AlfalfaGEDB | Msa0535040

M. sativa cultivar zhongmu-4 / Msa0535040

KEGG: -
GO: GO:0007275 GO:0008150 GO:0032501 GO:0032502 GO:0042335 GO:0048856
PFAM: PF00657.25

Nr:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0535040	XP_013454939.1	98.378	370	6	0	1	370	1	370	0.0	752

Swissprot:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0535040	sp\|Q8LB81\|GDL79_ARATH	70.225	356	104	1	15	370	13	366	0.0	537

Trembl:

Query id	Subject id	identity %	alignment length	mis matches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0535040	A0A072UH37	98.378	370	6	0	1	370	1	370	0.0	752

TFs/TRs:

Gene ID	Type	Classification

Protein Kinases:

Gene ID	Type	Classification

Network:

Co-expression Network

Gene1	Gene2	correlation coefficient	p_value	FDR
Msa0000190	Msa0535040	0.837921	3.906677e-57	-8.615850e-47
Msa0002930	Msa0535040	0.832285	1.031715e-55	-8.615850e-47
Msa0006980	Msa0535040	0.802396	5.721772e-49	-8.615850e-47
Msa0007480	Msa0535040	0.804079	2.566145e-49	-8.615850e-47
Msa0015710	Msa0535040	0.810723	1.000478e-50	-8.615850e-47
Msa0016120	Msa0535040	0.842159	3.065278e-58	-8.615850e-47
Msa0017510	Msa0535040	0.872690	2.620223e-67	-8.615850e-47
Msa0019600	Msa0535040	0.855485	6.113051e-62	-8.615850e-47
Msa0024550	Msa0535040	0.828479	8.789696e-55	-8.615850e-47
Msa0028420	Msa0535040	0.835829	1.335911e-56	-8.615850e-47
Msa0028640	Msa0535040	0.805472	1.313223e-49	-8.615850e-47
Msa0034270	Msa0535040	0.825744	3.965748e-54	-8.615850e-47
Msa0036430	Msa0535040	0.828720	7.683546e-55	-8.615850e-47
Msa0036830	Msa0535040	0.809971	1.453583e-50	-8.615850e-47
Msa0040450	Msa0535040	0.808885	2.485756e-50	-8.615850e-47
Msa0042610	Msa0535040	0.802946	4.406847e-49	-8.615850e-47
Msa0046100	Msa0535040	0.806181	9.320200e-50	-8.615850e-47
Msa0050040	Msa0535040	0.823268	1.518100e-53	-8.615850e-47
Msa0055450	Msa0535040	0.804571	2.026838e-49	-8.615850e-47
Msa0074240	Msa0535040	0.809567	1.775052e-50	-8.615850e-47
Msa0076010	Msa0535040	0.800143	1.655084e-48	-8.615850e-47
Msa0076250	Msa0535040	0.838661	2.518610e-57	-8.615850e-47
Msa0084500	Msa0535040	0.834334	3.182080e-56	-8.615850e-47
Msa0089630	Msa0535040	0.842089	3.198962e-58	-8.615850e-47
Msa0092790	Msa0535040	0.818940	1.507875e-52	-8.615850e-47
Msa0094140	Msa0535040	0.818313	2.092084e-52	-8.615850e-47
Msa0094850	Msa0535040	0.814658	1.377179e-51	-8.615850e-47
Msa0102990	Msa0535040	0.823763	1.162656e-53	-8.615850e-47
Msa0104500	Msa0535040	0.806862	6.692226e-50	-8.615850e-47
Msa0106790	Msa0535040	0.809274	2.052140e-50	-8.615850e-47
Msa0109880	Msa0535040	0.825864	3.715590e-54	-8.615850e-47
Msa0110970	Msa0535040	0.867333	1.478271e-65	-8.615850e-47
Msa0111750	Msa0535040	0.810726	9.987007e-51	-8.615850e-47
Msa0112570	Msa0535040	0.810215	1.287791e-50	-8.615850e-47
Msa0114540	Msa0535040	-0.806178	9.332656e-50	-8.615850e-47
Msa0118570	Msa0535040	0.807037	6.146339e-50	-8.615850e-47
Msa0120400	Msa0535040	0.823181	1.590235e-53	-8.615850e-47
Msa0124060	Msa0535040	0.826519	2.595032e-54	-8.615850e-47
Msa0124130	Msa0535040	0.824439	8.069245e-54	-8.615850e-47
Msa0124280	Msa0535040	0.816925	4.301778e-52	-8.615850e-47
Msa0130570	Msa0535040	0.835465	1.652158e-56	-8.615850e-47
Msa0131900	Msa0535040	0.814338	1.620953e-51	-8.615850e-47
Msa0140780	Msa0535040	0.809740	1.629849e-50	-8.615850e-47
Msa0141120	Msa0535040	0.822034	2.939658e-53	-8.615850e-47
Msa0146260	Msa0535040	0.809614	1.734296e-50	-8.615850e-47
Msa0147560	Msa0535040	0.810463	1.138495e-50	-8.615850e-47
Msa0149140	Msa0535040	0.828611	8.165088e-55	-8.615850e-47
Msa0152500	Msa0535040	0.806777	6.975493e-50	-8.615850e-47
Msa0153420	Msa0535040	0.818905	1.536080e-52	-8.615850e-47
Msa0156250	Msa0535040	0.835594	1.532496e-56	-8.615850e-47
Msa0157290	Msa0535040	0.873134	1.860525e-67	-8.615850e-47
Msa0158600	Msa0535040	0.804355	2.248333e-49	-8.615850e-47
Msa0164330	Msa0535040	0.808889	2.480957e-50	-8.615850e-47
Msa0166560	Msa0535040	0.833433	5.349095e-56	-8.615850e-47
Msa0168500	Msa0535040	0.838244	3.226892e-57	-8.615850e-47
Msa0168650	Msa0535040	0.800506	1.395648e-48	-8.615850e-47
Msa0169860	Msa0535040	0.814021	1.904139e-51	-8.615850e-47
Msa0173660	Msa0535040	0.806163	9.401488e-50	-8.615850e-47
Msa0176470	Msa0535040	0.818694	1.715230e-52	-8.615850e-47
Msa0185490	Msa0535040	0.858769	6.561880e-63	-8.615850e-47
Msa0193890	Msa0535040	0.803108	4.080300e-49	-8.615850e-47
Msa0194380	Msa0535040	0.816503	5.348144e-52	-8.615850e-47
Msa0197100	Msa0535040	0.812577	3.952970e-51	-8.615850e-47
Msa0197230	Msa0535040	0.808919	2.444020e-50	-8.615850e-47
Msa0197420	Msa0535040	0.829258	5.691949e-55	-8.615850e-47
Msa0197660	Msa0535040	0.814993	1.160778e-51	-8.615850e-47
Msa0197930	Msa0535040	0.860826	1.575427e-63	-8.615850e-47
Msa0200260	Msa0535040	0.815273	1.006015e-51	-8.615850e-47
Msa0203010	Msa0535040	0.835758	1.392900e-56	-8.615850e-47
Msa0203020	Msa0535040	0.807598	4.675196e-50	-8.615850e-47
Msa0203030	Msa0535040	0.905518	3.942957e-80	-8.615850e-47
Msa0205840	Msa0535040	0.802815	4.691055e-49	-8.615850e-47
Msa0212080	Msa0535040	0.817261	3.613926e-52	-8.615850e-47
Msa0212150	Msa0535040	0.810170	1.316737e-50	-8.615850e-47
Msa0218780	Msa0535040	0.832628	8.481792e-56	-8.615850e-47
Msa0219190	Msa0535040	0.868813	4.940916e-66	-8.615850e-47
Msa0221290	Msa0535040	0.840187	1.011483e-57	-8.615850e-47
Msa0225760	Msa0535040	0.818869	1.565178e-52	-8.615850e-47
Msa0230740	Msa0535040	0.840690	7.468663e-58	-8.615850e-47
Msa0230750	Msa0535040	0.846481	2.114169e-59	-8.615850e-47
Msa0369170	Msa0535040	0.821527	3.849930e-53	-8.615850e-47
Msa0370030	Msa0535040	0.817526	3.150433e-52	-8.615850e-47
Msa0373960	Msa0535040	0.814217	1.724238e-51	-8.615850e-47
Msa0375680	Msa0535040	0.800542	1.372700e-48	-8.615850e-47
Msa0378500	Msa0535040	0.816139	6.449701e-52	-8.615850e-47
Msa0385390	Msa0535040	0.864274	1.367746e-64	-8.615850e-47
Msa0387510	Msa0535040	0.814397	1.573232e-51	-8.615850e-47
Msa0392420	Msa0535040	0.890808	7.045127e-74	-8.615850e-47
Msa0392460	Msa0535040	0.887271	1.652386e-72	-8.615850e-47
Msa0392490	Msa0535040	0.890104	1.331305e-73	-8.615850e-47
Msa0392510	Msa0535040	0.810275	1.249988e-50	-8.615850e-47
Msa0395790	Msa0535040	0.807639	4.582789e-50	-8.615850e-47
Msa0406000	Msa0535040	0.867361	1.448272e-65	-8.615850e-47
Msa0407920	Msa0535040	0.814872	1.234777e-51	-8.615850e-47
Msa0410500	Msa0535040	0.802100	6.586121e-49	-8.615850e-47
Msa0410650	Msa0535040	0.807803	4.228393e-50	-8.615850e-47
Msa0415320	Msa0535040	0.856021	4.264259e-62	-8.615850e-47
Msa0416590	Msa0535040	0.817268	3.601037e-52	-8.615850e-47
Msa0417440	Msa0535040	0.809754	1.618581e-50	-8.615850e-47
Msa0417880	Msa0535040	0.812032	5.198789e-51	-8.615850e-47
Msa0419820	Msa0535040	0.813618	2.336388e-51	-8.615850e-47
Msa0422850	Msa0535040	0.826764	2.267491e-54	-8.615850e-47
Msa0422930	Msa0535040	0.827904	1.208915e-54	-8.615850e-47
Msa0423100	Msa0535040	0.819992	8.676505e-53	-8.615850e-47
Msa0424330	Msa0535040	0.834413	3.040962e-56	-8.615850e-47
Msa0424340	Msa0535040	0.824238	8.993454e-54	-8.615850e-47
Msa0424350	Msa0535040	0.841488	4.611015e-58	-8.615850e-47
Msa0436500	Msa0535040	0.828060	1.109100e-54	-8.615850e-47
Msa0440500	Msa0535040	0.809379	1.948577e-50	-8.615850e-47
Msa0441590	Msa0535040	0.813088	3.054464e-51	-8.615850e-47
Msa0443310	Msa0535040	0.811496	6.799084e-51	-8.615850e-47
Msa0450440	Msa0535040	0.819234	1.292796e-52	-8.615850e-47
Msa0450720	Msa0535040	0.802323	5.925049e-49	-8.615850e-47
Msa0451400	Msa0535040	0.898843	3.565625e-77	-8.615850e-47
Msa0461720	Msa0535040	0.829994	3.769841e-55	-8.615850e-47
Msa0467430	Msa0535040	0.813902	2.023474e-51	-8.615850e-47
Msa0469260	Msa0535040	0.827055	1.931999e-54	-8.615850e-47
Msa0475790	Msa0535040	0.813421	2.581149e-51	-8.615850e-47
Msa0479540	Msa0535040	0.838657	2.525029e-57	-8.615850e-47
Msa0480980	Msa0535040	0.815216	1.035937e-51	-8.615850e-47
Msa0238890	Msa0535040	0.811280	7.577701e-51	-8.615850e-47
Msa0239030	Msa0535040	0.828343	9.475226e-55	-8.615850e-47
Msa0239190	Msa0535040	0.813565	2.400197e-51	-8.615850e-47
Msa0239570	Msa0535040	0.844111	9.255941e-59	-8.615850e-47
Msa0239800	Msa0535040	0.811288	7.546922e-51	-8.615850e-47
Msa0243100	Msa0535040	0.825576	4.347077e-54	-8.615850e-47
Msa0244860	Msa0535040	0.800695	1.277347e-48	-8.615850e-47
Msa0248970	Msa0535040	0.815223	1.031916e-51	-8.615850e-47
Msa0252630	Msa0535040	0.811946	5.429059e-51	-8.615850e-47
Msa0252770	Msa0535040	0.816865	4.436511e-52	-8.615850e-47
Msa0258330	Msa0535040	0.800513	1.391413e-48	-8.615850e-47
Msa0260610	Msa0535040	0.806525	7.884646e-50	-8.615850e-47
Msa0260670	Msa0535040	0.811716	6.090604e-51	-8.615850e-47
Msa0261340	Msa0535040	0.846411	2.209144e-59	-8.615850e-47
Msa0264150	Msa0535040	0.805296	1.429223e-49	-8.615850e-47
Msa0272660	Msa0535040	0.807750	4.340277e-50	-8.615850e-47
Msa0276740	Msa0535040	0.823882	1.090563e-53	-8.615850e-47
Msa0277180	Msa0535040	0.818369	2.031651e-52	-8.615850e-47
Msa0284420	Msa0535040	0.808713	2.704989e-50	-8.615850e-47
Msa0287650	Msa0535040	0.831511	1.601720e-55	-8.615850e-47
Msa0289890	Msa0535040	0.801775	7.680933e-49	-8.615850e-47
Msa0291330	Msa0535040	0.802711	4.927837e-49	-8.615850e-47
