g0392931	46.948	213	100	4	1	201	7	218	2.24e-53	170
Msa1298100	MtrunA17_Chr7g0214241	47.126	174	92	0	7	180	14	187	2.65e-52	167
Msa1298100	MtrunA17_Chr3g0109721	44.103	195	100	4	10	201	12	200	6.10e-52	166
Msa1298100	MtrunA17_Chr5g0433561	42.268	194	105	3	10	201	12	200	2.38e-50	161
Msa1298100	MtrunA17_Chr8g0390561	41.237	194	106	3	10	201	11	198	9.41e-48	155
Msa1298100	MtrunA17_Chr1g0199331	42.236	161	92	1	10	169	33	193	2.86e-43	143
Msa1298100	MtrunA17_Chr8g0382221	37.056	197	120	1	9	201	10	206	5.73e-43	143
Msa1298100	MtrunA17_Chr5g0400131	36.735	196	119	1	9	199	10	205	1.20e-42	142
Msa1298100	MtrunA17_Chr4g0055081	39.752	161	97	0	9	169	10	170	1.02e-41	140
Msa1298100	MtrunA17_Chr3g0123971	41.615	161	94	0	9	169	10	170	1.74e-41	139
Msa1298100	MtrunA17_Chr2g0331691	38.308	201	113	5	8	200	10	207	4.54e-40	135
Msa1298100	MtrunA17_Chr4g0004661	38.308	201	113	5	8	200	64	261	5.95e-39	134
Msa1298100	MtrunA17_Chr4g0034871	40.476	168	93	3	8	168	8	175	3.42e-38	130
Msa1298100	MtrunA17_Chr6g0466301	35.922	206	112	6	8	201	8	205	3.78e-35	123
Msa1298100	MtrunA17_Chr6g0465491	35.922	206	112	6	8	201	8	205	3.78e-35	123
Msa1298100	MtrunA17_Chr1g0201121	37.952	166	96	3	8	166	8	173	5.30e-34	120
Msa1298100	MtrunA17_Chr8g0383261	36.747	166	98	2	8	166	12	177	5.74e-33	117
Msa1298100	MtrunA17_Chr3g0138101	30.435	184	119	4	9	188	14	192	1.99e-24	95.9
Msa1298100	MtrunA17_Chr3g0138111	30.435	184	119	4	9	188	14	192	2.02e-24	95.9
Msa1298100	MtrunA17_Chr3g0138121	30.435	184	119	4	9	188	14	192	2.15e-24	95.5
Msa1298100	MtrunA17_Chr6g0465471	33.690	187	104	6	25	199	7	185	7.82e-24	94.0
Msa1298100	MtrunA17_Chr6g0466161	33.690	187	104	6	25	199	7	185	1.21e-23	93.6
Msa1298100	MtrunA17_Chr4g0037021	31.737	167	100	5	8	162	6	170	6.77e-23	91.3
Msa1298100	MtrunA17_Chr6g0486041	31.737	167	100	5	8	162	6	170	8.45e-23	91.3
Msa1298100	MtrunA17_Chr8g0371501	31.953	169	101	5	8	164	6	172	2.41e-22	89.7
Msa1298100	MtrunA17_Chr4g0046211	35.772	123	76	3	8	129	6	126	3.65e-22	87.8
Msa1298100	MtrunA17_Chr5g0405791	31.361	169	102	5	8	164	6	172	1.23e-21	87.8
Msa1298100	MtrunA17_Chr1g0178291	36.416	173	100	4	5	177	428	590	2.20e-21	91.3
Msa1298100	MtrunA17_Chr3g0117931	30.220	182	108	6	8	177	8	182	3.56e-21	87.0
Msa1298100	MtrunA17_Chr2g0325101	29.586	169	105	5	8	164	6	172	6.70e-21	85.9
Msa1298100	MtrunA17_Chr6g0466431	35.354	99	55	1	8	106	8	97	7.14e-17	72.8
Msa1298100	MtrunA17_Chr6g0465611	35.354	99	55	1	8	106	8	97	7.14e-17	72.8
Msa1298100	MtrunA17_Chr5g0434561	36.232	138	78	4	9	145	20	148	3.67e-15	70.5
Msa1298100	MtrunA17_Chr5g0401071	28.994	169	110	5	9	172	20	183	1.46e-12	63.5
Msa1298100	MtrunA17_Chr5g0443631	23.214	168	123	2	9	171	105	271	8.46e-11	60.1

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa1298100	AT5G47200.1	90.099	202	20	0	1	202	1	202	1.98e-139	387
Msa1298100	AT4G17530.1	89.604	202	21	0	1	202	1	202	1.05e-138	386
Msa1298100	AT1G02130.1	87.192	203	25	1	1	202	1	203	2.38e-134	375
Msa1298100	AT3G11730.1	75.369	203	47	3	1	200	1	203	2.96e-114	324
Msa1298100	AT5G59840.1	59.615	208	73	4	4	202	11	216	1.28e-86	254
Msa1298100	AT3G46060.2	58.654	208	75	4	4	202	11	216	2.39e-85	251
Msa1298100	AT3G46060.3	58.654	208	75	4	4	202	11	216	2.39e-85	251
Msa1298100	AT3G46060.1	58.654	208	75	4	4	202	11	216	2.39e-85	251
Msa1298100	AT3G53610.2	57.488	207	79	3	4	202	11	216	2.23e-84	249
Msa1298100	AT3G53610.3	57.488	207	79	3	4	202	11	216	2.23e-84	249
Msa1298100	AT3G53610.1	57.488	207	79	3	4	202	11	216	2.23e-84	249
Msa1298100	AT3G09900.1	58.454	207	76	3	4	201	11	216	5.39e-82	243
Msa1298100	AT5G03520.1	59.024	205	76	3	4	201	11	214	2.63e-81	241
Msa1298100	AT4G17160.1	48.768	203	96	2	5	200	3	204	1.20e-65	201
Msa1298100	AT1G07410.1	45.714	210	106	2	1	202	5	214	1.16e-64	199
Msa1298100	AT5G47520.1	49.048	210	94	2	6	202	12	221	1.09e-63	196
Msa1298100	AT4G35860.1	45.370	216	92	2	5	201	3	211	1.88e-63	196
Msa1298100	AT1G09630.1	47.170	212	100	3	2	202	6	216	9.16e-63	194
Msa1298100	AT4G17170.1	46.411	209	100	2	5	201	3	211	3.57e-62	192
Msa1298100	AT5G45750.1	47.619	210	101	2	2	202	7	216	8.66e-62	191
Msa1298100	AT3G46830.1	44.131	213	108	1	1	202	5	217	3.64e-61	190
Msa1298100	AT3G46830.2	44.131	213	108	1	1	202	5	217	3.64e-61	190
Msa1298100	AT3G15060.1	48.113	212	98	3	2	202	7	217	4.53e-61	190
Msa1298100	AT5G03520.2	54.819	166	67	3	43	201	40	204	1.38e-60	188
Msa1298100	AT5G60860.1	45.972	211	104	1	2	202	7	217	1.73e-60	188
Msa1298100	AT1G28550.1	47.393	211	98	3	4	202	9	218	2.10e-60	188
Msa1298100	AT4G18430.1	45.714	210	104	1	2	201	7	216	2.20e-60	188
Msa1298100	AT3G07410.1	48.309	207	96	3	6	201	10	216	2.59e-60	188
Msa1298100	AT5G59150.1	42.723	213	111	1	1	202	5	217	3.05e-60	187
Msa1298100	AT1G16920.1	47.596	208	100	2	4	202	9	216	3.19e-60	187
Msa1298100	AT1G06400.1	45.238	210	106	2	2	202	7	216	4.32e-60	187
Msa1298100	AT4G39990.1	46.190	210	99	4	6	202	15	223	4.50e-60	187
Msa1298100	AT2G33870.1	46.919	211	99	3	4	202	9	218	1.66e-59	186
Msa1298100	AT5G47960.1	44.186	215	107	3	1	202	8	222	3.34e-59	185
Msa1298100	AT5G65270.1	45.540	213	99	5	6	202	15	226	6.66e-59	184
Msa1298100	AT4G18800.1	45.673	208	106	2	2	202	7	214	1.11e-58	184
Msa1298100	AT1G05810.1	44.231	208	105	2	6	202	10	217	5.17e-56	177
Msa1298100	AT1G43890.3	54.438	169	74	3	3	169	8	175	5.84e-56	177
Msa1298100	AT1G43890.1	54.438	169	74	3	3	169	8	175	5.84e-56	177
Msa1298100	AT1G43890.2	54.438	169	74	3	3	169	8	175	5.84e-56	177
Msa1298100	AT1G05810.2	44.231	208	105	2	6	202	56	263	1.07e-55	177
Msa1298100	AT5G03530.2	48.515	202	98	4	5	201	10	210	2.03e-55	175
Msa1298100	AT5G03530.1	48.515	202	98	4	5	201	10	210	2.03e-55	175
Msa1298100	AT2G43130.1	44.608	204	105	2	6	201	10	213	2.44e-55	175
Msa1298100	AT3G12160.1	42.654	211	109	2	2	200	9	219	4.81e-55	174
Msa1298100	AT1G18200.1	46.798	203	98	1	2	194	7	209	8.22e-55	174
Msa1298100	AT1G73640.1	48.691	191	93	2	4	190	9	198	9.56e-54	172
Msa1298100	AT2G31680.1	43.062	209	107	2	6	202	10	218	1.13e-53	171
Msa1298100	AT1G01200.1	43.781	201	110	2	1	198	21	221	1.73e-51	166
Msa1298100	AT4G19640.1	41.969	193	107	2	10	201	12	200	2.89e-48	157
Msa1298100	AT5G45130.1	41.538	195	105	4	10	201	12	200	4.21e-46	151
Msa1298100	AT3G54840.1	43.353	173	92	3	10	181	35	202	9.70e-45	147
Msa1298100	AT3G09910.5	45.405	185	97	4	5	187	10	192	1.18e-44	147
Msa1298100	AT3G09910.4	45.405	185	97	4	5	187	10	192	1.18e-44	147
Msa1298100	AT5G45130.2	40.933	193	105	4	12	201	22	208	1.63e-44	147
Msa1298100	AT2G44610.1	37.879	198	118	1	9	201	10	207	2.12e-44	147
Msa1298100	AT3G09910.3	44.500	200	105	4	5	202	10	205	2.41e-44	147
Msa1298100	AT3G09910.1	44.500	200	105	4	5	202	10	205	2.41e-44	147
Msa1298100	AT3G09910.2	44.500	200	105	4	5	202	10	205	2.41e-44	147
Msa1298100	AT3G54840.3	43.023	172	92	3	11	181	2	168	2.45e-44	145
Msa1298100	AT3G54840.2	44.805	154	84	1	10	162	35	188	6.05e-44	145
Msa1298100	AT4G35860.2	42.105	171	73	2	50	201	2	165	1.39e-42	141
Msa1298100	AT2G22290.1	38.191	199	115	3	9	201	10	206	6.25e-42	140
Msa1298100	AT5G10260.1	36.041	197	121	1	9	200	10	206	6.12e-41	138
Msa1298100	AT1G52280.1	39.500	200	110	5	8	199	8	204	8.98e-41	137
Msa1298100	AT4G39890.1	41.975	162	93	1	9	169	10	171	1.11e-40	137
Msa1298100	AT5G59150.2	39.634	164	88	1	50	202	3	166	1.71e-40	135
Msa1298100	AT3G18820.1	42.857	168	89	3	8	168	8	175	3.11e-40	136
Msa1298100	AT3G16100.1	38.500	200	112	5	8	199	8	204	1.38e-39	134
Msa1298100	AT5G64990.1	39.759	166	100	0	9	174	8	173	1.91e-38	132
Msa1298100	AT4G19640.3	45.802	131	71	0	10	140	12	142	2.02e-37	129
Msa1298100	AT1G49300.2	37.000	200	115	5	8	199	8	204	3.29e-37	129
Msa1298100	AT1G49300.1	37.000	200	115	5	8	199	8	204	3.29e-37	129
Msa1298100	AT2G21880.1	39.157	166	94	3	8	166	9	174	1.56e-36	127
Msa1298100	AT4G19640.2	46.400	125	67	0	10	134	12	136	2.13e-36	124
Msa1298100	AT5G64990.2	38.150	173	100	1	9	174	8	180	1.17e-35	125
Msa1298100	AT1G22740.1	35.784	204	109	5	8	199	8	201	1.57e-35	124
Msa1298100	AT4G09720.1	39.759	166	93	3	8	166	8	173	7.12e-34	120
Msa1298100	AT4G09720.4	37.427	171	95	3	8	166	8	178	7.37e-32	115
Msa1298100	AT5G39620.1	40.000	165	92	4	9	166	6	170	1.71e-31	114
Msa1298100	AT4G09720.3	36.158	177	95	3	8	166	8	184	7.06e-31	112
Msa1298100	AT2G21880.4	40.146	137	75	3	37	166	13	149	1.06e-28	106
Msa1298100	AT2G21880.3	40.146	137	75	3	37	166	13	149	1.06e-28	106
Msa1298100	AT2G21880.2	34.337	166	94	4	8	166	9	166	1.18e-26	101
Msa1298100	AT4G09720.6	40.876	137	74	3	37	166	3	139	2.39e-26	99.8
Msa1298100	AT4G09720.5	40.876	137	74	3	37	166	3	139	2.39e-26	99.8
Msa1298100	AT4G09720.2	40.876	137	74	3	37	166	3	139	2.39e-26	99.8
Msa1298100	AT2G44690.1	34.132	167	96	5	8	162	18	182	4.12e-25	97.8
Msa1298100	AT4G35020.1	33.728	169	98	5	8	164	6	172	1.23e-24	96.3
Msa1298100	AT4G35020.2	33.728	169	98	5	8	164	6	172	1.23e-24	96.3
Msa1298100	AT4G35020.3	33.728	169	98	5	8	164	6	172	1.23e-24	96.3
Msa1298100	AT5G55190.1	30.435	184	119	4	9	188	14	192	2.72e-24	95.9
Msa1298100	AT4G28950.1	33.333	165	98	5	8	162	6	168	3.00e-24	95.5
Msa1298100	AT5G20020.1	28.796	191	129	3	9	195	14	201	3.90e-24	95.5
Msa1298100	AT5G55080.1	30.864	162	107	4	9	169	14	171	4.03e-24	95.5
Msa1298100	AT5G20010.1	31.056	161	108	2	9	169	14	171	5.14e-24	95.1
Msa1298100	AT3G51300.1	32.934	167	98	5	10	164	8	172	1.25e-23	93.6
Msa1298100	AT1G75840.1	32.544	169	100	5	8	164	6	172	3.63e-23	92.0
Msa1298100	AT2G17800.2	32.544	169	100	5	8	164	6	172	6.87e-23	91.7
Msa1298100	AT2G17800.1	32.544	169	100	5	8	164	6	172	6.87e-23	91.7
Msa1298100	AT4G35950.1	32.544	169	100	5	8	164	6	172	9.95e-23	91.3
Msa1298100	AT5G45970.1	30.539	167	102	5	8	162	6	170	4.73e-22	89.4
Msa1298100	AT5G46025.1	40.187	107	63	1	70	175	6	112	6.01e-22	86.7
Msa1298100	AT1G20090.1	31.361	169	102	5	8	164	5	171	1.37e-21	88.2
Msa1298100	AT3G48040.1	30.178	169	104	5	8	164	8	174	1.12e-20	85.9
Msa1298100	AT5G62880.1	29.885	174	108	5	8	169	8	179	6.61e-20	84.0
Msa1298100	AT3G48040.2	33.333	123	79	3	8	129	8	128	3.98e-19	81.3
Msa1298100	AT5G62880.2	34.146	123	78	3	8	129	8	128	6.09e-19	80.9
Msa1298100	AT4G35020.4	35.965	114	70	3	10	122	8	119	2.45e-18	78.2
Msa1298100	AT4G35020.5	35.965	114	70	3	10	122	8	119	2.45e-18	78.2