Msa0292400	Msa0535040	0.822195	2.697296e-53	-8.615850e-47
Msa0297740	Msa0535040	0.832722	8.037751e-56	-8.615850e-47
Msa0298240	Msa0535040	0.859143	5.069479e-63	-8.615850e-47
Msa0300270	Msa0535040	0.800483	1.411409e-48	-8.615850e-47
Msa0300690	Msa0535040	0.805151	1.533130e-49	-8.615850e-47
Msa0302160	Msa0535040	0.802265	6.090093e-49	-8.615850e-47
Msa0302170	Msa0535040	0.816881	4.399298e-52	-8.615850e-47
Msa0306120	Msa0535040	0.836274	1.029974e-56	-8.615850e-47
Msa0306300	Msa0535040	0.837669	4.535560e-57	-8.615850e-47
Msa0308830	Msa0535040	0.822203	2.685161e-53	-8.615850e-47
Msa0314630	Msa0535040	0.807828	4.177145e-50	-8.615850e-47
Msa0316680	Msa0535040	0.821985	3.017983e-53	-8.615850e-47
Msa0316810	Msa0535040	0.834674	2.614878e-56	-8.615850e-47
Msa0317280	Msa0535040	0.849693	2.744479e-60	-8.615850e-47
Msa0317340	Msa0535040	0.823491	1.346156e-53	-8.615850e-47
Msa0317510	Msa0535040	0.820195	7.797709e-53	-8.615850e-47
Msa0322830	Msa0535040	0.830015	3.726187e-55	-8.615850e-47
Msa0322840	Msa0535040	0.830702	2.531251e-55	-8.615850e-47
Msa0322860	Msa0535040	0.842453	2.562364e-58	-8.615850e-47
Msa0323610	Msa0535040	0.826353	2.842487e-54	-8.615850e-47
Msa0329620	Msa0535040	0.829255	5.701521e-55	-8.615850e-47
Msa0332000	Msa0535040	0.801485	8.808546e-49	-8.615850e-47
Msa0335780	Msa0535040	0.809453	1.878545e-50	-8.615850e-47
Msa0339490	Msa0535040	0.807457	5.008783e-50	-8.615850e-47
Msa0339500	Msa0535040	0.811449	6.962297e-51	-8.615850e-47
Msa0344570	Msa0535040	0.877937	4.209476e-69	-8.615850e-47
Msa0345330	Msa0535040	0.847790	9.251429e-60	-8.615850e-47
Msa0345410	Msa0535040	0.844687	6.478972e-59	-8.615850e-47
Msa0348880	Msa0535040	0.813259	2.802326e-51	-8.615850e-47
Msa0351770	Msa0535040	0.834189	3.460413e-56	-8.615850e-47
Msa0359250	Msa0535040	0.884296	2.163741e-71	-8.615850e-47
Msa0362780	Msa0535040	0.807889	4.054636e-50	-8.615850e-47
Msa0363070	Msa0535040	0.815093	1.103208e-51	-8.615850e-47
Msa0363200	Msa0535040	0.819699	1.012531e-52	-8.615850e-47
Msa0487570	Msa0535040	0.895376	1.016890e-75	-8.615850e-47
Msa0487630	Msa0535040	0.891840	2.750126e-74	-8.615850e-47
Msa0492190	Msa0535040	0.873747	1.157391e-67	-8.615850e-47
Msa0498060	Msa0535040	0.810920	9.069349e-51	-8.615850e-47
Msa0503580	Msa0535040	0.816555	5.205625e-52	-8.615850e-47
Msa0507680	Msa0535040	0.803211	3.884355e-49	-8.615850e-47
Msa0509610	Msa0535040	0.801067	1.072603e-48	-8.615850e-47
Msa0509790	Msa0535040	0.810095	1.366911e-50	-8.615850e-47
Msa0510980	Msa0535040	0.815049	1.128231e-51	-8.615850e-47
Msa0513160	Msa0535040	0.809302	2.024000e-50	-8.615850e-47
Msa0515950	Msa0535040	0.834583	2.756556e-56	-8.615850e-47
Msa0520510	Msa0535040	0.803619	3.197661e-49	-8.615850e-47
Msa0523000	Msa0535040	0.843533	1.321757e-58	-8.615850e-47
Msa0523460	Msa0535040	0.804779	1.833996e-49	-8.615850e-47
Msa0527550	Msa0535040	0.840812	6.938560e-58	-8.615850e-47
Msa0527860	Msa0535040	0.819010	1.453416e-52	-8.615850e-47
Msa0534930	Msa0535040	0.948033	2.100604e-106	-8.615850e-47
Msa0535040	Msa0537920	0.829834	4.123476e-55	-8.615850e-47
Msa0535040	Msa0538060	0.812236	4.692737e-51	-8.615850e-47
Msa0535040	Msa0538220	0.835294	1.824106e-56	-8.615850e-47
Msa0535040	Msa0545340	0.805433	1.337911e-49	-8.615850e-47
Msa0535040	Msa0546680	0.801513	8.691631e-49	-8.615850e-47
Msa0535040	Msa0560070	0.818970	1.484102e-52	-8.615850e-47
Msa0535040	Msa0571140	0.805683	1.185809e-49	-8.615850e-47
Msa0535040	Msa0574890	0.835148	1.985767e-56	-8.615850e-47
Msa0535040	Msa0575740	0.826285	2.950253e-54	-8.615850e-47
Msa0535040	Msa0581760	0.810314	1.225787e-50	-8.615850e-47
Msa0535040	Msa0582450	0.827117	1.867486e-54	-8.615850e-47
Msa0535040	Msa0586190	0.826618	2.456948e-54	-8.615850e-47
Msa0535040	Msa0588140	0.804937	1.699584e-49	-8.615850e-47
Msa0535040	Msa0591790	0.925955	9.079476e-91	-8.615850e-47
Msa0535040	Msa0594090	0.852903	3.401374e-61	-8.615850e-47
Msa0535040	Msa0597790	0.815512	8.898307e-52	-8.615850e-47
Msa0535040	Msa0602240	0.816528	5.278212e-52	-8.615850e-47
Msa0535040	Msa0602250	0.821698	3.516066e-53	-8.615850e-47
Msa0535040	Msa0621010	0.816405	5.625610e-52	-8.615850e-47
Msa0535040	Msa0625890	0.825818	3.809354e-54	-8.615850e-47
Msa0535040	Msa0626510	0.809829	1.559298e-50	-8.615850e-47
Msa0535040	Msa0637560	0.813513	2.463757e-51	-8.615850e-47
Msa0535040	Msa0637580	0.810575	1.076929e-50	-8.615850e-47
Msa0535040	Msa0641250	0.838182	3.347567e-57	-8.615850e-47
Msa0535040	Msa0641360	0.817622	2.997059e-52	-8.615850e-47
Msa0535040	Msa0643080	0.804792	1.822669e-49	-8.615850e-47
Msa0535040	Msa0643300	0.810327	1.218209e-50	-8.615850e-47
Msa0535040	Msa0650020	0.803255	3.803598e-49	-8.615850e-47
Msa0535040	Msa0657970	0.818186	2.234896e-52	-8.615850e-47
Msa0535040	Msa0662240	0.805789	1.126600e-49	-8.615850e-47
Msa0535040	Msa0663300	0.816621	5.032935e-52	-8.615850e-47
Msa0535040	Msa0663590	0.801368	9.307534e-49	-8.615850e-47
Msa0535040	Msa0663680	0.818802	1.620829e-52	-8.615850e-47
Msa0535040	Msa0664060	0.819427	1.168416e-52	-8.615850e-47
Msa0535040	Msa0669840	0.889106	3.258856e-73	-8.615850e-47
Msa0535040	Msa0677410	0.807186	5.716093e-50	-8.615850e-47
Msa0535040	Msa0680150	0.804349	2.254458e-49	-8.615850e-47
Msa0535040	Msa0682330	0.813474	2.512866e-51	-8.615850e-47
Msa0535040	Msa0682620	0.824767	6.754215e-54	-8.615850e-47
Msa0535040	Msa0683510	0.805818	1.110788e-49	-8.615850e-47
Msa0535040	Msa0683570	0.828219	1.015054e-54	-8.615850e-47
Msa0535040	Msa0688500	0.820252	7.565101e-53	-8.615850e-47
Msa0535040	Msa0688770	0.826076	3.308705e-54	-8.615850e-47
Msa0535040	Msa0707220	0.844585	6.901624e-59	-8.615850e-47
Msa0535040	Msa0708520	0.810219	1.284961e-50	-8.615850e-47
Msa0535040	Msa0720040	0.817990	2.475045e-52	-8.615850e-47
Msa0535040	Msa0720820	0.800465	1.422851e-48	-8.615850e-47
Msa0535040	Msa0722780	0.819066	1.411883e-52	-8.615850e-47
Msa0535040	Msa0722850	0.814939	1.193155e-51	-8.615850e-47
Msa0535040	Msa0723000	0.811084	8.355255e-51	-8.615850e-47
Msa0535040	Msa0723050	0.814942	1.191178e-51	-8.615850e-47
Msa0535040	Msa0737190	0.816137	6.457377e-52	-8.615850e-47
Msa0535040	Msa0738040	0.802652	5.068944e-49	-8.615850e-47
Msa0535040	Msa0739580	0.833804	4.322060e-56	-8.615850e-47
Msa0535040	Msa0739730	0.819708	1.007889e-52	-8.615850e-47
Msa0535040	Msa0740640	0.800406	1.463183e-48	-8.615850e-47
Msa0535040	Msa0741900	0.819910	9.060794e-53	-8.615850e-47
Msa0535040	Msa0742180	0.819254	1.279123e-52	-8.615850e-47
Msa0535040	Msa0747780	0.800569	1.355406e-48	-8.615850e-47
Msa0535040	Msa0754230	0.800879	1.171551e-48	-8.615850e-47
Msa0535040	Msa0761580	0.814296	1.656301e-51	-8.615850e-47
Msa0535040	Msa0764820	0.820072	8.321060e-53	-8.615850e-47
Msa0535040	Msa0769180	0.809509	1.826573e-50	-8.615850e-47
Msa0535040	Msa0770290	0.802014	6.860114e-49	-8.615850e-47
Msa0535040	Msa0778930	0.811186	7.941207e-51	-8.615850e-47
Msa0535040	Msa0782360	0.833613	4.822645e-56	-8.615850e-47
Msa0535040	Msa0785210	0.816398	5.644130e-52	-8.615850e-47
Msa0535040	Msa0785250	0.801321	9.515002e-49	-8.615850e-47
Msa0535040	Msa0786040	0.817148	3.832020e-52	-8.615850e-47
Msa0535040	Msa0798430	0.808763	2.639598e-50	-8.615850e-47
Msa0535040	Msa0803890	0.800851	1.187012e-48	-8.615850e-47
Msa0535040	Msa0816150	0.805995	1.019689e-49	-8.615850e-47
Msa0535040	Msa0823400	0.848019	7.999514e-60	-8.615850e-47
Msa0535040	Msa0828560	0.839195	1.832446e-57	-8.615850e-47
Msa0535040	Msa0828830	0.835823	1.340775e-56	-8.615850e-47
Msa0535040	Msa0833220	0.810146	1.332497e-50	-8.615850e-47
Msa0535040	Msa0840500	0.806912	6.533143e-50	-8.615850e-47
Msa0535040	Msa0843220	0.842666	2.249625e-58	-8.615850e-47
Msa0535040	Msa0844560	0.861508	9.769990e-64	-8.615850e-47
Msa0535040	Msa0849280	0.828939	6.802618e-55	-8.615850e-47
Msa0535040	Msa0851020	0.826297	2.931670e-54	-8.615850e-47
Msa0535040	Msa0853660	0.813357	2.666157e-51	-8.615850e-47
Msa0535040	Msa0857640	0.808258	3.383844e-50	-8.615850e-47
Msa0535040	Msa0860280	0.842556	2.405808e-58	-8.615850e-47
Msa0535040	Msa0861510	0.810481	1.128538e-50	-8.615850e-47
Msa0535040	Msa0861600	0.807637	4.586031e-50	-8.615850e-47
Msa0535040	Msa0862100	0.810671	1.026396e-50	-8.615850e-47
Msa0535040	Msa0867350	0.855158	7.611927e-62	-8.615850e-47
Msa0535040	Msa0872310	0.812117	4.982758e-51	-8.615850e-47
Msa0535040	Msa0876560	0.821689	3.532720e-53	-8.615850e-47
Msa0535040	Msa0880140	0.870999	9.544897e-67	-8.615850e-47
Msa0535040	Msa0885060	0.817591	3.046171e-52	-8.615850e-47
Msa0535040	Msa0896350	0.803222	3.863534e-49	-8.615850e-47
Msa0535040	Msa0896540	0.851316	9.609901e-61	-8.615850e-47
Msa0535040	Msa0896750	0.806285	8.859919e-50	-8.615850e-47
Msa0535040	Msa0896970	0.865349	6.298511e-65	-8.615850e-47
Msa0535040	Msa0898730	0.862552	4.675000e-64	-8.615850e-47
Msa0535040	Msa0903690	0.801245	9.863702e-49	-8.615850e-47
Msa0535040	Msa0908050	0.808393	3.166284e-50	-8.615850e-47
Msa0535040	Msa0909120	0.803119	4.058129e-49	-8.615850e-47
Msa0535040	Msa0909140	0.813857	2.069867e-51	-8.615850e-47
Msa0535040	Msa0910430	0.802968	4.361411e-49	-8.615850e-47
Msa0535040	Msa0911540	0.822937	1.812656e-53	-8.615850e-47
Msa0535040	Msa0925180	0.836403	9.552022e-57	-8.615850e-47