Msa1298100	AT5G67560.1	33.962	159	95	5	9	162	20	173	3.84e-14	68.2
Msa1298100	AT5G37680.1	34.058	138	81	4	9	145	20	148	4.13e-14	68.2
Msa1298100	AT3G49870.2	31.609	174	99	6	9	172	1	164	4.88e-14	67.4
Msa1298100	AT3G51290.2	32.394	142	82	5	35	164	634	773	5.05e-14	70.5
Msa1298100	AT3G49870.1	32.759	174	97	7	9	172	20	183	1.58e-13	66.2
Msa1298100	AT3G22950.1	31.298	131	76	5	1	127	12	132	1.57e-11	60.8
Msa1298100	AT3G22950.2	31.298	131	76	5	1	127	12	132	1.57e-11	60.8
Msa1298100	AT3G49860.1	28.205	156	104	4	9	160	12	163	1.90e-11	60.5
Msa1298100	AT5G37680.2	35.780	109	60	4	38	145	2	101	3.50e-11	58.9

Find 82 sgRNAs with CRISPR-Local

Find 271 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
TCACTGGTTGTCCTCGAATT+TGG	0.168291	8_3:-58738353	None:intergenic
ACTTACAATTTGAAGTTTAA+TGG	0.206147	8_3:-58737163	None:intergenic
CCTCGAATTTGGACTGTTGC+AGG	0.237144	8_3:-58738342	None:intergenic
CAGGCATTTGCAGATGAAAT+TGG	0.240708	8_3:+58738062	Msa1298100:intron
CTGCTGGTCAAGAACGTTTC+CGG	0.274066	8_3:+58737636	Msa1298100:CDS
AGAGTTGAGACTTACTATTC+AGG	0.317299	8_3:-58734903	None:intergenic
TGAGTAACGTAAAATGTGTT+TGG	0.320714	8_3:-58738623	None:intergenic
GAGTAACGTAAAATGTGTTT+GGG	0.326797	8_3:-58738622	None:intergenic
TGAAATTGGAATTCCTTTCA+TGG	0.332549	8_3:+58738076	Msa1298100:CDS
TCACTTATCTCTTTAGTTGT+TGG	0.357342	8_3:+58738664	Msa1298100:three_prime_UTR
CAATGTGGAACAAGCTTTCA+TGG	0.386569	8_3:+58738121	Msa1298100:CDS
TAACATTGTTAAAGCTCTCT+TGG	0.389666	8_3:-58737815	None:intergenic
ACGAGCAGCAACCAGCCTTC+TGG	0.395079	8_3:-58738377	None:intergenic
TCTTAGAGACCAAGTATTCA+TGG	0.395534	8_3:+58738399	Msa1298100:exon
TACTCAATAGCTTCCCGTAT+TGG	0.396704	8_3:+58738640	Msa1298100:three_prime_UTR
AATTTGGACTGTTGCAGGCC+TGG	0.409513	8_3:-58738337	None:intergenic
AATGTTAACAAGCTTCTAGT+TGG	0.417837	8_3:+58737876	Msa1298100:CDS
TTGGCAGCGAAGGGAGTTAC+CGG	0.420942	8_3:-58734833	None:intergenic
CTTCTAAGACCATGAATACT+TGG	0.425115	8_3:-58738408	None:intergenic
AAGAGATAAGTGAGCCAATA+CGG	0.427083	8_3:-58738654	None:intergenic
TGTTGCAGGCCTGGCACTGT+TGG	0.432139	8_3:-58738328	None:intergenic
CAACCAGCCTTCTGGTTCAC+TGG	0.436527	8_3:-58738369	None:intergenic
AAGGGATCGGAAGAAGGGTT+TGG	0.449473	8_3:-58734852	None:intergenic
AAAGATGGAAGAAGAAATGA+AGG	0.458708	8_3:-58734777	None:intergenic
AGAAATTGAGAAGCGAAAGA+TGG	0.467173	8_3:-58734792	None:intergenic
GAAAATCCGCACTGTTGAGC+AGG	0.471772	8_3:+58737131	Msa1298100:intron
GTCAACCTGCCAACAGTGCC+AGG	0.473985	8_3:+58738319	Msa1298100:CDS
AGCTACTATCGTGGGGCTCA+TGG	0.480037	8_3:+58737671	Msa1298100:CDS
GAAAGCTTGTTCCACATTGG+AGG	0.502915	8_3:-58738117	None:intergenic
ATCGGAAAGGGATCGGAAGA+AGG	0.506069	8_3:-58734858	None:intergenic
TTGATTGGAGATTCTGGTGT+GGG	0.506444	8_3:+58736463	Msa1298100:CDS
ATTGTATAGTGGGACACTGC+TGG	0.512939	8_3:+58737620	Msa1298100:intron
TCCGCACTGTTGAGCAGGAT+GGG	0.520866	8_3:+58737136	Msa1298100:CDS
TTAGCACTAGTTTCCATGAA+AGG	0.524383	8_3:-58738089	None:intergenic
ATCCGCACTGTTGAGCAGGA+TGG	0.528930	8_3:+58737135	Msa1298100:CDS
CGAAGGGAGTTACCGGTCGC+CGG	0.532984	8_3:-58734826	None:intergenic
AATCACCTTTGCTGTTTCAG+AGG	0.533991	8_3:-58737934	None:intergenic
CGGAGGTATACGCATCAAGA+AGG	0.536232	8_3:-58734720	None:intergenic
TAAAATGACTCGCTTGGTGT+CGG	0.537749	8_3:-58734740	None:intergenic
ATGACGGTGAGAGGTTGAAT+CGG	0.541849	8_3:-58734876	None:intergenic
GAAGAAGGGTTTGGCAGCGA+AGG	0.542052	8_3:-58734843	None:intergenic
AGTAGCTGCTAGTTATAGTC+CGG	0.542099	8_3:-58737655	None:intergenic
TAACTAGCAGCTACTATCGT+GGG	0.548282	8_3:+58737663	Msa1298100:CDS
ATACGCATCAAGAAGGGAGT+GGG	0.550854	8_3:-58734713	None:intergenic
AGAGATAAGTGAGCCAATAC+GGG	0.555982	8_3:-58738653	None:intergenic
AGGTTGAATCGGAAAGGGAT+CGG	0.562913	8_3:-58734865	None:intergenic
TGTGTTTGGGGCAACGAACA+AGG	0.563689	8_3:-58738609	None:intergenic
GTGAGAGGTTGAATCGGAAA+GGG	0.564038	8_3:-58734870	None:intergenic
GACAGCTATATCAGTACCAT+CGG	0.567693	8_3:+58737008	Msa1298100:CDS
CAGAACTTACAGCAAACCTC+AGG	0.568006	8_3:-58736501	None:intergenic
TGGAAACAAGAGCGATCTCT+CGG	0.568213	8_3:+58737896	Msa1298100:CDS
GCAAGTCATGTCTCCTCCTG+AGG	0.576917	8_3:+58736485	Msa1298100:CDS
TGGTACTGATATAGCTGTCA+AGG	0.577148	8_3:-58737004	None:intergenic
GGTGAGAGGTTGAATCGGAA+AGG	0.581313	8_3:-58734871	None:intergenic
AAGAAGGGTTTGGCAGCGAA+GGG	0.582589	8_3:-58734842	None:intergenic
TCAGGATTCATGACGGTGAG+AGG	0.583650	8_3:-58734885	None:intergenic
CCTGCAACAGTCCAAATTCG+AGG	0.584589	8_3:+58738342	Msa1298100:CDS
TATACGCATCAAGAAGGGAG+TGG	0.591545	8_3:-58734714	None:intergenic
CATGAAAGCTTGTTCCACAT+TGG	0.594293	8_3:-58738120	None:intergenic
CAACCAGTGAACCAGAAGGC+TGG	0.595916	8_3:+58738366	Msa1298100:CDS
TCGGAAAGGGATCGGAAGAA+GGG	0.597755	8_3:-58734857	None:intergenic
GAGACGTATGCCAACCACTT+CGG	0.601230	8_3:-58734690	None:intergenic
GGAACAAGCTTTCATGGCCA+TGG	0.601950	8_3:+58738127	Msa1298100:CDS
AATGACTCGCTTGGTGTCGG+AGG	0.604170	8_3:-58734737	None:intergenic
GTTGATTGGAGATTCTGGTG+TGG	0.609925	8_3:+58736462	Msa1298100:CDS
GTGGCAAGCACCGAAGTGGT+TGG	0.616304	8_3:+58734680	None:intergenic