Msa0535040	Msa0929870	0.848294	6.716835e-60	-8.615850e-47
Msa0535040	Msa0930780	0.819690	1.017422e-52	-8.615850e-47
Msa0535040	Msa0936340	0.844580	6.922166e-59	-8.615850e-47
Msa0535040	Msa0936410	0.873168	1.811483e-67	-8.615850e-47
Msa0535040	Msa0941820	0.854422	1.244041e-61	-8.615850e-47
Msa0535040	Msa0944700	0.809809	1.575128e-50	-8.615850e-47
Msa0535040	Msa0944760	0.857864	1.220703e-62	-8.615850e-47
Msa0535040	Msa0944880	0.824362	8.411307e-54	-8.615850e-47
Msa0535040	Msa0948290	0.834212	3.416156e-56	-8.615850e-47
Msa0535040	Msa0961560	0.808169	3.534051e-50	-8.615850e-47
Msa0535040	Msa0961690	0.860326	2.232887e-63	-8.615850e-47
Msa0535040	Msa0964840	0.835388	1.727484e-56	-8.615850e-47
Msa0535040	Msa0965310	0.813352	2.673636e-51	-8.615850e-47
Msa0535040	Msa0967380	0.822852	1.898136e-53	-8.615850e-47
Msa0535040	Msa0972670	0.809142	2.189703e-50	-8.615850e-47
Msa0535040	Msa0973250	0.866725	2.310749e-65	-8.615850e-47
Msa0535040	Msa0979510	0.833959	3.951733e-56	-8.615850e-47
Msa0535040	Msa0986030	0.825259	5.168784e-54	-8.615850e-47
Msa0535040	Msa0996270	0.803429	3.500845e-49	-8.615850e-47
Msa0535040	Msa0996390	0.801122	1.045085e-48	-8.615850e-47
Msa0535040	Msa0996960	0.826721	2.322084e-54	-8.615850e-47
Msa0535040	Msa0999300	0.850791	1.350923e-60	-8.615850e-47
Msa0535040	Msa0999340	0.815864	7.430267e-52	-8.615850e-47
Msa0535040	Msa0999350	0.805138	1.542852e-49	-8.615850e-47
Msa0535040	Msa0999360	0.837746	4.332768e-57	-8.615850e-47
Msa0535040	Msa0999410	0.824457	7.988293e-54	-8.615850e-47
Msa0535040	Msa1001890	0.829261	5.683531e-55	-8.615850e-47
Msa0535040	Msa1005870	0.830233	3.295061e-55	-8.615850e-47
Msa0535040	Msa1007270	0.818048	2.401318e-52	-8.615850e-47
Msa0535040	Msa1021570	0.802023	6.830085e-49	-8.615850e-47
Msa0535040	Msa1032450	0.821787	3.352917e-53	-8.615850e-47
Msa0535040	Msa1037890	0.836568	8.669864e-57	-8.615850e-47
Msa0535040	Msa1037900	0.857964	1.139581e-62	-8.615850e-47
Msa0535040	Msa1037910	0.853278	2.655226e-61	-8.615850e-47
Msa0535040	Msa1037920	0.841215	5.437537e-58	-8.615850e-47
Msa0535040	Msa1041530	0.832350	9.936737e-56	-8.615850e-47
Msa0535040	Msa1042670	0.823350	1.452552e-53	-8.615850e-47
Msa0535040	Msa1045140	0.816339	5.819294e-52	-8.615850e-47
Msa0535040	Msa1047980	0.800091	1.695764e-48	-8.615850e-47
Msa0535040	Msa1048920	0.822785	1.967138e-53	-8.615850e-47
Msa0535040	Msa1066490	0.834454	2.969760e-56	-8.615850e-47
Msa0535040	Msa1070000	0.813530	2.442802e-51	-8.615850e-47
Msa0535040	Msa1073340	0.816800	4.587190e-52	-8.615850e-47
Msa0535040	Msa1077180	0.807898	4.036116e-50	-8.615850e-47
Msa0535040	Msa1079590	0.821164	4.669095e-53	-8.615850e-47
Msa0535040	Msa1081570	0.841359	4.984869e-58	-8.615850e-47
Msa0535040	Msa1082500	0.802813	4.695725e-49	-8.615850e-47
Msa0535040	Msa1084520	0.818044	2.407290e-52	-8.615850e-47
Msa0535040	Msa1085200	0.802801	4.720897e-49	-8.615850e-47
Msa0535040	Msa1092010	0.827067	1.919986e-54	-8.615850e-47
Msa0535040	Msa1096210	0.808569	2.903566e-50	-8.615850e-47
Msa0535040	Msa1097640	0.826171	3.140863e-54	-8.615850e-47
Msa0535040	Msa1123380	0.830495	2.843408e-55	-8.615850e-47
Msa0535040	Msa1123880	0.839206	1.820534e-57	-8.615850e-47
Msa0535040	Msa1125000	0.804662	1.940128e-49	-8.615850e-47
Msa0535040	Msa1125810	0.807524	4.846475e-50	-8.615850e-47
Msa0535040	Msa1127140	0.840560	8.079319e-58	-8.615850e-47
Msa0535040	Msa1127950	0.804302	2.305643e-49	-8.615850e-47
Msa0535040	Msa1128710	0.812763	3.598990e-51	-8.615850e-47
Msa0535040	Msa1129950	0.823256	1.527579e-53	-8.615850e-47
Msa0535040	Msa1129960	0.854230	1.413124e-61	-8.615850e-47
Msa0535040	Msa1129970	0.850471	1.662519e-60	-8.615850e-47
Msa0535040	Msa1129980	0.845902	3.040124e-59	-8.615850e-47
Msa0535040	Msa1130010	0.852660	3.989845e-61	-8.615850e-47
Msa0535040	Msa1139810	0.836552	8.751115e-57	-8.615850e-47
Msa0535040	Msa1140690	0.806559	7.756144e-50	-8.615850e-47
Msa0535040	Msa1145020	0.859636	3.605599e-63	-8.615850e-47
Msa0535040	Msa1151910	0.811425	7.045319e-51	-8.615850e-47
Msa0535040	Msa1157870	0.806591	7.635383e-50	-8.615850e-47
Msa0535040	Msa1165020	0.801791	7.622897e-49	-8.615850e-47
Msa0535040	Msa1166400	0.846019	2.824451e-59	-8.615850e-47
Msa0535040	Msa1168160	0.815977	7.009510e-52	-8.615850e-47
Msa0535040	Msa1169710	0.853427	2.407324e-61	-8.615850e-47
Msa0535040	Msa1169990	0.831255	1.851173e-55	-8.615850e-47
Msa0535040	Msa1171310	0.804532	2.065036e-49	-8.615850e-47
Msa0535040	Msa1176160	0.812138	4.929460e-51	-8.615850e-47
Msa0535040	Msa1179280	0.843318	1.508223e-58	-8.615850e-47
Msa0535040	Msa1190400	0.820669	6.069549e-53	-8.615850e-47
Msa0535040	Msa1193290	0.808152	3.564738e-50	-8.615850e-47
Msa0535040	Msa1200440	0.821053	4.953115e-53	-8.615850e-47
Msa0535040	Msa1201110	0.838276	3.166555e-57	-8.615850e-47
Msa0535040	Msa1201160	0.840421	8.784941e-58	-8.615850e-47
Msa0535040	Msa1209460	0.811917	5.508963e-51	-8.615850e-47
Msa0535040	Msa1217610	0.817207	3.716739e-52	-8.615850e-47
Msa0535040	Msa1218280	-0.800277	1.554400e-48	-8.615850e-47
Msa0535040	Msa1221060	0.809510	1.826040e-50	-8.615850e-47
Msa0535040	Msa1222970	0.809285	2.041104e-50	-8.615850e-47
Msa0535040	Msa1228190	0.863011	3.374691e-64	-8.615850e-47
Msa0535040	Msa1228610	0.825514	4.498314e-54	-8.615850e-47
Msa0535040	Msa1233560	0.841723	3.997565e-58	-8.615850e-47
Msa0535040	Msa1236100	0.807353	5.269687e-50	-8.615850e-47
Msa0535040	Msa1238930	0.815515	8.885674e-52	-8.615850e-47
Msa0535040	Msa1239920	0.808616	2.837263e-50	-8.615850e-47
Msa0535040	Msa1242220	0.808355	3.226397e-50	-8.615850e-47
Msa0535040	Msa1242230	0.817170	3.788851e-52	-8.615850e-47
Msa0535040	Msa1264710	0.805442	1.332454e-49	-8.615850e-47
Msa0535040	Msa1271260	0.845631	3.601077e-59	-8.615850e-47
Msa0535040	Msa1271990	0.808636	2.810307e-50	-8.615850e-47
Msa0535040	Msa1275820	0.811210	7.847642e-51	-8.615850e-47
Msa0535040	Msa1276660	0.800416	1.456262e-48	-8.615850e-47
Msa0535040	Msa1283860	0.822373	2.452648e-53	-8.615850e-47
Msa0535040	Msa1284260	0.800629	1.317341e-48	-8.615850e-47
Msa0535040	Msa1292340	0.814636	1.393069e-51	-8.615850e-47
Msa0535040	Msa1293730	0.806332	8.658487e-50	-8.615850e-47
Msa0535040	Msa1293770	0.849824	2.523816e-60	-8.615850e-47
Msa0535040	Msa1294290	0.825832	3.779526e-54	-8.615850e-47
Msa0535040	Msa1300490	0.808674	2.757550e-50	-8.615850e-47
Msa0535040	Msa1303240	0.808164	3.542193e-50	-8.615850e-47
Msa0535040	Msa1303250	0.847298	1.263738e-59	-8.615850e-47
Msa0535040	Msa1305510	0.868652	5.568883e-66	-8.615850e-47
Msa0535040	Msa1307190	0.802418	5.664461e-49	-8.615850e-47
Msa0535040	Msa1308380	0.807246	5.550146e-50	-8.615850e-47
Msa0535040	Msa1313970	0.823966	1.041933e-53	-8.615850e-47
Msa0535040	Msa1322860	0.818897	1.541796e-52	-8.615850e-47
Msa0535040	Msa1326630	0.837204	5.965785e-57	-8.615850e-47
Msa0535040	Msa1327050	0.803221	3.866883e-49	-8.615850e-47
Msa0535040	Msa1336780	0.832209	1.077306e-55	-8.615850e-47
Msa0535040	Msa1345420	0.826568	2.525838e-54	-8.615850e-47
Msa0535040	Msa1346280	0.814857	1.244443e-51	-8.615850e-47
Msa0535040	Msa1346370	0.811224	7.789803e-51	-8.615850e-47
Msa0535040	Msa1349630	0.805212	1.488800e-49	-8.615850e-47
Msa0535040	Msa1351760	0.826928	2.071883e-54	-8.615850e-47
Msa0535040	Msa1356740	0.831934	1.259603e-55	-8.615850e-47
Msa0535040	Msa1357240	0.823723	1.188247e-53	-8.615850e-47
Msa0535040	Msa1361400	0.814612	1.409942e-51	-8.615850e-47
Msa0535040	Msa1361410	0.809389	1.938806e-50	-8.615850e-47
Msa0535040	Msa1366340	0.803775	2.968217e-49	-8.615850e-47
Msa0535040	Msa1373100	0.801146	1.033357e-48	-8.615850e-47
Msa0535040	Msa1374040	0.807745	4.351269e-50	-8.615850e-47
Msa0535040	Msa1374550	0.875672	2.562691e-68	-8.615850e-47
Msa0535040	Msa1378490	0.802712	4.925426e-49	-8.615850e-47
Msa0535040	Msa1379970	0.831851	1.320194e-55	-8.615850e-47
Msa0535040	Msa1389050	0.801893	7.263997e-49	-8.615850e-47
Msa0535040	Msa1394890	0.850843	1.306791e-60	-8.615850e-47
Msa0535040	Msa1406780	0.832622	8.510522e-56	-8.615850e-47
Msa0535040	Msa1414930	0.828879	7.034604e-55	-8.615850e-47
Msa0535040	Msa1420060	0.868292	7.276296e-66	-8.615850e-47
Msa0535040	Msa1421550	0.883990	2.808537e-71	-8.615850e-47
Msa0535040	Msa1422950	0.800674	1.290224e-48	-8.615850e-47
Msa0535040	Msa1423460	0.861885	7.490921e-64	-8.615850e-47
Msa0535040	Msa1430240	0.842008	3.359895e-58	-8.615850e-47
Msa0535040	Msa1431850	0.839614	1.425736e-57	-8.615850e-47
Msa0535040	Msa1435480	0.836401	9.563408e-57	-8.615850e-47
Msa0535040	Msa1438250	0.810275	1.249877e-50	-8.615850e-47
Msa0535040	Msa1445190	0.809156	2.175120e-50	-8.615850e-47
Msa0535040	Msa1446810	0.809145	2.186684e-50	-8.615850e-47
Msa0535040	Msa1446820	0.804491	2.106292e-49	-8.615850e-47
Msa0535040	Msa1451160	0.806242	9.047569e-50	-8.615850e-47
Msa0535040	Msa1455320	0.810145	1.333525e-50	-8.615850e-47
Msa0535040	Msa1459380	0.814463	1.521359e-51	-8.615850e-47
Msa0535040	Msa1459530	0.842874	1.980668e-58	-8.615850e-47
Msa0535040	Msa1460020	0.802976	4.345414e-49	-8.615850e-47
Msa0535040	Msa1461060	0.809031	2.312992e-50	-8.615850e-47
Msa0535040	Msa1461300	0.807703	4.439816e-50	-8.615850e-47
Msa0535040	Msa1466920	0.814601	1.417773e-51	-8.615850e-47

PPI

Gene1	Gene2	Type

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0535040	MtrunA17_Chr4g0008851	98.378	370	6	0	1	370	1	370	0.0	752
Msa0535040	MtrunA17_Chr7g0274991	75.741	371	87	2	1	370	1	369	0.0	587
Msa0535040	MtrunA17_Chr7g0275011	69.945	366	103	2	9	369	6	369	0.0	525
Msa0535040	MtrunA17_Chr7g0275001	68.802	359	108	3	13	370	7	362	0.0	515
Msa0535040	MtrunA17_Chr1g0189931	70.326	337	98	1	31	367	31	365	0.0	512
Msa0535040	MtrunA17_Chr6g0457921	67.867	361	111	3	13	370	8	366	2.06e-180	504
Msa0535040	MtrunA17_Chr7g0275021	65.854	369	115	3	11	370	4	370	8.53e-179	501
Msa0535040	MtrunA17_Chr1g0189901	65.110	364	118	3	12	368	4	365	4.93e-176	494
Msa0535040	MtrunA17_Chr1g0182811	61.773	361	134	3	10	368	11	369	2.76e-166	469
Msa0535040	MtrunA17_Chr7g0215961	62.500	360	118	3	13	370	12	356	3.88e-164	463
Msa0535040	MtrunA17_Chr1g0189891	62.740	365	122	5	9	369	5	359	3.95e-161	456
Msa0535040	MtrunA17_Chr5g0434621	38.889	342	201	7	10	349	3	338	1.71e-78	245
Msa0535040	MtrunA17_Chr4g0068441	37.571	354	213	6	13	363	17	365	6.21e-74	234
Msa0535040	MtrunA17_Chr8g0374101	36.512	367	219	9	8	363	10	373	1.07e-73	233
Msa0535040	MtrunA17_Chr3g0131321	37.092	337	197	6	32	360	34	363	4.49e-70	224
Msa0535040	MtrunA17_Chr4g0017431	32.687	361	237	4	7	366	8	363	3.53e-69	221
Msa0535040	MtrunA17_Chr2g0294311	35.657	373	219	8	7	364	5	371	3.65e-69	221
Msa0535040	MtrunA17_Chr8g0380041	36.134	357	219	7	14	366	12	363	5.04e-69	221
Msa0535040	MtrunA17_Chr2g0294301	36.283	339	209	5	29	364	32	366	7.91e-69	220
Msa0535040	MtrunA17_Chr3g0077571	35.028	354	223	6	10	363	8	354	1.79e-68	219
Msa0535040	MtrunA17_Chr5g0438641	34.294	347	218	7	1	343	1	341	1.89e-68	219
Msa0535040	MtrunA17_Chr3g0086641	37.464	347	203	8	6	343	5	346	5.58e-68	218
Msa0535040	MtrunA17_Chr3g0105401	37.135	342	205	8	6	343	3	338	1.52e-67	216
Msa0535040	MtrunA17_Chr5g0438621	35.503	338	201	7	15	340	4	336	7.74e-67	215
Msa0535040	MtrunA17_Chr3g0092131	36.593	317	195	5	34	348	25	337	5.01e-66	213
Msa0535040	MtrunA17_Chr2g0285061	37.353	340	198	8	10	343	11	341	5.09e-66	213
Msa0535040	MtrunA17_Chr3g0120861	35.802	324	200	6	25	345	31	349	7.00e-66	213
Msa0535040	MtrunA17_Chr5g0444401	35.380	342	205	6	32	365	28	361	4.84e-65	211
Msa0535040	MtrunA17_Chr4g0060811	37.224	317	193	5	34	348	29	341	4.27e-64	208
Msa0535040	MtrunA17_Chr5g0438631	36.709	316	191	6	32	343	28	338	7.41e-64	207
Msa0535040	MtrunA17_Chr1g0156921	34.375	352	210	7	7	344	8	352	4.93e-63	205
Msa0535040	MtrunA17_Chr3g0099151	34.795	365	218	8	13	366	67	422	1.91e-62	206
Msa0535040	MtrunA17_Chr3g0099161	34.435	363	221	9	13	366	72	426	5.38e-62	204
Msa0535040	MtrunA17_Chr5g0396511	33.934	333	215	4	34	364	48	377	1.03e-61	202
Msa0535040	MtrunA17_Chr5g0432101	34.161	322	201	7	32	348	33	348	2.54e-61	201
Msa0535040	MtrunA17_Chr1g0156931	34.675	323	203	6	28	348	37	353	3.10e-61	201
Msa0535040	MtrunA17_Chr8g0371491	34.286	350	207	8	15	346	8	352	1.30e-60	199
Msa0535040	MtrunA17_Chr3g0077581	33.875	369	222	10	14	366	8	370	7.47e-59	194
Msa0535040	MtrunA17_Chr5g0405831	35.127	316	196	7	32	343	43	353	8.33e-59	194
Msa0535040	MtrunA17_Chr3g0099231	32.787	366	230	8	7	364	2	359	8.61e-59	195
Msa0535040	MtrunA17_Chr2g0301641	33.243	367	219	9	18	369	25	380	1.10e-58	195
Msa0535040	MtrunA17_Chr2g0330781	34.472	322	200	7	32	348	31	346	3.01e-58	192
Msa0535040	MtrunA17_Chr1g0156901	35.736	333	196	7	32	358	50	370	4.26e-58	192
Msa0535040	MtrunA17_Chr1g0156891	35.328	351	214	8	13	355	20	365	5.58e-58	192
Msa0535040	MtrunA17_Chr8g0371481	33.742	326	207	7	32	353	41	361	2.44e-57	191
Msa0535040	MtrunA17_Chr3g0085881	35.224	335	199	9	32	364	33	351	3.58e-57	190
Msa0535040	MtrunA17_Chr8g0341001	33.144	353	224	9	1	348	2	347	4.62e-57	189
Msa0535040	MtrunA17_Chr2g0320671	33.903	351	222	7	1	348	1	344	4.13e-56	187
Msa0535040	MtrunA17_Chr4g0046151	31.268	355	224	7	13	350	15	366	4.44e-56	187
Msa0535040	MtrunA17_Chr5g0405821	35.331	317	195	8	32	343	43	354	4.81e-56	187
Msa0535040	MtrunA17_Chr8g0371471	32.923	325	210	6	32	353	41	360	6.93e-56	187
Msa0535040	MtrunA17_Chr1g0189911	55.405	148	63	2	221	367	2	147	7.11e-56	180
Msa0535040	MtrunA17_Chr3g0142941	33.438	320	196	6	32	344	47	356	9.36e-56	186
Msa0535040	MtrunA17_Chr1g0156911	34.286	315	200	5	32	344	37	346	1.26e-55	186
Msa0535040	MtrunA17_Chr4g0027521	33.951	324	201	7	32	348	27	344	2.38e-53	180
Msa0535040	MtrunA17_Chr3g0142921	32.424	330	212	7	32	358	36	357	8.33e-53	179
Msa0535040	MtrunA17_Chr2g0283191	31.487	343	222	6	7	339	13	352	4.21e-52	177
Msa0535040	MtrunA17_Chr2g0284921	32.070	343	214	7	29	369	31	356	1.03e-50	173
Msa0535040	MtrunA17_Chr8g0349321	33.043	345	207	8	29	364	34	363	1.11e-50	173
Msa0535040	MtrunA17_Chr2g0284951	32.153	339	212	8	32	367	33	356	1.31e-50	173
Msa0535040	MtrunA17_Chr8g0380031	30.435	368	237	9	1	366	56	406	9.26e-50	172
Msa0535040	MtrunA17_Chr1g0157001	33.043	345	200	8	37	363	41	372	1.86e-49	170
Msa0535040	MtrunA17_Chr8g0370951	31.421	366	229	11	13	364	9	366	3.58e-49	169
Msa0535040	MtrunA17_Chr8g0349341	31.793	368	218	11	13	364	13	363	1.32e-47	165
Msa0535040	MtrunA17_Chr2g0285001	30.376	372	223	9	13	367	10	362	4.51e-47	164
Msa0535040	MtrunA17_Chr2g0284991	31.267	371	231	9	7	369	1	355	1.58e-46	162
Msa0535040	MtrunA17_Chr7g0228261	72.043	93	26	0	277	369	3	95	6.62e-46	152
Msa0535040	MtrunA17_Chr8g0370981	30.000	390	206	8	30	365	42	418	9.21e-46	162
Msa0535040	MtrunA17_Chr5g0437421	29.268	328	219	5	32	351	32	354	6.78e-45	158
Msa0535040	MtrunA17_Chr8g0344941	28.650	363	228	10	8	351	9	359	1.79e-44	157
Msa0535040	MtrunA17_Chr1g0189921	63.333	120	38	1	13	126	6	125	4.96e-44	149
Msa0535040	MtrunA17_Chr2g0284941	30.925	346	187	9	34	367	35	340	1.44e-41	149
Msa0535040	MtrunA17_Chr8g0349301	33.448	290	173	8	29	314	34	307	6.44e-41	146
Msa0535040	MtrunA17_Chr8g0344931	28.533	368	237	10	7	366	12	361	1.14e-40	147
Msa0535040	MtrunA17_Chr8g0370961	31.381	239	150	5	129	363	14	242	4.71e-39	139
Msa0535040	MtrunA17_Chr5g0420811	29.032	341	218	11	13	346	11	334	2.55e-38	140
Msa0535040	MtrunA17_Chr3g0085231	26.113	337	226	9	32	364	31	348	1.53e-35	133
Msa0535040	MtrunA17_Chr8g0349331	28.406	345	193	8	29	364	32	331	2.29e-35	132
Msa0535040	MtrunA17_Chr8g0381581	27.926	376	221	15	9	350	15	374	1.57e-32	125
Msa0535040	MtrunA17_Chr1g0160031	28.158	380	227	16	1	351	7	369	8.12e-31	120
Msa0535040	MtrunA17_Chr1g0160011	27.989	368	216	14	13	350	21	369	1.47e-30	120
Msa0535040	MtrunA17_Chr7g0254461	26.722	363	213	14	24	351	35	379	2.60e-30	119
Msa0535040	MtrunA17_Chr7g0271551	28.614	339	207	13	34	357	38	356	3.40e-29	116
Msa0535040	MtrunA17_Chr7g0229591	38.462	169	102	2	14	181	12	179	8.37e-28	108
Msa0535040	MtrunA17_Chr2g0283481	30.499	341	203	13	32	350	47	375	1.54e-27	112
Msa0535040	MtrunA17_Chr1g0159991	29.040	396	222	16	1	359	4	377	3.95e-27	110
Msa0535040	MtrunA17_Chr7g0275291	28.385	384	221	18	1	351	1	363	5.23e-27	110
Msa0535040	MtrunA17_Chr4g0027571	28.125	224	155	4	135	356	3	222	2.67e-26	105
Msa0535040	MtrunA17_Chr2g0283511	29.086	361	222	14	13	350	12	361	8.95e-26	107
Msa0535040	MtrunA17_Chr1g0160101	27.708	397	225	17	5	361	12	386	1.48e-25	106
Msa0535040	MtrunA17_Chr2g0283501	29.825	342	205	13	32	350	31	360	1.87e-25	105
Msa0535040	MtrunA17_Chr6g0455661	26.941	219	155	3	130	346	238	453	6.70e-25	105
Msa0535040	MtrunA17_Chr6g0455661	50.000	94	44	2	30	123	29	119	1.42e-17	84.0
Msa0535040	MtrunA17_Chr1g0159971	27.179	390	219	16	3	350	12	378	6.93e-25	104
Msa0535040	MtrunA17_Chr1g0159981	26.289	388	233	16	6	359	19	387	7.24e-25	104
Msa0535040	MtrunA17_Chr7g0273101	26.836	354	213	11	27	350	24	361	1.01e-24	103
Msa0535040	MtrunA17_Chr6g0459921	26.484	219	156	3	130	346	127	342	1.17e-24	103
Msa0535040	MtrunA17_Chr2g0301581	28.000	375	216	14	1	350	1	346	8.37e-24	100
Msa0535040	MtrunA17_Chr7g0226941	27.762	353	203	15	32	351	33	366	2.97e-23	99.8
Msa0535040	MtrunA17_Chr2g0301541	27.733	375	217	14	1	350	1	346	1.01e-22	97.8
Msa0535040	MtrunA17_Chr8g0352901	27.273	374	229	13	7	351	1	360	1.28e-22	97.8
Msa0535040	MtrunA17_Chr3g0104821	25.770	357	230	13	17	350	29	373	2.73e-22	97.1
Msa0535040	MtrunA17_Chr2g0283531	29.915	351	192	17	32	350	31	359	1.18e-21	95.1
Msa0535040	MtrunA17_Chr6g0469511	46.491	114	59	2	32	144	30	142	1.34e-21	89.7
Msa0535040	MtrunA17_Chr7g0226911	22.835	381	236	13	9	351	12	372	1.74e-21	94.7
Msa0535040	MtrunA17_Chr6g0450721	27.193	342	210	12	32	357	33	351	1.88e-21	94.4
Msa0535040	MtrunA17_Chr6g0450731	26.016	369	230	13	5	351	2	349	4.02e-21	93.6
Msa0535040	MtrunA17_Chr8g0347751	25.000	368	229	14	16	351	18	370	4.17e-21	93.6
Msa0535040	MtrunA17_Chr1g0191461	25.956	366	225	13	13	349	13	361	5.16e-21	93.2
Msa0535040	MtrunA17_Chr6g0450701	27.487	382	225	16	5	351	2	366	6.96e-21	92.8
Msa0535040	MtrunA17_Chr7g0266061	25.000	328	207	12	33	347	43	344	5.41e-20	90.1
Msa0535040	MtrunA17_Chr1g0178931	25.000	320	202	13	30	337	35	328	8.86e-20	89.4
Msa0535040	MtrunA17_Chr4g0027561	43.103	116	65	1	14	128	12	127	1.08e-19	84.7
Msa0535040	MtrunA17_Chr6g0450711	27.089	347	207	14	32	351	122	449	2.71e-19	89.0
Msa0535040	MtrunA17_Chr4g0057991	25.723	346	222	13	31	357	38	367	3.71e-19	87.8
Msa0535040	MtrunA17_Chr7g0226931	23.367	398	236	14	3	351	9	386	4.43e-19	87.8
Msa0535040	MtrunA17_Chr8g0370971	39.456	147	78	4	1	136	1	147	1.03e-18	82.4
Msa0535040	MtrunA17_Chr3g0112821	26.471	340	221	13	31	354	29	355	1.51e-18	85.9
Msa0535040	MtrunA17_Chr5g0440501	23.868	243	171	6	132	364	11	249	2.60e-18	83.6
Msa0535040	MtrunA17_Chr2g0317271	25.895	363	225	13	12	350	2	344	3.30e-18	85.1
Msa0535040	MtrunA17_Chr1g0178941	25.153	326	202	13	30	337	38	339	4.60e-18	84.7
Msa0535040	MtrunA17_Chr1g0198351	25.352	355	209	16	7	337	11	333	1.21e-17	83.2
Msa0535040	MtrunA17_Chr0c01g0489581	26.462	359	216	14	18	350	8	344	1.45e-17	83.2
Msa0535040	MtrunA17_Chr2g0317261	25.620	363	226	13	12	350	2	344	1.82e-17	82.8
Msa0535040	MtrunA17_Chr0c01g0489571	26.462	359	216	14	18	350	8	344	2.05e-17	82.8
Msa0535040	MtrunA17_Chr7g0229581	29.139	151	103	3	208	356	7	155	5.68e-17	77.8
Msa0535040	MtrunA17_Chr2g0301551	26.441	295	170	11	78	350	33	302	1.89e-14	73.6
Msa0535040	MtrunA17_Chr8g0339251	25.758	330	202	11	7	318	1	305	3.83e-14	72.8
Msa0535040	MtrunA17_Chr2g0301571	26.441	295	170	11	78	350	33	302	4.56e-14	72.4
Msa0535040	MtrunA17_Chr2g0301591	26.349	315	178	11	1	293	1	283	2.22e-12	67.0
Msa0535040	MtrunA17_Chr2g0321991	38.393	112	61	2	14	117	8	119	4.43e-12	62.8
Msa0535040	MtrunA17_Chr4g0018571	30.137	146	98	3	205	348	27	170	6.35e-12	63.9
Msa0535040	MtrunA17_Chr2g0284931	25.541	231	136	5	123	353	11	205	5.09e-11	62.0