AACTTACAGCAAACCTCAGG+AGG	0.618028	8_3:-58736498	None:intergenic
AGAAGTTCCATGTGTCTCTG+TGG	0.620705	8_3:+58738426	Msa1298100:three_prime_UTR
ATAACTAGCAGCTACTATCG+TGG	0.626182	8_3:+58737662	Msa1298100:CDS
GGAGGTATACGCATCAAGAA+GGG	0.627373	8_3:-58734719	None:intergenic
GCTTACAAAGTCCACTCCGA+TGG	0.633467	8_3:-58737024	None:intergenic
GCTTTAACAATGTTAAGCAG+TGG	0.636327	8_3:+58737823	Msa1298100:CDS
TTACATGCCACAGAGACACA+TGG	0.640787	8_3:-58738433	None:intergenic
TGTGTCCTCTGAAACAGCAA+AGG	0.645238	8_3:+58737929	Msa1298100:CDS
TCCCATCCTGCTCAACAGTG+CGG	0.647894	8_3:-58737137	None:intergenic
ACACGTGGCAAGCACCGAAG+TGG	0.656912	8_3:+58734676	None:intergenic
AGTAACGTAAAATGTGTTTG+GGG	0.658888	8_3:-58738621	None:intergenic
TACGCATCAAGAAGGGAGTG+GGG	0.662707	8_3:-58734712	None:intergenic
AACTAGCAGCTACTATCGTG+GGG	0.674225	8_3:+58737664	Msa1298100:CDS
CTATATCAGTACCATCGGAG+TGG	0.681244	8_3:+58737013	Msa1298100:CDS
AGGACAACCAGTGAACCAGA+AGG	0.685270	8_3:+58738362	Msa1298100:CDS
TTACTATTCAGGATTCATGA+CGG	0.701188	8_3:-58734892	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!	TTAAAATTTAAAAATAAGAC+AGG	-	chr8_3:58734990-58735009	None:intergenic	10.0%
!!!	AAGAATCATAATTATTTTAT+GGG	-	chr8_3:58736250-58736269	None:intergenic	10.0%
!!	AAAAAAAAAAAAAAAAACAG+AGG	-	chr8_3:58736529-58736548	None:intergenic	10.0%
!!	AAAATGTAATAGTAAAAAAT+GGG	-	chr8_3:58736611-58736630	None:intergenic	10.0%
!!!	TCATTTTCTCAAATTATTAT+CGG	-	chr8_3:58735380-58735399	None:intergenic	15.0%
!!!	TTGTTTTATGATTGAATTTA+GGG	+	chr8_3:58735474-58735493	Msa1298100:intron	15.0%
!!!	TTTTAAACCTATTAACTTTA+GGG	-	chr8_3:58735636-58735655	None:intergenic	15.0%
!!!	TTTTTAAACCTATTAACTTT+AGG	-	chr8_3:58735637-58735656	None:intergenic	15.0%
!!	TAGGTTTAAAAATTTATTAG+AGG	+	chr8_3:58735645-58735664	Msa1298100:intron	15.0%
!!!	CAAGAATCATAATTATTTTA+TGG	-	chr8_3:58736251-58736270	None:intergenic	15.0%
!!	AATAATATCATATCTTTGAT+TGG	+	chr8_3:58736397-58736416	Msa1298100:intron	15.0%
!!	ATAATATCATATCTTTGATT+GGG	+	chr8_3:58736398-58736417	Msa1298100:intron	15.0%
!!	GAAAATGTAATAGTAAAAAA+TGG	-	chr8_3:58736612-58736631	None:intergenic	15.0%
!!!	CTTTTTAAATTTTTTTTTGC+AGG	+	chr8_3:58737773-58737792	Msa1298100:intron	15.0%
!!	ACATCAAAATATTAGATTAA+AGG	-	chr8_3:58738025-58738044	None:intergenic	15.0%
!!	AAAAAATTATGTACAAAAGT+AGG	+	chr8_3:58738562-58738581	Msa1298100:three_prime_UTR	15.0%
!!!	TTTACTTTTTATCTTATGCA+TGG	+	chr8_3:58735090-58735109	Msa1298100:intron	20.0%
!!	AACTAAACATGATAACTAAA+CGG	-	chr8_3:58735192-58735211	None:intergenic	20.0%
!!	TTTCTTAAAATTGATACACA+TGG	+	chr8_3:58735335-58735354	Msa1298100:intron	20.0%
!!	TTCTTAAAATTGATACACAT+GGG	+	chr8_3:58735336-58735355	Msa1298100:intron	20.0%
!!!	GTTGTTTTATGATTGAATTT+AGG	+	chr8_3:58735473-58735492	Msa1298100:intron	20.0%
!!	TATGTTAAAAAATGTTGTAC+AGG	+	chr8_3:58735784-58735803	Msa1298100:intron	20.0%
!!	TGGTATATCCTTATAAAATA+AGG	+	chr8_3:58736053-58736072	Msa1298100:intron	20.0%
!!!	AACATTCTCCTTATTTTATA+AGG	-	chr8_3:58736064-58736083	None:intergenic	20.0%
!!!	TTTAAATCGAAATTTTGTCT+TGG	-	chr8_3:58736187-58736206	None:intergenic	20.0%
!!	TAATATCATATCTTTGATTG+GGG	+	chr8_3:58736399-58736418	Msa1298100:intron	20.0%
!!!	TTTTTTTCCTTCTTTAGTTA+TGG	+	chr8_3:58736546-58736565	Msa1298100:intron	20.0%
!!	AGTTGAATATAAAGAACATA+TGG	+	chr8_3:58736638-58736657	Msa1298100:intron	20.0%
!!	ACTTCATAAAATATCATTCA+AGG	-	chr8_3:58736931-58736950	None:intergenic	20.0%
!!!	TTGAATGATATTTTATGAAG+TGG	+	chr8_3:58736930-58736949	Msa1298100:intron	20.0%
!!	ATAAGTTTAAATGGTAGATA+TGG	-	chr8_3:58737053-58737072	None:intergenic	20.0%
!!	AACATGGAAATAAGTTTAAA+TGG	-	chr8_3:58737062-58737081	None:intergenic	20.0%
!!!	ACTTACAATTTGAAGTTTAA+TGG	-	chr8_3:58737166-58737185	None:intergenic	20.0%
!!	TTTAGATGTAGAAAACAAAT+TGG	-	chr8_3:58737276-58737295	None:intergenic	20.0%
!!	TTATATGTCCATTTGATAAA+TGG	+	chr8_3:58737411-58737430	Msa1298100:intron	20.0%
!!	TTGATTTCCTAATATTCAAT+GGG	-	chr8_3:58737512-58737531	None:intergenic	20.0%
!!!	ATTGATTTCCTAATATTCAA+TGG	-	chr8_3:58737513-58737532	None:intergenic	20.0%
!!!	TGCATTTTTTTATTGTATAG+TGG	+	chr8_3:58737609-58737628	Msa1298100:intron	20.0%
!!!	GCATTTTTTTATTGTATAGT+GGG	+	chr8_3:58737610-58737629	Msa1298100:intron	20.0%
!!	CAAAATATTAGATTAAAGGA+AGG	-	chr8_3:58738021-58738040	None:intergenic	20.0%
!!	CAATTTCTCTTTTCTTTATC+CGG	+	chr8_3:58734807-58734826	Msa1298100:five_prime_UTR	25.0%
!!!	AGGAAAGAATTAATTTGTGA+CGG	-	chr8_3:58734970-58734989	None:intergenic	25.0%
!!	AGAGATGTTCAATTTTCATA+AGG	+	chr8_3:58735264-58735283	Msa1298100:intron	25.0%
!	AAAACAACACTTATGAATGA+AGG	-	chr8_3:58735461-58735480	None:intergenic	25.0%
!	CATATTCATTGATCTATCTA+TGG	-	chr8_3:58735589-58735608	None:intergenic	25.0%
!!	TTTTTAACATATATCCCACA+TGG	-	chr8_3:58735775-58735794	None:intergenic	25.0%
!	TAAATGATGTCCTATATATG+TGG	+	chr8_3:58735885-58735904	Msa1298100:intron	25.0%
!	AATCAATTTCTTGTCTTCAT+TGG	+	chr8_3:58736033-58736052	Msa1298100:intron	25.0%
!!	TTATAAAAGCTTGCCAATTT+TGG	-	chr8_3:58736118-58736137	None:intergenic	25.0%