Query id	Subject id	identity %	alignment length	mismatches	gap openings	q. start	q. end	s. start	s. end	e-value	bit score
Msa0535040	AT5G33370.1	70.225	356	104	1	15	370	13	366	0.0	537
Msa0535040	AT3G04290.1	72.807	342	91	1	27	368	24	363	0.0	525
Msa0535040	AT5G18430.1	67.507	357	109	4	12	366	11	362	4.33e-172	484
Msa0535040	AT4G28780.1	63.859	368	120	4	12	369	2	366	2.94e-167	472
Msa0535040	AT5G33370.2	70.357	280	81	1	15	294	13	290	1.86e-144	412
Msa0535040	AT2G23540.1	37.427	342	205	7	32	366	48	387	1.37e-77	244
Msa0535040	AT3G50400.1	39.481	347	199	10	22	360	25	368	1.86e-76	241
Msa0535040	AT2G42990.1	37.249	349	210	7	11	356	8	350	3.42e-74	234
Msa0535040	AT4G18970.1	39.823	339	193	7	30	363	26	358	9.08e-74	233
Msa0535040	AT4G18970.2	39.823	339	193	7	30	363	26	358	4.81e-73	233
Msa0535040	AT5G15720.1	37.101	345	209	5	26	366	24	364	5.90e-73	231
Msa0535040	AT5G37690.1	39.617	313	183	5	34	345	29	336	6.76e-73	231
Msa0535040	AT5G45670.1	35.616	365	226	7	6	366	3	362	1.58e-72	230
Msa0535040	AT1G29660.1	35.946	370	227	8	1	366	1	364	1.37e-70	225
Msa0535040	AT1G71250.1	34.734	357	222	5	15	363	17	370	3.18e-70	224
Msa0535040	AT5G08460.1	36.716	335	208	4	32	363	49	382	9.06e-70	224
Msa0535040	AT1G29670.1	35.734	361	219	6	14	366	8	363	1.36e-69	223
Msa0535040	AT1G29670.2	36.034	358	216	6	14	363	76	428	7.21e-69	223
Msa0535040	AT1G71691.2	38.279	337	200	7	32	367	55	384	2.87e-68	220
Msa0535040	AT4G26790.1	35.938	320	197	6	32	348	29	343	1.09e-67	217
Msa0535040	AT4G26790.2	35.938	320	197	6	32	348	29	343	1.09e-67	217
Msa0535040	AT5G37690.2	38.339	313	179	6	34	345	29	328	1.79e-67	217
Msa0535040	AT1G75880.1	36.250	320	197	5	32	348	52	367	6.70e-67	216
Msa0535040	AT1G75880.2	36.250	320	196	6	32	348	52	366	4.78e-66	214
Msa0535040	AT1G33811.1	36.467	351	211	9	20	363	22	367	3.69e-65	211
Msa0535040	AT2G30310.1	35.783	313	191	7	32	339	34	341	2.30e-64	209
Msa0535040	AT2G30220.1	36.278	317	192	7	32	343	33	344	2.98e-64	209
Msa0535040	AT2G04570.1	35.604	323	200	6	32	351	28	345	3.27e-64	208
Msa0535040	AT1G75890.2	35.913	323	194	8	32	348	47	362	4.13e-64	209
Msa0535040	AT1G75890.3	35.913	323	194	8	32	348	76	391	8.13e-64	209
Msa0535040	AT1G74460.1	36.308	325	200	6	34	356	25	344	1.36e-63	207
Msa0535040	AT1G58430.1	36.452	310	189	6	32	337	35	340	2.54e-63	206
Msa0535040	AT5G42170.1	35.000	320	197	6	32	348	50	361	4.95e-62	203
Msa0535040	AT2G31540.1	36.278	317	192	7	32	343	35	346	7.54e-62	202
Msa0535040	AT1G06990.1	34.295	312	196	6	32	339	37	343	1.11e-61	202
Msa0535040	AT5G03820.2	36.769	359	207	8	1	348	28	377	1.91e-61	202
Msa0535040	AT5G03820.1	36.261	353	199	8	13	348	6	349	3.56e-61	201
Msa0535040	AT5G41890.1	32.065	368	225	9	14	363	12	372	3.84e-61	201
Msa0535040	AT1G75890.1	34.627	335	195	9	32	348	47	375	5.00e-61	201
Msa0535040	AT2G24560.1	35.144	313	189	7	32	337	34	339	1.12e-60	199
Msa0535040	AT5G03810.1	36.827	353	204	8	6	348	2	345	2.52e-60	198
Msa0535040	AT1G75900.1	32.945	343	219	7	6	344	17	352	2.94e-60	198
Msa0535040	AT1G20120.1	33.851	322	201	7	32	348	78	392	7.90e-60	198
Msa0535040	AT4G10950.2	34.030	335	216	4	32	364	71	402	2.33e-59	197
Msa0535040	AT3G16370.1	36.909	317	191	7	32	344	30	341	2.78e-59	196
Msa0535040	AT5G45950.1	33.033	333	211	7	25	353	29	353	6.45e-59	195
Msa0535040	AT1G59406.1	35.202	321	195	6	32	348	30	341	7.58e-59	194
Msa0535040	AT1G59030.1	35.202	321	195	6	32	348	30	341	7.58e-59	194
Msa0535040	AT1G58725.1	35.202	321	195	6	32	348	30	341	7.58e-59	194
Msa0535040	AT1G20130.2	33.033	333	200	8	32	348	184	509	8.96e-58	196
Msa0535040	AT1G20130.1	33.033	333	200	8	32	348	204	529	1.67e-57	196
Msa0535040	AT5G22810.1	36.615	325	191	9	32	348	34	351	2.34e-57	191
Msa0535040	AT5G45960.1	32.907	313	202	4	32	339	47	356	3.04e-57	191
Msa0535040	AT1G20132.1	35.238	315	196	6	32	343	61	370	4.14e-57	191
Msa0535040	AT4G10950.1	34.226	336	210	6	32	364	71	398	1.44e-56	190
Msa0535040	AT3G53100.1	36.760	321	193	7	32	348	29	343	3.63e-56	187
Msa0535040	AT5G63170.1	34.911	338	199	9	5	339	2	321	4.42e-55	184
Msa0535040	AT1G58520.3	34.579	321	190	7	32	348	30	334	8.45e-55	184
Msa0535040	AT1G58525.1	34.579	321	190	7	32	348	30	334	8.45e-55	184
Msa0535040	AT5G55050.1	33.431	341	214	7	33	365	40	375	6.38e-54	182
Msa0535040	AT2G19060.1	32.857	350	207	11	12	350	4	336	1.08e-53	181
Msa0535040	AT5G15720.3	34.296	277	176	4	94	366	59	333	3.80e-53	179
Msa0535040	AT2G19010.1	33.048	351	211	10	17	363	15	345	3.95e-53	179
Msa0535040	AT5G40990.1	31.481	378	231	11	9	367	6	374	4.31e-53	180
Msa0535040	AT3G43570.1	33.229	319	175	6	32	348	30	312	5.80e-53	178
Msa0535040	AT2G19010.2	33.048	351	211	10	17	363	45	375	1.21e-52	179
Msa0535040	AT4G16230.1	44.105	229	114	5	13	231	5	229	2.61e-52	174
Msa0535040	AT1G73610.1	34.688	320	188	8	32	348	35	336	5.87e-52	176
Msa0535040	AT2G40250.1	31.875	320	204	5	32	343	36	349	8.61e-52	176
Msa0535040	AT5G15720.2	37.545	277	165	5	26	298	24	296	3.15e-51	173
Msa0535040	AT1G20135.1	31.343	335	207	9	17	344	9	327	6.98e-51	173
Msa0535040	AT2G19050.1	33.036	336	199	8	33	363	32	346	1.18e-50	173
Msa0535040	AT1G71691.1	34.843	287	180	6	82	367	3	283	4.26e-50	169
Msa0535040	AT3G14820.1	30.571	350	225	9	14	356	12	350	1.97e-49	170
Msa0535040	AT4G30140.1	33.634	333	201	8	33	364	34	347	3.42e-49	169
Msa0535040	AT2G24560.2	33.803	284	174	7	32	308	34	310	3.82e-48	166
Msa0535040	AT1G53940.2	31.429	350	214	12	32	367	39	376	1.09e-47	166
Msa0535040	AT1G23500.1	31.707	328	202	8	27	350	30	339	2.18e-46	162
Msa0535040	AT3G14225.1	30.484	351	218	10	32	366	37	377	5.47e-46	161
Msa0535040	AT1G71120.1	33.235	340	204	13	32	363	31	355	5.86e-46	161
Msa0535040	AT3G14225.2	30.659	349	216	10	32	366	37	373	8.45e-46	161
Msa0535040	AT1G71691.3	39.015	264	153	7	32	294	55	311	1.66e-45	159
Msa0535040	AT1G75920.2	29.683	347	214	8	15	348	6	335	1.25e-44	157
Msa0535040	AT1G75910.1	30.938	320	206	6	32	348	28	335	1.52e-44	157
Msa0535040	AT1G75930.1	32.492	317	194	8	32	343	29	330	1.56e-44	157
Msa0535040	AT1G53990.1	29.521	376	224	13	13	366	8	364	4.44e-43	154
Msa0535040	AT3G43550.1	33.456	272	169	5	26	294	24	286	2.18e-42	149
Msa0535040	AT1G75920.1	28.453	362	214	9	15	348	1	345	9.19e-41	147
Msa0535040	AT2G19050.2	34.568	243	151	3	33	275	32	266	9.37e-40	142
Msa0535040	AT2G03980.2	30.818	318	202	8	32	342	43	349	6.65e-38	140
Msa0535040	AT2G03980.3	30.818	318	202	8	32	342	43	349	6.65e-38	140
Msa0535040	AT2G03980.1	30.818	318	202	8	32	342	43	349	6.65e-38	140
Msa0535040	AT2G03980.4	30.818	318	202	8	32	342	43	349	6.65e-38	140
Msa0535040	AT1G53920.1	27.949	390	245	12	1	366	7	384	1.19e-36	137
Msa0535040	AT1G75920.3	28.655	342	193	8	15	348	6	304	7.24e-36	133
Msa0535040	AT2G31550.1	32.701	211	135	4	139	346	2	208	7.90e-36	130
Msa0535040	AT1G75920.4	27.852	298	191	7	58	348	27	307	5.73e-34	128
Msa0535040	AT1G56670.1	28.142	366	215	12	12	349	12	357	1.08e-31	123
Msa0535040	AT1G54030.1	29.619	341	209	14	30	366	50	363	9.53e-31	121
Msa0535040	AT1G09390.1	29.086	361	214	12	14	349	11	354	3.07e-29	116
Msa0535040	AT1G53940.1	30.797	276	167	12	32	297	39	300	6.48e-29	114
Msa0535040	AT5G45910.1	29.815	379	215	18	5	350	4	364	3.76e-27	110
Msa0535040	AT3G62280.1	28.363	342	205	13	36	359	40	359	4.54e-27	110
Msa0535040	AT5G14450.1	27.273	374	224	14	9	350	16	373	1.28e-26	109
Msa0535040	AT4G01130.1	26.790	377	221	15	13	354	15	371	6.58e-25	104
Msa0535040	AT1G54790.3	26.984	378	225	14	5	350	6	364	1.19e-24	103
Msa0535040	AT3G26430.1	28.895	353	199	15	32	350	31	365	1.72e-24	103
Msa0535040	AT3G14220.1	25.069	363	243	12	13	365	9	352	9.64e-24	101
Msa0535040	AT3G09930.2	28.060	335	200	14	25	343	32	341	1.24e-23	100
Msa0535040	AT3G09930.1	28.060	335	200	14	25	343	32	341	1.24e-23	100
Msa0535040	AT3G27950.1	27.457	346	206	10	32	351	32	358	1.48e-23	100
Msa0535040	AT3G05180.1	27.794	349	206	13	32	350	36	368	2.68e-23	100
Msa0535040	AT4G16233.1	36.000	125	77	2	240	363	5	127	3.95e-23	94.0
Msa0535040	AT1G54790.1	27.557	352	199	15	34	350	33	363	5.99e-23	99.4
Msa0535040	AT1G31550.2	29.275	386	222	19	12	366	14	379	2.19e-22	97.8
Msa0535040	AT1G67830.1	26.944	360	215	15	25	352	23	366	3.34e-22	97.1
Msa0535040	AT2G04020.1	32.673	202	123	4	32	229	43	235	9.18e-22	94.0
Msa0535040	AT2G04020.2	32.558	215	129	5	32	239	43	248	9.34e-22	95.1
Msa0535040	AT1G54000.1	25.613	367	231	14	15	363	12	354	1.03e-21	95.9
Msa0535040	AT1G54010.1	26.016	369	229	15	15	364	12	355	3.67e-21	94.4
Msa0535040	AT1G28670.1	28.883	367	222	15	12	350	10	365	4.28e-21	94.0
Msa0535040	AT1G56670.2	27.451	306	179	11	12	294	12	297	9.68e-21	91.7
Msa0535040	AT1G28570.1	28.371	356	219	18	31	363	33	375	1.18e-20	92.8
Msa0535040	AT5G03610.1	25.776	322	205	12	34	343	45	344	1.67e-20	92.0
Msa0535040	AT4G16220.1	47.321	112	56	2	13	123	11	120	2.07e-20	89.7
Msa0535040	AT1G28660.1	29.730	370	214	16	12	350	10	364	5.87e-20	90.9
Msa0535040	AT1G54020.2	25.000	348	235	11	21	364	22	347	7.08e-20	90.5
Msa0535040	AT1G28650.1	28.415	366	220	16	14	350	14	366	1.93e-19	89.4
Msa0535040	AT3G14210.1	26.801	347	215	12	32	364	36	357	2.06e-19	89.4
Msa0535040	AT1G28640.1	28.686	373	216	19	12	351	10	365	2.19e-19	89.0
Msa0535040	AT1G54030.2	28.629	248	152	9	30	274	50	275	3.99e-19	87.4
Msa0535040	AT3G48460.1	25.872	344	210	14	34	351	40	364	1.03e-18	87.0
Msa0535040	AT4G01130.3	26.599	297	171	11	93	354	1	285	1.10e-18	85.9
Msa0535040	AT1G54790.2	25.661	378	199	16	34	350	33	389	6.79e-18	85.1
Msa0535040	AT1G28590.1	25.956	366	239	15	7	350	10	365	4.09e-16	79.7
Msa0535040	AT4G01130.2	26.645	304	181	13	13	294	15	298	9.06e-16	77.8
Msa0535040	AT3G62280.2	28.195	266	158	10	36	286	40	287	1.60e-15	76.6
Msa0535040	AT2G36325.1	25.278	360	215	14	9	343	16	346	1.89e-12	68.2

Find 96 sgRNAs with CRISPR-Local

Find 307 sgRNAs with CRISPR-GE

CRISPR-Local

CRISPR-Local
sgRNA_sequence	on_target_score	Position	Region
ATAGGGATCTTTATGCATTT+TGG	0.100711	4_1:-10847830	Msa0535040:CDS
CATTCCCACCTAAAGTTATT+AGG	0.124247	4_1:+10851071	None:intergenic
CTTCTAACTTGTGCCCTAAT+AGG	0.217615	4_1:-10847848	Msa0535040:CDS
ATTGTATTCTTGAACGTTTA+AGG	0.219399	4_1:-10847597	Msa0535040:three_prime_UTR
AATGCATAAAGATCCCTATT+AGG	0.244612	4_1:+10847834	None:intergenic
AATTCATCATCATTATTATT+AGG	0.246629	4_1:+10847689	None:intergenic
AATCAACTCAATGCTGAAAT+TGG	0.265479	4_1:-10849542	Msa0535040:CDS
ATAAGTGTACTAAGATTATA+TGG	0.279256	4_1:+10847729	None:intergenic
TTTATCAACGATTAGTCTAT+TGG	0.279659	4_1:+10847782	None:intergenic
CACTTATTGCTATGGATTCT+AGG	0.292361	4_1:-10847713	Msa0535040:CDS
ACTGTTTAAAGTATGCTAAT+TGG	0.292401	4_1:+10851161	None:intergenic
CATACAGAATCTATATGAAT+TGG	0.299167	4_1:-10849708	Msa0535040:intron
CGTGCTGATTCATATCCTTA+TGG	0.309899	4_1:-10852501	Msa0535040:CDS
GATGGTGAAAGGTTGCTTAA+TGG	0.313083	4_1:-10852227	Msa0535040:CDS
TCTCAAACTCATAGAGCTTC+TGG	0.319164	4_1:-10852471	Msa0535040:CDS
TCAAGCTCTGGACTCAAATA+TGG	0.322479	4_1:+10852248	None:intergenic
CAATAAACTGCAAAGATCAT+AGG	0.328879	4_1:+10847616	None:intergenic
ATTCCCACCTAAAGTTATTA+GGG	0.330551	4_1:+10851072	None:intergenic
CAAAGGGTTAGTGCACTAAT+TGG	0.330824	4_1:-10851133	Msa0535040:CDS
TGAGTATCGCAAAATTCTTA+TGG	0.332687	4_1:-10850963	Msa0535040:intron
ATTGGGAGCAAGAAGAGTTT+TGG	0.351874	4_1:-10849690	Msa0535040:CDS
GCATTAACCCTAATAACTTT+AGG	0.353703	4_1:-10851079	Msa0535040:CDS
TTCTAACTTGTGCCCTAATA+GGG	0.362728	4_1:-10847847	Msa0535040:CDS
TCACCACTCACTAGCAAGTT+GGG	0.365485	4_1:-10852702	None:intergenic
TTGAAGGAATAATATTCATT+TGG	0.368127	4_1:+10852646	None:intergenic
CTGTTTAAAGTATGCTAATT+GGG	0.373885	4_1:+10851162	None:intergenic
ATGCATAAAGATCCCTATTA+GGG	0.388461	4_1:+10847835	None:intergenic
GCATAGATGAAGACATGATT+AGG	0.388507	4_1:+10849515	None:intergenic
TTAGTGCACTAACCCTTTGC+TGG	0.395839	4_1:+10851137	None:intergenic
TCTAATGCTTCATTCCTATA+GGG	0.402387	4_1:-10847652	Msa0535040:three_prime_UTR
AGGTTGTGTGCCAGCAGAAT+TGG	0.403582	4_1:-10849648	Msa0535040:CDS
AAATGAGCACTCAACTAATA+AGG	0.407140	4_1:+10852418	None:intergenic
ATGCTAATTGGGCAGTAATT+CGG	0.407503	4_1:+10851173	None:intergenic
TTGGCTATGCAAGGAAGAAA+TGG	0.409678	4_1:-10849629	Msa0535040:CDS
AAATGCCTTTGCTATGCATT+TGG	0.417717	4_1:-10849492	Msa0535040:CDS
ATCTAATGCTTCATTCCTAT+AGG	0.432403	4_1:-10847653	Msa0535040:three_prime_UTR
ATGAGGAAGACAACATAATC+AGG	0.437834	4_1:+10850989	None:intergenic
AGTCTATTGGCTCTTTCTGA+TGG	0.442836	4_1:+10847795	None:intergenic
GCTCTTTCTGATGGATGAAA+GGG	0.446836	4_1:+10847804	None:intergenic
TCTTAGTACACTTATTGCTA+TGG	0.450346	4_1:-10847721	Msa0535040:CDS
ATTATATGGGTGCATGTAAT+CGG	0.455255	4_1:+10847743	None:intergenic
TATTTGAGTCCAGAGCTTGA+TGG	0.458469	4_1:-10852245	Msa0535040:CDS
CTCACCACTCACTAGCAAGT+TGG	0.459599	4_1:-10852703	None:intergenic
GGACTCAAATATGGTAATGT+AGG	0.461253	4_1:+10852257	None:intergenic
GGCTCTTTCTGATGGATGAA+AGG	0.468116	4_1:+10847803	None:intergenic
GTCAGGCATGTTGAGGCCAT+TGG	0.468967	4_1:+10852440	None:intergenic
ATCGTTGATAAATTTATGAC+TGG	0.473147	4_1:-10847771	Msa0535040:CDS
AAGAGCATATTCACGAGATC+TGG	0.473248	4_1:+10851012	None:intergenic
GGTTACAACCACGACCCTAT+AGG	0.485545	4_1:+10847638	None:intergenic
ATACAGAATCTATATGAATT+GGG	0.488950	4_1:-10849707	Msa0535040:intron
CATAGTCCAACTCCATTGTA+TGG	0.492410	4_1:+10847879	None:intergenic
CCTTGCATAGCCAATTCTGC+TGG	0.494918	4_1:+10849638	None:intergenic
GCTTCTGGTCGTTTCTCCAA+TGG	0.503907	4_1:-10852456	Msa0535040:CDS
GTTTGAGAATCAATTCCATA+AGG	0.506762	4_1:+10852486	None:intergenic
AACACACAAAGAAATATTGA+AGG	0.510102	4_1:+10852630	None:intergenic
AATAAACTGCAAAGATCATA+GGG	0.521338	4_1:+10847617	None:intergenic
TTAACCCTAATAACTTTAGG+TGG	0.521401	4_1:-10851076	Msa0535040:CDS
CAACTCAATGCTGAAATTGG+TGG	0.521897	4_1:-10849539	Msa0535040:CDS
CTTTAAACAGTACCAGCAAA+GGG	0.526031	4_1:-10851149	Msa0535040:CDS
TTAATCAATTGAACAAGTTG+AGG	0.526832	4_1:+10849563	None:intergenic
TTAGGGCACAAGTTAGAAGC+TGG	0.527870	4_1:+10847852	None:intergenic
GTTAGAGACATTAATTCCAA+TGG	0.529094	4_1:-10852679	Msa0535040:exon
AACCTTTCACCATCAAGCTC+TGG	0.531953	4_1:+10852236	None:intergenic
AGCACTCAACTAATAAGGTC+AGG	0.533862	4_1:+10852423	None:intergenic
TTCACGAGATCTGGCTGAGT+AGG	0.549249	4_1:+10851021	None:intergenic
GCTTCATTCCTATAGGGTCG+TGG	0.549624	4_1:-10847646	Msa0535040:three_prime_UTR
CAAGGACCATACAATGGAGT+TGG	0.550513	4_1:-10847885	Msa0535040:CDS
CAGCACGAGCAGTAGTGGCT+AGG	0.552042	4_1:+10852517	None:intergenic
GTTTCTAATCCACAAGCATA+CGG	0.553825	4_1:-10849464	Msa0535040:intron
GTGACAGGAACGGGACCACT+AGG	0.554470	4_1:-10849668	Msa0535040:CDS
AAACATGCATGTTGTGGTCA+AGG	0.555677	4_1:-10847903	Msa0535040:CDS
GTGTTGATCACCTTGAGCAT+TGG	0.558772	4_1:-10852612	Msa0535040:CDS
TCACGAGATCTGGCTGAGTA+GGG	0.559568	4_1:+10851022	None:intergenic
TGAATCAGCACGAGCAGTAG+TGG	0.564727	4_1:+10852512	None:intergenic
TTGTTGAACACCAATGCTCA+AGG	0.567686	4_1:+10852602	None:intergenic
GGAAATATACCGTATGCTTG+TGG	0.571755	4_1:+10849455	None:intergenic
ACTTTAAACAGTACCAGCAA+AGG	0.571949	4_1:-10851150	Msa0535040:CDS
TGTGTTTGGTGATTCTCTTG+TGG	0.575556	4_1:-10852559	Msa0535040:CDS
AAGTTATTAGGGTTAATGCT+TGG	0.575775	4_1:+10851083	None:intergenic
TAAGTGTACTAAGATTATAT+GGG	0.583474	4_1:+10847730	None:intergenic
AAGTTAGTAGCTGTTTGAAG+AGG	0.588986	4_1:+10849593	None:intergenic
CTCTTTCTGATGGATGAAAG+GGG	0.589840	4_1:+10847805	None:intergenic
GGTGATTCTCTTGTGGACAA+TGG	0.593184	4_1:-10852552	Msa0535040:CDS
CCAGCAGAATTGGCTATGCA+AGG	0.594783	4_1:-10849638	Msa0535040:CDS
TAACCCTAATAACTTTAGGT+GGG	0.599439	4_1:-10851075	Msa0535040:CDS
ATTGGAATTCTCAATGACAC+TGG	0.602237	4_1:-10852182	Msa0535040:CDS
GTCCAGAGCTTGATGGTGAA+AGG	0.614928	4_1:-10852238	Msa0535040:CDS
GAAATCCAAATGCATAGCAA+AGG	0.615273	4_1:+10849487	None:intergenic
TAATAAGGTCAGGCATGTTG+AGG	0.615842	4_1:+10852433	None:intergenic
TGCACTAATTGGAGAAAGTG+AGG	0.617026	4_1:-10851122	Msa0535040:CDS
CACCACTCACTAGCAAGTTG+GGG	0.623635	4_1:-10852701	None:intergenic
CAAGGAAGAAATGGAGAGTG+TGG	0.633620	4_1:-10849620	Msa0535040:CDS
ACATCAAAACATGCATGTTG+TGG	0.666826	4_1:-10847909	Msa0535040:CDS
TGTGGTCAAGGACCATACAA+TGG	0.678040	4_1:-10847891	Msa0535040:CDS
TCTGCTGGCACACAACCTAG+TGG	0.689336	4_1:+10849653	None:intergenic
ATTGAGAATTCCAATCCCAG+CGG	0.771559	4_1:+10852190	None:intergenic