!!	ATTGGCAAGCTTTTATAAAA+AGG	+	chr8_3:58736120-58736139	Msa1298100:intron	25.0%
!!	AAATGAGTTCTAGTCTATAA+TGG	-	chr8_3:58736312-58736331	None:intergenic	25.0%
!	ATTATAGACTAGAACTCATT+TGG	+	chr8_3:58736311-58736330	Msa1298100:intron	25.0%
!	TTATAGACTAGAACTCATTT+GGG	+	chr8_3:58736312-58736331	Msa1298100:intron	25.0%
!!	TATCTTTTTCCTAAAGAGAA+TGG	-	chr8_3:58736367-58736386	None:intergenic	25.0%
!!	ATTCTCTTTAGGAAAAAGAT+AGG	+	chr8_3:58736366-58736385	Msa1298100:intron	25.0%
!	ATAGTCACTGAAAATAAGAT+AGG	-	chr8_3:58736428-58736447	None:intergenic	25.0%
!!	AATGATATTTTATGAAGTGG+AGG	+	chr8_3:58736933-58736952	Msa1298100:intron	25.0%
!!	TTTTTCTTTTTCTGTGAAAC+AGG	+	chr8_3:58736971-58736990	Msa1298100:intron	25.0%
!	TACTAAAGTTGAAAACAACA+TGG	-	chr8_3:58737078-58737097	None:intergenic	25.0%
!	AATACTGAACAAGTTGTTAT+TGG	+	chr8_3:58737210-58737229	Msa1298100:intron	25.0%
!	CATTTGAACAGTATTATTTG+AGG	+	chr8_3:58737475-58737494	Msa1298100:intron	25.0%
!	AAAGTTACCCATTGAATATT+AGG	+	chr8_3:58737502-58737521	Msa1298100:intron	25.0%
!!	AATTTCCTTTTCAAACACTT+CGG	+	chr8_3:58737530-58737549	Msa1298100:intron	25.0%
!!	AATTGTGAGTCTTTTTAAAC+CGG	+	chr8_3:58737697-58737716	Msa1298100:intron	25.0%
!!	ATTTCCTTTTTACATTGTCT+TGG	+	chr8_3:58737733-58737752	Msa1298100:intron	25.0%
!!	TTTCCTTTTTACATTGTCTT+GGG	+	chr8_3:58737734-58737753	Msa1298100:intron	25.0%
!	TATGGAATTTCTGTATGTAA+AGG	+	chr8_3:58738170-58738189	Msa1298100:intron	25.0%
!	GTAAATGAGGTTAATAATCA+AGG	-	chr8_3:58738267-58738286	None:intergenic	25.0%
	AAAGATGGAAGAAGAAATGA+AGG	-	chr8_3:58734780-58734799	None:intergenic	30.0%
	TTACTATTCAGGATTCATGA+CGG	-	chr8_3:58734895-58734914	None:intergenic	30.0%
!!	TTAATTTGTGACGGGAAATT+TGG	-	chr8_3:58734961-58734980	None:intergenic	30.0%
!!	GGAAAGAATTAATTTGTGAC+GGG	-	chr8_3:58734969-58734988	None:intergenic	30.0%
!	TGGATTGTGAAATTTGTTCA+TGG	+	chr8_3:58735110-58735129	Msa1298100:intron	30.0%
!	TTGATTATGTGATCCACTTT+TGG	+	chr8_3:58735236-58735255	Msa1298100:intron	30.0%
	TAAAATTGATACACATGGGA+TGG	+	chr8_3:58735340-58735359	Msa1298100:intron	30.0%
!!	TCTATAGTTTGTTTCTTCCA+CGG	+	chr8_3:58735528-58735547	Msa1298100:intron	30.0%
	ATGATGTCTTGAGTAAAATG+TGG	+	chr8_3:58735606-58735625	Msa1298100:intron	30.0%
!	TAAACCTATTAACTTTAGGG+AGG	-	chr8_3:58735633-58735652	None:intergenic	30.0%
!	TGTCTTTTGTAATCTTGTAC+TGG	+	chr8_3:58735703-58735722	Msa1298100:intron	30.0%
!	GTCTTTTGTAATCTTGTACT+GGG	+	chr8_3:58735704-58735723	Msa1298100:intron	30.0%
!	TCTTTTGTAATCTTGTACTG+GGG	+	chr8_3:58735705-58735724	Msa1298100:intron	30.0%
!	GAAATACTTTTGTCCATTAG+AGG	-	chr8_3:58735734-58735753	None:intergenic	30.0%
	AAAAAATGTTGTACAGGTCA+TGG	+	chr8_3:58735790-58735809	Msa1298100:intron	30.0%
	AAAAATGTTGTACAGGTCAT+GGG	+	chr8_3:58735791-58735810	Msa1298100:intron	30.0%
	ATTGGTTAAGCAACCAAAAT+TGG	+	chr8_3:58736102-58736121	Msa1298100:intron	30.0%
!	TTGTTCAAGCTTTTGTTGAT+TGG	+	chr8_3:58736448-58736467	Msa1298100:CDS	30.0%
	AAGATGACCATAACTAAAGA+AGG	-	chr8_3:58736556-58736575	None:intergenic	30.0%
!	GAACATATGGATGTGTTTTT+AGG	+	chr8_3:58736651-58736670	Msa1298100:intron	30.0%
	TCTTGACCATAAACAATGTA+AGG	+	chr8_3:58736752-58736771	Msa1298100:intron	30.0%
!!!	GTCATTTTTATGTGAGAAGA+AGG	-	chr8_3:58736862-58736881	None:intergenic	30.0%
!!	ATTTTCTAAAGAAGGAAGCA+TGG	-	chr8_3:58737117-58737136	None:intergenic	30.0%
!!!	TCCATGAGAAGTTTTATTTG+AGG	+	chr8_3:58737362-58737381	Msa1298100:intron	30.0%
	TCCTCAAATAAAACTTCTCA+TGG	-	chr8_3:58737366-58737385	None:intergenic	30.0%
!	AATTGGTAACTGGAAAAACT+TGG	-	chr8_3:58737443-58737462	None:intergenic	30.0%
	AAATGATCCAAGAACACAAT+TGG	-	chr8_3:58737460-58737479	None:intergenic	30.0%
	AAAAGGAAATTGCTGACAAA+GGG	-	chr8_3:58737723-58737742	None:intergenic	30.0%
	AAAAAGGAAATTGCTGACAA+AGG	-	chr8_3:58737724-58737743	None:intergenic	30.0%
	TTTCCCAAGACAATGTAAAA+AGG	-	chr8_3:58737740-58737759	None:intergenic	30.0%
	TAACATTGTTAAAGCTCTCT+TGG	-	chr8_3:58737818-58737837	None:intergenic	30.0%
!	TAACATTTTCACTTGCATAG+CGG	-	chr8_3:58737863-58737882	None:intergenic	30.0%
	AATGTTAACAAGCTTCTAGT+TGG	+	chr8_3:58737876-58737895	Msa1298100:CDS	30.0%
	AAAAAAATGTCACTGGAAGT+GGG	-	chr8_3:58737993-58738012	None:intergenic	30.0%
	AAAAAAAATGTCACTGGAAG+TGG	-	chr8_3:58737994-58738013	None:intergenic	30.0%
	GGACTTAAAAAAAATGTCAC+TGG	-	chr8_3:58738000-58738019	None:intergenic	30.0%
	TGAAATTGGAATTCCTTTCA+TGG	+	chr8_3:58738076-58738095	Msa1298100:CDS	30.0%
	GCTGAAATTAAAAACAGGTA+TGG	+	chr8_3:58738152-58738171	Msa1298100:intron	30.0%
!	CAGTATCTATTGACTAAACA+AGG	-	chr8_3:58738239-58738258	None:intergenic	30.0%
	AGTAACGTAAAATGTGTTTG+GGG	-	chr8_3:58738624-58738643	None:intergenic	30.0%
	GAGTAACGTAAAATGTGTTT+GGG	-	chr8_3:58738625-58738644	None:intergenic	30.0%
	TGAGTAACGTAAAATGTGTT+TGG	-	chr8_3:58738626-58738645	None:intergenic	30.0%
	TCACTTATCTCTTTAGTTGT+TGG	+	chr8_3:58738664-58738683	Msa1298100:three_prime_UTR	30.0%
!!!	GAGTTTTAAAATGACTCGCT+TGG	-	chr8_3:58734749-58734768	None:intergenic	35.0%
	AGAAATTGAGAAGCGAAAGA+TGG	-	chr8_3:58734795-58734814	None:intergenic	35.0%