CRISPR-GE

badsite warning	sgRNA_sequence	Strand	Position	Region	GC_content
!!!	ATTTCTTTTTTTTTTTTTTG+AGG	-	chr4_1:10848707-10848726	Msa0535040:intron	10.0%
!!!	TTTCTTTTTTTTTTTTTTGA+GGG	-	chr4_1:10848708-10848727	Msa0535040:intron	10.0%
!!!	CTTTTTTTATATTTAAGATT+AGG	+	chr4_1:10848791-10848810	None:intergenic	10.0%
!!	CAAAAAAAATAAATATTAGT+AGG	+	chr4_1:10849595-10849614	None:intergenic	10.0%
!!!	TTTTTTTTTTTTGAAATGTT+GGG	+	chr4_1:10850031-10850050	None:intergenic	10.0%
!!!	TTTTTTTTTTTTTGAAATGT+TGG	+	chr4_1:10850032-10850051	None:intergenic	10.0%
!!!	ATGAAATTTTTTTTTTTATG+AGG	-	chr4_1:10850198-10850217	Msa0535040:intron	10.0%
!!!	TGAAATTTTTTTTTTTATGA+GGG	-	chr4_1:10850199-10850218	Msa0535040:intron	10.0%
!!	ATAATATAATAATTGATGTA+CGG	+	chr4_1:10850435-10850454	None:intergenic	10.0%
!!!	ACTTAATAACATTTTATTTT+AGG	+	chr4_1:10851470-10851489	None:intergenic	10.0%
!!	AAAAAAAAAAAAAAACTTGT+AGG	-	chr4_1:10851571-10851590	Msa0535040:intron	10.0%
!!	TTGAATATAAATTCATTATA+TGG	+	chr4_1:10851634-10851653	None:intergenic	10.0%
!!	AAATCTATATAATACATATA+TGG	+	chr4_1:10851784-10851803	None:intergenic	10.0%
!!!	TTTCATCTAATGTATTTTTT+AGG	-	chr4_1:10847876-10847895	Msa0535040:CDS	15.0%
!!!	TTCATCTAATGTATTTTTTA+GGG	-	chr4_1:10847877-10847896	Msa0535040:CDS	15.0%
!!!	GATATATTTCAAATTTTTAG+TGG	+	chr4_1:10848445-10848464	None:intergenic	15.0%
!!!	AAGACATGAAAATAAATTTT+TGG	-	chr4_1:10848469-10848488	Msa0535040:intron	15.0%
!!	TCATTACACATATAAATTTA+GGG	+	chr4_1:10848940-10848959	None:intergenic	15.0%
!!	TTCATTACACATATAAATTT+AGG	+	chr4_1:10848941-10848960	None:intergenic	15.0%
!!	TTAGATAATTAGATACAAAT+AGG	+	chr4_1:10848999-10849018	None:intergenic	15.0%
!!	AATGATGAAAATTAAACAAA+GGG	+	chr4_1:10849303-10849322	None:intergenic	15.0%
!!	AAATGATGAAAATTAAACAA+AGG	+	chr4_1:10849304-10849323	None:intergenic	15.0%
!!!	TTCAACTGTTTTTATATATA+TGG	+	chr4_1:10849505-10849524	None:intergenic	15.0%
!!	TATATATAAAAACAGTTGAA+TGG	-	chr4_1:10849505-10849524	Msa0535040:CDS	15.0%
!!!	TTTTATAAGGAAAATACTAT+AGG	+	chr4_1:10849569-10849588	None:intergenic	15.0%
!!!	TATTAGTAGGTTTTTTTATA+AGG	+	chr4_1:10849582-10849601	None:intergenic	15.0%
!!	TTAGCTATATAGTTAATAAA+AGG	-	chr4_1:10849678-10849697	Msa0535040:CDS	15.0%
!!	TAGCTATATAGTTAATAAAA+GGG	-	chr4_1:10849679-10849698	Msa0535040:CDS	15.0%
!!!	AGAAGCTTTTTTATTTTTTT+TGG	+	chr4_1:10849971-10849990	None:intergenic	15.0%
!!!	ATCTATTTTATTTCAATATG+TGG	-	chr4_1:10850098-10850117	Msa0535040:intron	15.0%
!!!	ATGTGGATTTTAATATTAAT+CGG	+	chr4_1:10850335-10850354	None:intergenic	15.0%
!!!	TTTTACTATATGGTTATATT+TGG	+	chr4_1:10850369-10850388	None:intergenic	15.0%
!!!	AATTCAACATTTTTACTATA+TGG	+	chr4_1:10850379-10850398	None:intergenic	15.0%
!!	ATATATTACTACTACATATT+AGG	+	chr4_1:10852070-10852089	None:intergenic	15.0%
!!!	TTTTTGTTTTTTATATATGC+AGG	-	chr4_1:10852278-10852297	Msa0535040:CDS	15.0%
!!	AATTCATCATCATTATTATT+AGG	+	chr4_1:10852531-10852550	None:intergenic	15.0%
!!	ATGATGAATTTAAAAAATCT+AGG	-	chr4_1:10852541-10852560	Msa0535040:CDS	15.0%
!!	TTGAAGGAATAATATTCATT+TGG	+	chr4_1:10847574-10847593	None:intergenic	20.0%
!!	CTATAAATTATGAATGTGAT+AGG	-	chr4_1:10847918-10847937	Msa0535040:CDS	20.0%
!!!	ATTTTTGGATCATACATATA+AGG	-	chr4_1:10848484-10848503	Msa0535040:intron	20.0%
!!	TCGATAAAAGTTTATGTATT+TGG	-	chr4_1:10848863-10848882	Msa0535040:intron	20.0%
!!!	TTTTGTGAACAACTATTATT+TGG	-	chr4_1:10849170-10849189	Msa0535040:intron	20.0%
!!	ATATTAAGAGTAATGTTAAC+CGG	+	chr4_1:10849860-10849879	None:intergenic	20.0%
!!!	TTTTTTATTTTTTTTGGTGG+TGG	+	chr4_1:10849965-10849984	None:intergenic	20.0%
!!!	AGCTTTTTTATTTTTTTTGG+TGG	+	chr4_1:10849968-10849987	None:intergenic	20.0%
!!!	ACATTATCTTTAGAAATGTT+GGG	+	chr4_1:10850069-10850088	None:intergenic	20.0%
!!!	AACATTATCTTTAGAAATGT+TGG	+	chr4_1:10850070-10850089	None:intergenic	20.0%
!!!	TTTTTTTATGAGGGTTAATT+AGG	-	chr4_1:10850208-10850227	Msa0535040:intron	20.0%
!!!	GGAATTAAATGTGTTTTTTT+TGG	-	chr4_1:10850229-10850248	Msa0535040:intron	20.0%
!!	TAGATGAGTTAATTAATGTT+TGG	-	chr4_1:10850257-10850276	Msa0535040:intron	20.0%
!!	ATTCAATGTTATAACACAAT+TGG	+	chr4_1:10850483-10850502	None:intergenic	20.0%
!!	ATACAGAATCTATATGAATT+GGG	-	chr4_1:10850510-10850529	Msa0535040:intron	20.0%
!!	GTATATTTCCAATCTTAATT+TGG	-	chr4_1:10850775-10850794	Msa0535040:intron	20.0%
!!	AAGTTTAACCAAATTAAGAT+TGG	+	chr4_1:10850786-10850805	None:intergenic	20.0%
!!	AAACACAAATATTCATCTAT+TGG	-	chr4_1:10850843-10850862	Msa0535040:intron	20.0%
!!	TATGCTAGATTTAAATTGTT+AGG	-	chr4_1:10850900-10850919	Msa0535040:intron	20.0%
!!!	TAATTAATATGTTTAGCTCT+TGG	-	chr4_1:10851006-10851025	Msa0535040:CDS	20.0%
!!	TTGATCTACTTTACATTTAA+TGG	+	chr4_1:10851109-10851128	None:intergenic	20.0%
!!	AAAGTAGATCAATTATGATT+AGG	-	chr4_1:10851117-10851136	Msa0535040:CDS	20.0%
!!	AAGTAGATCAATTATGATTA+GGG	-	chr4_1:10851118-10851137	Msa0535040:CDS	20.0%
!!	GATTCAAATACTATGAAAAA+AGG	+	chr4_1:10851212-10851231	None:intergenic	20.0%
!!!	TACTCAAACAAAAGTATATA+GGG	+	chr4_1:10851247-10851266	None:intergenic	20.0%
!!!	ATACTCAAACAAAAGTATAT+AGG	+	chr4_1:10851248-10851267	None:intergenic	20.0%
!!	TTTGCAAAATCACAAAATAA+TGG	+	chr4_1:10851677-10851696	None:intergenic	20.0%
!!	TGAATTTGTCGTAATTATAA+TGG	-	chr4_1:10851725-10851744	Msa0535040:intron	20.0%
!!	TACTATATATTGAACCATAT+AGG	+	chr4_1:10851923-10851942	None:intergenic	20.0%
!!	TAAGTGTACTAAGATTATAT+GGG	+	chr4_1:10852490-10852509	None:intergenic	20.0%
!!	ATAAGTGTACTAAGATTATA+TGG	+	chr4_1:10852491-10852510	None:intergenic	20.0%
!!!	ATTTGGTTTTTTTGTTCCAT+TGG	+	chr4_1:10847557-10847576	None:intergenic	25.0%
!	AACACACAAAGAAATATTGA+AGG	+	chr4_1:10847590-10847609	None:intergenic	25.0%
!	AATACATTAGATGAAAGCTA+GGG	+	chr4_1:10847872-10847891	None:intergenic	25.0%
!	AAATACATTAGATGAAAGCT+AGG	+	chr4_1:10847873-10847892	None:intergenic	25.0%
!!!	TAGGGCATGTTTTAATTAAT+TGG	-	chr4_1:10847895-10847914	Msa0535040:CDS	25.0%
!	AATGTGATAGGTGAAAAAAT+TGG	-	chr4_1:10847930-10847949	Msa0535040:intron	25.0%
!	ATGTGATAGGTGAAAAAATT+GGG	-	chr4_1:10847931-10847950	Msa0535040:intron	25.0%
!!	AAAGTAGAATTTTCCTTTCA+CGG	-	chr4_1:10848114-10848133	Msa0535040:intron	25.0%
!	TAGTATAAGATATGGAGTTT+AGG	+	chr4_1:10848180-10848199	None:intergenic	25.0%
!	TGTAGCAATAGTATAAGATA+TGG	+	chr4_1:10848188-10848207	None:intergenic	25.0%
!!	CTGTTTAAAGTATGCTAATT+GGG	+	chr4_1:10849058-10849077	None:intergenic	25.0%
!!	ACTGTTTAAAGTATGCTAAT+TGG	+	chr4_1:10849059-10849078	None:intergenic	25.0%
!!!	ATTGTTACATCACACTTTTT+GGG	-	chr4_1:10849432-10849451	Msa0535040:intron	25.0%
!	GACTTTGACCAAATATATTA+GGG	+	chr4_1:10849481-10849500	None:intergenic	25.0%
!	TGACTTTGACCAAATATATT+AGG	+	chr4_1:10849482-10849501	None:intergenic	25.0%
!	TGAGTAAAGAACCTTTAAAT+TGG	-	chr4_1:10849617-10849636	Msa0535040:CDS	25.0%
!	GAGTAAAGAACCTTTAAATT+GGG	-	chr4_1:10849618-10849637	Msa0535040:CDS	25.0%
!	AATAAAAGGGTTATGTTAAC+CGG	-	chr4_1:10849692-10849711	Msa0535040:CDS	25.0%