	AGAGTTGAGACTTACTATTC+AGG	-	chr8_3:58734906-58734925	None:intergenic	35.0%
	TAAACGGATCTAAATCAGCA+AGG	-	chr8_3:58735155-58735174	None:intergenic	35.0%
	AGATCCGTTTAATTAGTCGA+TGG	+	chr8_3:58735164-58735183	Msa1298100:intron	35.0%
!	GGATCCATCGACTAATTAAA+CGG	-	chr8_3:58735171-58735190	None:intergenic	35.0%
	ACATCTCTTGAAACCAAAAG+TGG	-	chr8_3:58735252-58735271	None:intergenic	35.0%
	GTAAATGCATGTGAACTCTA+AGG	+	chr8_3:58735286-58735305	Msa1298100:intron	35.0%
!!	CTCTGAGTTGAAAAAGCATT+CGG	-	chr8_3:58735505-58735524	None:intergenic	35.0%
	TGCATGACTTCAATCAATCT+AGG	+	chr8_3:58735846-58735865	Msa1298100:intron	35.0%
	ATGTACGATGCCACATATAT+AGG	-	chr8_3:58735898-58735917	None:intergenic	35.0%
	GCAAAACATGACTGTCTAAA+AGG	-	chr8_3:58735927-58735946	None:intergenic	35.0%
!!	CTTTTGTTGATTGGAGATTC+TGG	+	chr8_3:58736457-58736476	Msa1298100:CDS	35.0%
!!	AGGCATTGAAAAAGTGTGTA+TGG	+	chr8_3:58736671-58736690	Msa1298100:intron	35.0%
	TATATGCACCAGAGAGTAAA+AGG	+	chr8_3:58736723-58736742	Msa1298100:intron	35.0%
!	GATTTACTCCTTTTACTCTC+TGG	-	chr8_3:58736734-58736753	None:intergenic	35.0%
	CCTTGACCTTACATTGTTTA+TGG	-	chr8_3:58736761-58736780	None:intergenic	35.0%
	CCATAAACAATGTAAGGTCA+AGG	+	chr8_3:58736758-58736777	Msa1298100:intron	35.0%
	CTATTTGTGGTTTGATCGAA+CGG	+	chr8_3:58736825-58736844	Msa1298100:intron	35.0%
!!	TTATTGGTTCTGAACTCTGA+TGG	+	chr8_3:58737226-58737245	Msa1298100:intron	35.0%
!!	TATTGGTTCTGAACTCTGAT+GGG	+	chr8_3:58737227-58737246	Msa1298100:intron	35.0%
	GGAATGAGCCATTTATCAAA+TGG	-	chr8_3:58737422-58737441	None:intergenic	35.0%
	ACATTGTCTTGGGAAAACAA+TGG	+	chr8_3:58737744-58737763	Msa1298100:intron	35.0%
	GCTTTAACAATGTTAAGCAG+TGG	+	chr8_3:58737823-58737842	Msa1298100:CDS	35.0%
!	TTAGCACTAGTTTCCATGAA+AGG	-	chr8_3:58738092-58738111	None:intergenic	35.0%
!!!	GTTTTTAATTTCAGCAGCCA+TGG	-	chr8_3:58738147-58738166	None:intergenic	35.0%
	TGGCTGCTGAAATTAAAAAC+AGG	+	chr8_3:58738147-58738166	Msa1298100:CDS	35.0%
!	CCATTCTGTGAAAAAAGTAC+CGG	-	chr8_3:58738296-58738315	None:intergenic	35.0%
	TCTTAGAGACCAAGTATTCA+TGG	+	chr8_3:58738399-58738418	Msa1298100:exon	35.0%
!!	CTTCTAAGACCATGAATACT+TGG	-	chr8_3:58738411-58738430	None:intergenic	35.0%
	AAGAGATAAGTGAGCCAATA+CGG	-	chr8_3:58738657-58738676	None:intergenic	35.0%
!!	TAAAATGACTCGCTTGGTGT+CGG	-	chr8_3:58734743-58734762	None:intergenic	40.0%
!!	GGAGAAGTGTTAAGCAGAAA+AGG	-	chr8_3:58734940-58734959	None:intergenic	40.0%
	TGCGCAGATCTAACTAAACA+AGG	-	chr8_3:58735027-58735046	None:intergenic	40.0%
	GATAATGTAATCACGTGTGC+CGG	+	chr8_3:58735400-58735419	Msa1298100:intron	40.0%
!	CTTATGAATGAAGGTGTGTC+TGG	-	chr8_3:58735452-58735471	None:intergenic	40.0%
!!	TAGTTTGTTTCTTCCACGGT+TGG	+	chr8_3:58735532-58735551	Msa1298100:intron	40.0%
!	TTTCTTCCACGGTTGGTATA+AGG	+	chr8_3:58735539-58735558	Msa1298100:intron	40.0%
!	TTCTTCCACGGTTGGTATAA+GGG	+	chr8_3:58735540-58735559	Msa1298100:intron	40.0%
	TGGTCCTCCCTAAAGTTAAT+AGG	+	chr8_3:58735626-58735645	Msa1298100:intron	40.0%
	TAAAGCTAGTGAAGTCCATG+TGG	+	chr8_3:58735757-58735776	Msa1298100:intron	40.0%
	AAAGCTAGTGAAGTCCATGT+GGG	+	chr8_3:58735758-58735777	Msa1298100:intron	40.0%
!!	TCATGTTTTGCTGTCTACTG+TGG	+	chr8_3:58735936-58735955	Msa1298100:intron	40.0%
	GAGAATGGCCATAGCAAAAT+GGG	-	chr8_3:58736352-58736371	None:intergenic	40.0%
	AGAGAATGGCCATAGCAAAA+TGG	-	chr8_3:58736353-58736372	None:intergenic	40.0%
	TTGCTATGGCCATTCTCTTT+AGG	+	chr8_3:58736355-58736374	Msa1298100:intron	40.0%
	TTGATTGGAGATTCTGGTGT+GGG	+	chr8_3:58736463-58736482	Msa1298100:CDS	40.0%
	TACATAGTGAGATTGTGAGC+AGG	+	chr8_3:58736699-58736718	Msa1298100:intron	40.0%
	CAGAGTCACATCTCTATTTG+TGG	+	chr8_3:58736812-58736831	Msa1298100:intron	40.0%
!!	TGGTACTGATATAGCTGTCA+AGG	-	chr8_3:58737007-58737026	None:intergenic	40.0%
	GACAGCTATATCAGTACCAT+CGG	+	chr8_3:58737008-58737027	Msa1298100:CDS	40.0%
!!	CAGTGCGGATTTTCTAAAGA+AGG	-	chr8_3:58737125-58737144	None:intergenic	40.0%
!	CCAAGAACACAATTGGTAAC+TGG	-	chr8_3:58737453-58737472	None:intergenic	40.0%
	CCAGTTACCAATTGTGTTCT+TGG	+	chr8_3:58737450-58737469	Msa1298100:intron	40.0%
!	TTGAGCCGAAGTGTTTGAAA+AGG	-	chr8_3:58737538-58737557	None:intergenic	40.0%
	AACACTTCGGCTCAATTATC+TGG	+	chr8_3:58737543-58737562	Msa1298100:intron	40.0%
	ACACTTCGGCTCAATTATCT+GGG	+	chr8_3:58737544-58737563	Msa1298100:intron	40.0%
	AGTAGCTGCTAGTTATAGTC+CGG	-	chr8_3:58737658-58737677	None:intergenic	40.0%
	ATAACTAGCAGCTACTATCG+TGG	+	chr8_3:58737662-58737681	Msa1298100:CDS	40.0%
	TAACTAGCAGCTACTATCGT+GGG	+	chr8_3:58737663-58737682	Msa1298100:CDS	40.0%
!!	AATCACCTTTGCTGTTTCAG+AGG	-	chr8_3:58737937-58737956	None:intergenic	40.0%
	TGGAAGTGGGACATGTATAT+GGG	-	chr8_3:58737980-58737999	None:intergenic	40.0%
!	GTTTGTGCCTTTTGTACATC+AGG	+	chr8_3:58738043-58738062	Msa1298100:intron	40.0%
	GCAAATGCCTGATGTACAAA+AGG	-	chr8_3:58738053-58738072	None:intergenic	40.0%
	CAGGCATTTGCAGATGAAAT+TGG	+	chr8_3:58738062-58738081	Msa1298100:intron	40.0%
	TGCTAAAAATGCCTCCAATG+TGG	+	chr8_3:58738106-58738125	Msa1298100:CDS	40.0%
!	CATGAAAGCTTGTTCCACAT+TGG	-	chr8_3:58738123-58738142	None:intergenic	40.0%
	CAATGTGGAACAAGCTTTCA+TGG	+	chr8_3:58738121-58738140	Msa1298100:CDS	40.0%
!!!	CCGGTACTTTTTTCACAGAA+TGG	+	chr8_3:58738293-58738312	Msa1298100:intron	40.0%
	TACTCAATAGCTTCCCGTAT+TGG	+	chr8_3:58738640-58738659	Msa1298100:three_prime_UTR	40.0%
	AGAGATAAGTGAGCCAATAC+GGG	-	chr8_3:58738656-58738675	None:intergenic	40.0%
	ATACGCATCAAGAAGGGAGT+GGG	-	chr8_3:58734716-58734735	None:intergenic	45.0%
	TATACGCATCAAGAAGGGAG+TGG	-	chr8_3:58734717-58734736	None:intergenic	45.0%
!	GGAGGTATACGCATCAAGAA+GGG	-	chr8_3:58734722-58734741	None:intergenic	45.0%
!	TCTTTTCTTTATCCGGCGAC+CGG	+	chr8_3:58734814-58734833	Msa1298100:five_prime_UTR	45.0%
	AGGTTGAATCGGAAAGGGAT+CGG	-	chr8_3:58734868-58734887	None:intergenic	45.0%
	GTGAGAGGTTGAATCGGAAA+GGG	-	chr8_3:58734873-58734892	None:intergenic	45.0%
	ATGACGGTGAGAGGTTGAAT+CGG	-	chr8_3:58734879-58734898	None:intergenic	45.0%
!!	GAACTCTAAGGTCTCTGTGA+TGG	+	chr8_3:58735298-58735317	Msa1298100:intron	45.0%
!	TCTTCCACGGTTGGTATAAG+GGG	+	chr8_3:58735541-58735560	Msa1298100:intron	45.0%
	TGTACTGGGGAATCCTCTAA+TGG	+	chr8_3:58735718-58735737	Msa1298100:intron	45.0%
	AGATTGCTTAACTAGTGCCC+CGG	+	chr8_3:58736206-58736225	Msa1298100:intron	45.0%
	CAAAATGGGTGACTGTGACA+TGG	-	chr8_3:58736338-58736357	None:intergenic	45.0%
!	CACAGTCACCCATTTTGCTA+TGG	+	chr8_3:58736341-58736360	Msa1298100:intron	45.0%
	GTTGATTGGAGATTCTGGTG+TGG	+	chr8_3:58736462-58736481	Msa1298100:CDS	45.0%
	AACTTACAGCAAACCTCAGG+AGG	-	chr8_3:58736501-58736520	None:intergenic	45.0%
	CAGAACTTACAGCAAACCTC+AGG	-	chr8_3:58736504-58736523	None:intergenic	45.0%
	ACTCTCTCACTTGACAGTCA+AGG	+	chr8_3:58736880-58736899	Msa1298100:intron	45.0%
	CTATATCAGTACCATCGGAG+TGG	+	chr8_3:58737013-58737032	Msa1298100:CDS	45.0%
!	TCGGCTCAATTATCTGGGAT+TGG	+	chr8_3:58737549-58737568	Msa1298100:intron	45.0%
!	ATTGTATAGTGGGACACTGC+TGG	+	chr8_3:58737620-58737639	Msa1298100:intron	45.0%
	AACTAGCAGCTACTATCGTG+GGG	+	chr8_3:58737664-58737683	Msa1298100:CDS	45.0%
	TGGAAACAAGAGCGATCTCT+CGG	+	chr8_3:58737896-58737915	Msa1298100:CDS	45.0%
!!	TGTGTCCTCTGAAACAGCAA+AGG	+	chr8_3:58737929-58737948	Msa1298100:CDS	45.0%
	GGAAGTGGGACATGTATATG+GGG	-	chr8_3:58737979-58737998	None:intergenic	45.0%
	CTGGAAGTGGGACATGTATA+TGG	-	chr8_3:58737981-58738000	None:intergenic	45.0%
!	GAAAGCTTGTTCCACATTGG+AGG	-	chr8_3:58738120-58738139	None:intergenic	45.0%
	TAACCTCATTTACTCGTCGC+CGG	+	chr8_3:58738274-58738293	Msa1298100:intron	45.0%
!	TCACTGGTTGTCCTCGAATT+TGG	-	chr8_3:58738356-58738375	None:intergenic	45.0%
	AGAAGTTCCATGTGTCTCTG+TGG	+	chr8_3:58738426-58738445	Msa1298100:three_prime_UTR	45.0%
	TTACATGCCACAGAGACACA+TGG	-	chr8_3:58738436-58738455	None:intergenic	45.0%
	GAGACGTATGCCAACCACTT+CGG	-	chr8_3:58734693-58734712	None:intergenic	50.0%
	TACGCATCAAGAAGGGAGTG+GGG	-	chr8_3:58734715-58734734	None:intergenic	50.0%
!	CGGAGGTATACGCATCAAGA+AGG	-	chr8_3:58734723-58734742	None:intergenic	50.0%
	AAGAAGGGTTTGGCAGCGAA+GGG	-	chr8_3:58734845-58734864	None:intergenic	50.0%
	AAGGGATCGGAAGAAGGGTT+TGG	-	chr8_3:58734855-58734874	None:intergenic	50.0%
	TCGGAAAGGGATCGGAAGAA+GGG	-	chr8_3:58734860-58734879	None:intergenic	50.0%
	ATCGGAAAGGGATCGGAAGA+AGG	-	chr8_3:58734861-58734880	None:intergenic	50.0%
	GGTGAGAGGTTGAATCGGAA+AGG	-	chr8_3:58734874-58734893	None:intergenic	50.0%
	TCAGGATTCATGACGGTGAG+AGG	-	chr8_3:58734888-58734907	None:intergenic	50.0%
!!	GCGCATTCGTTGTTTTGCGA+TGG	+	chr8_3:58735042-58735061	Msa1298100:intron	50.0%
	AGATCCCCTTATACCAACCG+TGG	-	chr8_3:58735548-58735567	None:intergenic	50.0%
	TGGTTGCTTAACCAATGCCC+CGG	-	chr8_3:58736098-58736117	None:intergenic	50.0%
	GATTGCTTAACTAGTGCCCC+GGG	+	chr8_3:58736207-58736226	Msa1298100:intron	50.0%
	ATTGCTTAACTAGTGCCCCG+GGG	+	chr8_3:58736208-58736227	Msa1298100:intron	50.0%
	TCTTGTTAACCAATGCCCCC+GGG	-	chr8_3:58736227-58736246	None:intergenic	50.0%
!	GTCTTGTTAACCAATGCCCC+CGG	-	chr8_3:58736228-58736247	None:intergenic	50.0%
	GCTTACAAAGTCCACTCCGA+TGG	-	chr8_3:58737027-58737046	None:intergenic	50.0%
	GAAAATCCGCACTGTTGAGC+AGG	+	chr8_3:58737131-58737150	Msa1298100:intron	50.0%
	CTGCTGGTCAAGAACGTTTC+CGG	+	chr8_3:58737636-58737655	Msa1298100:CDS	50.0%
	GGAAATTGCTGACAAAGGGC+CGG	-	chr8_3:58737719-58737738	None:intergenic	50.0%
	GGAACAAGCTTTCATGGCCA+TGG	+	chr8_3:58738127-58738146	Msa1298100:CDS	50.0%
	AATTTGGACTGTTGCAGGCC+TGG	-	chr8_3:58738340-58738359	None:intergenic	50.0%
	CCTCGAATTTGGACTGTTGC+AGG	-	chr8_3:58738345-58738364	None:intergenic	50.0%
	CCTGCAACAGTCCAAATTCG+AGG	+	chr8_3:58738342-58738361	Msa1298100:CDS	50.0%
	AGGACAACCAGTGAACCAGA+AGG	+	chr8_3:58738362-58738381	Msa1298100:CDS	50.0%
!	TGTGTTTGGGGCAACGAACA+AGG	-	chr8_3:58738612-58738631	None:intergenic	50.0%
!!	AATGACTCGCTTGGTGTCGG+AGG	-	chr8_3:58734740-58734759	None:intergenic	55.0%
	TTGGCAGCGAAGGGAGTTAC+CGG	-	chr8_3:58734836-58734855	None:intergenic	55.0%
	GAAGAAGGGTTTGGCAGCGA+AGG	-	chr8_3:58734846-58734865	None:intergenic	55.0%
!	GTAATCACGTGTGCCGGTGT+CGG	+	chr8_3:58735406-58735425	Msa1298100:intron	55.0%
	GTCTGGTGTCCTACACATGC+CGG	-	chr8_3:58735435-58735454	None:intergenic	55.0%
	AGAATGTTAACCCGTGCCCC+CGG	+	chr8_3:58736076-58736095	Msa1298100:intron	55.0%
	TTGCTTAACCAATGCCCCGG+GGG	-	chr8_3:58736095-58736114	None:intergenic	55.0%
	GTTGCTTAACCAATGCCCCG+GGG	-	chr8_3:58736096-58736115	None:intergenic	55.0%
	GGTTGCTTAACCAATGCCCC+GGG	-	chr8_3:58736097-58736116	None:intergenic	55.0%
	TTGCTTAACTAGTGCCCCGG+GGG	+	chr8_3:58736209-58736228	Msa1298100:intron	55.0%
	CTTGTTAACCAATGCCCCCG+GGG	-	chr8_3:58736226-58736245	None:intergenic	55.0%
	GCAAGTCATGTCTCCTCCTG+AGG	+	chr8_3:58736485-58736504	Msa1298100:CDS	55.0%
	ATCCGCACTGTTGAGCAGGA+TGG	+	chr8_3:58737135-58737154	Msa1298100:CDS	55.0%
	TCCGCACTGTTGAGCAGGAT+GGG	+	chr8_3:58737136-58737155	Msa1298100:CDS	55.0%
	TCCCATCCTGCTCAACAGTG+CGG	-	chr8_3:58737140-58737159	None:intergenic	55.0%
	AGCTACTATCGTGGGGCTCA+TGG	+	chr8_3:58737671-58737690	Msa1298100:CDS	55.0%
!	GTACCGGCGACGAGTAAATG+AGG	-	chr8_3:58738280-58738299	None:intergenic	55.0%
	CAACCAGTGAACCAGAAGGC+TGG	+	chr8_3:58738366-58738385	Msa1298100:CDS	55.0%
!!	CAACCAGCCTTCTGGTTCAC+TGG	-	chr8_3:58738372-58738391	None:intergenic	55.0%
	TGTCGGACACCGGCATGTGT+AGG	+	chr8_3:58735423-58735442	Msa1298100:intron	60.0%
	GAATGTTAACCCGTGCCCCC+GGG	+	chr8_3:58736077-58736096	Msa1298100:intron	60.0%
	AATGTTAACCCGTGCCCCCG+GGG	+	chr8_3:58736078-58736097	Msa1298100:intron	60.0%
	GTCAACCTGCCAACAGTGCC+AGG	+	chr8_3:58738319-58738338	Msa1298100:CDS	60.0%
	TGTTGCAGGCCTGGCACTGT+TGG	-	chr8_3:58738331-58738350	None:intergenic	60.0%
	ACGAGCAGCAACCAGCCTTC+TGG	-	chr8_3:58738380-58738399	None:intergenic	60.0%
	CGAAGGGAGTTACCGGTCGC+CGG	-	chr8_3:58734829-58734848	None:intergenic	65.0%
	CACATGCCGGTGTCCGACAC+CGG	-	chr8_3:58735422-58735441	None:intergenic	65.0%
	TAACCAATGCCCCGGGGGCA+CGG	-	chr8_3:58736090-58736109	None:intergenic	65.0%
!	AACTAGTGCCCCGGGGGCAT+TGG	+	chr8_3:58736215-58736234	Msa1298100:intron	65.0%
!	CGTGTGCCGGTGTCGGACAC+CGG	+	chr8_3:58735413-58735432	Msa1298100:intron	70.0%
!	AACCAATGCCCCGGGGGCAC+GGG	-	chr8_3:58736089-58736108	None:intergenic	70.0%
	GCAGGCCTGGCACTGTTGGC+AGG	-	chr8_3:58738327-58738346	None:intergenic	70.0%
	AACCCGTGCCCCCGGGGCAT+TGG	+	chr8_3:58736084-58736103	Msa1298100:intron	75.0%

Chromosome	Type	Strat	End	Strand	Name
chr8_3	gene	58734684	58738755	58734684	ID=Msa1298100;Name=Msa1298100
chr8_3	mRNA	58734684	58738755	58734684	ID=Msa1298100-mRNA-1;Parent=Msa1298100;Name=Msa1298100-mRNA-1;_AED=0.10;_eAED=0.10;_QI=213\|1\|1\|1\|1\|1\|8\|351\|202
chr8_3	exon	58734684	58734910	58734684	ID=Msa1298100-mRNA-1:exon:16862;Parent=Msa1298100-mRNA-1
chr8_3	exon	58736441	58736513	58736441	ID=Msa1298100-mRNA-1:exon:16863;Parent=Msa1298100-mRNA-1
chr8_3	exon	58736993	58737040	58736993	ID=Msa1298100-mRNA-1:exon:16864;Parent=Msa1298100-mRNA-1
chr8_3	exon	58737132	58737179	58737132	ID=Msa1298100-mRNA-1:exon:16865;Parent=Msa1298100-mRNA-1
chr8_3	exon	58737629	58737700	58737629	ID=Msa1298100-mRNA-1:exon:16866;Parent=Msa1298100-mRNA-1
chr8_3	exon	58737795	58737950	58737795	ID=Msa1298100-mRNA-1:exon:16867;Parent=Msa1298100-mRNA-1
chr8_3	exon	58738065	58738168	58738065	ID=Msa1298100-mRNA-1:exon:16868;Parent=Msa1298100-mRNA-1
chr8_3	exon	58738311	58738755	58738311	ID=Msa1298100-mRNA-1:exon:16869;Parent=Msa1298100-mRNA-1
chr8_3	five_prime_UTR	58734684	58734896	58734684	ID=Msa1298100-mRNA-1:five_prime_utr;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58734897	58734910	58734897	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58736441	58736513	58736441	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58736993	58737040	58736993	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58737132	58737179	58737132	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58737629	58737700	58737629	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58737795	58737950	58737795	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58738065	58738168	58738065	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	CDS	58738311	58738404	58738311	ID=Msa1298100-mRNA-1:cds;Parent=Msa1298100-mRNA-1
chr8_3	three_prime_UTR	58738405	58738755	58738405	ID=Msa1298100-mRNA-1:three_prime_utr;Parent=Msa1298100-mRNA-1

Gene Sequence

>Msa1298100

ATGAATCCTGAATATGACTATTTGTTCAAGCTTTTGTTGATTGGAGATTCTGGTGTGGGCAAGTCATGTCTCCTCCTGAGGTTTGCTGATGATTCATACCTTGACAGCTATATCAGTACCATCGGAGTGGACTTTAAAATCCGCACTGTTGAGCAGGATGGGAAGACCATTAAACTTCAAATTTGGGACACTGCTGGTCAAGAACGTTTCCGGACTATAACTAGCAGCTACTATCGTGGGGCTCATGGCATAATTGTTGTTTACGATGTCACTGACCAAGAGAGCTTTAACAATGTTAAGCAGTGGCTGAATGAAATTGACCGCTATGCAAGTGAAAATGTTAACAAGCTTCTAGTTGGAAACAAGAGCGATCTCTCGGACAAAAAAGTTGTGTCCTCTGAAACAGCAAAGGCATTTGCAGATGAAATTGGAATTCCTTTCATGGAAACTAGTGCTAAAAATGCCTCCAATGTGGAACAAGCTTTCATGGCCATGGCTGCTGAAATTAAAAACAGAATGGCGAGTCAACCTGCCAACAGTGCCAGGCCTGCAACAGTCCAAATTCGAGGACAACCAGTGAACCAGAAGGCTGGTTGCTGCTCGTCTTAG

Protein sequence

>Msa1298100

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKSDLSDKKVVSSETAKAFADEIGIPFMETSAKNASNVEQAFMAMAAEIKNRMASQPANSARPATVQIRGQPVNQKAGCCSS*