!	CAAATATAGTAACATCACAT+TGG	+	chr4_1:10849811-10849830	None:intergenic	25.0%
!	AACAATGCATAATATATGCA+AGG	-	chr4_1:10849920-10849939	Msa0535040:intron	25.0%
!	TACTATATGGTTATATTTGG+TGG	+	chr4_1:10850366-10850385	None:intergenic	25.0%
!	ATAATAATTGATGTACGGAT+TGG	+	chr4_1:10850430-10850449	None:intergenic	25.0%
!	CATACAGAATCTATATGAAT+TGG	-	chr4_1:10850509-10850528	Msa0535040:intron	25.0%
!	TTAATCAATTGAACAAGTTG+AGG	+	chr4_1:10850657-10850676	None:intergenic	25.0%
!	TAGATTTAAATTGTTAGGTC+CGG	-	chr4_1:10850905-10850924	Msa0535040:intron	25.0%
!	ATTAGATTATCCTAAGATCT+TGG	-	chr4_1:10851044-10851063	Msa0535040:CDS	25.0%
!	TTAGATTATCCTAAGATCTT+GGG	-	chr4_1:10851045-10851064	Msa0535040:CDS	25.0%
!	AGTAGATCAATTATGATTAG+GGG	-	chr4_1:10851119-10851138	Msa0535040:CDS	25.0%
!	TGAGTTAGTATCAAATTGAT+CGG	+	chr4_1:10851166-10851185	None:intergenic	25.0%
!	GTTCAAGTGTCATAATTTAA+AGG	-	chr4_1:10851415-10851434	Msa0535040:intron	25.0%
!!	TATATTTTCTTGAACGAGTT+GGG	+	chr4_1:10851605-10851624	None:intergenic	25.0%
!	AACATAATCCATTTGAATAG+TGG	+	chr4_1:10851991-10852010	None:intergenic	25.0%
!	TATGTTGCAATCATGTTAAA+TGG	-	chr4_1:10852005-10852024	Msa0535040:intron	25.0%
!	TTACTACTACATATTAGGAA+TGG	+	chr4_1:10852065-10852084	None:intergenic	25.0%
!!!	AAATGTTTTTTCAATGAGCA+TGG	+	chr4_1:10852118-10852137	None:intergenic	25.0%
!	ACCTAAACATCTAAGAAAAT+AGG	-	chr4_1:10852147-10852166	Msa0535040:intron	25.0%
!!	ACCTATTTTCTTAGATGTTT+AGG	+	chr4_1:10852151-10852170	None:intergenic	25.0%
!!!	TTTTTTCCACAAACTTTTGT+TGG	-	chr4_1:10852174-10852193	Msa0535040:CDS	25.0%
!!!	TTTATCAACGATTAGTCTAT+TGG	+	chr4_1:10852438-10852457	None:intergenic	25.0%
!!	ATCGTTGATAAATTTATGAC+TGG	-	chr4_1:10852446-10852465	Msa0535040:CDS	25.0%
!	AATAAACTGCAAAGATCATA+GGG	+	chr4_1:10852603-10852622	None:intergenic	25.0%
!	ATTGTATTCTTGAACGTTTA+AGG	-	chr4_1:10852620-10852639	Msa0535040:CDS	25.0%
!!!	AAATGAGTTTTGTTGTTAAG+TGG	-	chr4_1:10852669-10852688	Msa0535040:exon	25.0%
	GTTAGAGACATTAATTCCAA+TGG	-	chr4_1:10847538-10847557	Msa0535040:three_prime_UTR	30.0%
	GTTTGAGAATCAATTCCATA+AGG	+	chr4_1:10847734-10847753	None:intergenic	30.0%
	AAATGAGCACTCAACTAATA+AGG	+	chr4_1:10847802-10847821	None:intergenic	30.0%
	TAGATCCTCTCATTTATTAG+AGG	+	chr4_1:10848565-10848584	None:intergenic	30.0%
	AAGTTATTAGGGTTAATGCT+TGG	+	chr4_1:10849137-10849156	None:intergenic	30.0%
	GCATTAACCCTAATAACTTT+AGG	-	chr4_1:10849138-10849157	Msa0535040:intron	30.0%
	TTAACCCTAATAACTTTAGG+TGG	-	chr4_1:10849141-10849160	Msa0535040:intron	30.0%
	TAACCCTAATAACTTTAGGT+GGG	-	chr4_1:10849142-10849161	Msa0535040:intron	30.0%
	ATTCCCACCTAAAGTTATTA+GGG	+	chr4_1:10849148-10849167	None:intergenic	30.0%
!	TGAGTATCGCAAAATTCTTA+TGG	-	chr4_1:10849254-10849273	Msa0535040:intron	30.0%
!	TAAACAAAGGGAAGTACATA+AGG	+	chr4_1:10849291-10849310	None:intergenic	30.0%
!	CATTGTTACATCACACTTTT+TGG	-	chr4_1:10849431-10849450	Msa0535040:intron	30.0%
!!!	CACTTTTTGGGTCATAATAT+AGG	-	chr4_1:10849444-10849463	Msa0535040:intron	30.0%
	TGTATCAAAGCCCAATTTAA+AGG	+	chr4_1:10849631-10849650	None:intergenic	30.0%
	ATGTAACGGTAAGATTCAAT+TGG	-	chr4_1:10850285-10850304	Msa0535040:intron	30.0%
!	TATATGGTTATATTTGGTGG+TGG	+	chr4_1:10850363-10850382	None:intergenic	30.0%
!!	TACGGATTGGAAAAAATAGA+GGG	+	chr4_1:10850417-10850436	None:intergenic	30.0%
	ACACAATTGGTATGAATTGT+TGG	+	chr4_1:10850470-10850489	None:intergenic	30.0%
	AATCAACTCAATGCTGAAAT+TGG	-	chr4_1:10850675-10850694	Msa0535040:intron	30.0%
!!	TTAATATGTTTAGCTCTTGG+TGG	-	chr4_1:10851009-10851028	Msa0535040:CDS	30.0%
	TTTGACTAAGTGTAGCTATT+AGG	-	chr4_1:10851081-10851100	Msa0535040:CDS	30.0%
!!	AAAGTATATAGGGTTAGTCT+AGG	+	chr4_1:10851237-10851256	None:intergenic	30.0%
!	GTCACAATGAGTTGAATTTA+TGG	+	chr4_1:10851293-10851312	None:intergenic	30.0%
	ACTCATTGTGACACAAATTA+TGG	-	chr4_1:10851301-10851320	Msa0535040:intron	30.0%
	GACACAAATTATGGATTTCT+TGG	-	chr4_1:10851310-10851329	Msa0535040:intron	30.0%
!!	GTGTAATGTAAGTGTTGAAT+AGG	-	chr4_1:10851375-10851394	Msa0535040:intron	30.0%
!	CTATATTTTCTTGAACGAGT+TGG	+	chr4_1:10851606-10851625	None:intergenic	30.0%
	ACACCATTAGAAAAGTAAGA+TGG	-	chr4_1:10851848-10851867	Msa0535040:intron	30.0%
	AATAATAGTCAAGATTCCAC+TGG	-	chr4_1:10852091-10852110	Msa0535040:intron	30.0%
	ATGCATAAAGATCCCTATTA+GGG	+	chr4_1:10852385-10852404	None:intergenic	30.0%
	AATGCATAAAGATCCCTATT+AGG	+	chr4_1:10852386-10852405	None:intergenic	30.0%
!	ATAGGGATCTTTATGCATTT+TGG	-	chr4_1:10852387-10852406	Msa0535040:intron	30.0%
!	TAGGGATCTTTATGCATTTT+GGG	-	chr4_1:10852388-10852407	Msa0535040:intron	30.0%
	ATTATATGGGTGCATGTAAT+CGG	+	chr4_1:10852477-10852496	None:intergenic	30.0%
	TCTTAGTACACTTATTGCTA+TGG	-	chr4_1:10852496-10852515	Msa0535040:CDS	30.0%
	ATCTAATGCTTCATTCCTAT+AGG	-	chr4_1:10852564-10852583	Msa0535040:CDS	30.0%
	TCTAATGCTTCATTCCTATA+GGG	-	chr4_1:10852565-10852584	Msa0535040:CDS	30.0%
	CAATAAACTGCAAAGATCAT+AGG	+	chr4_1:10852604-10852623	None:intergenic	30.0%
!!!	GCAAGAGCATTTTTTGTGTT+TGG	-	chr4_1:10847644-10847663	Msa0535040:three_prime_UTR	35.0%
!	GGACTCAAATATGGTAATGT+AGG	+	chr4_1:10847963-10847982	None:intergenic	35.0%
	ATTGGAATTCTCAATGACAC+TGG	-	chr4_1:10848035-10848054	Msa0535040:intron	35.0%
	TGTGACCTCTAATAAATGAG+AGG	-	chr4_1:10848557-10848576	Msa0535040:intron	35.0%
	GCAATTACATTTAGCACACA+TGG	+	chr4_1:10848601-10848620	None:intergenic	35.0%
!!	CTCAAAGTTTTGTACACGTA+CGG	+	chr4_1:10848655-10848674	None:intergenic	35.0%
	AGGGATAACTTATCAAACTG+TGG	-	chr4_1:10848727-10848746	Msa0535040:intron	35.0%
	ATGCTAATTGGGCAGTAATT+CGG	+	chr4_1:10849047-10849066	None:intergenic	35.0%
	ACTTTAAACAGTACCAGCAA+AGG	-	chr4_1:10849067-10849086	Msa0535040:intron	35.0%
	CTTTAAACAGTACCAGCAAA+GGG	-	chr4_1:10849068-10849087	Msa0535040:intron	35.0%
	CATTCCCACCTAAAGTTATT+AGG	+	chr4_1:10849149-10849168	None:intergenic	35.0%
	ATGAGGAAGACAACATAATC+AGG	+	chr4_1:10849231-10849250	None:intergenic	35.0%
!	TTTTGCGATACTCAGAAATG+AGG	+	chr4_1:10849248-10849267	None:intergenic	35.0%
!	AAAGGGAAGTACATAAGGAT+AGG	+	chr4_1:10849286-10849305	None:intergenic	35.0%
	CTCCTAAGCCCTAATATATT+TGG	-	chr4_1:10849470-10849489	Msa0535040:CDS	35.0%
	GACCAAATATATTAGGGCTT+AGG	+	chr4_1:10849475-10849494	None:intergenic	35.0%
	GGTAAGAACACATTCAAAGT+TGG	-	chr4_1:10849526-10849545	Msa0535040:CDS	35.0%
	ACTATATTTGCTTCCGTAAC+CGG	-	chr4_1:10849821-10849840	Msa0535040:intron	35.0%
	TGCATAATATATGCAAGGTC+TGG	-	chr4_1:10849925-10849944	Msa0535040:intron	35.0%
!!!	TTATTTTTTTTGGTGGTGGC+CGG	+	chr4_1:10849961-10849980	None:intergenic	35.0%
	AATGTTTGGCAAGCATGTAA+CGG	-	chr4_1:10850271-10850290	Msa0535040:intron	35.0%
	TGTTGAAAGCAGCACATATT+AGG	-	chr4_1:10850309-10850328	Msa0535040:intron	35.0%
!!	GTACGGATTGGAAAAAATAG+AGG	+	chr4_1:10850418-10850437	None:intergenic	35.0%
	AAGTTAGTAGCTGTTTGAAG+AGG	+	chr4_1:10850627-10850646	None:intergenic	35.0%
	GCATAGATGAAGACATGATT+AGG	+	chr4_1:10850705-10850724	None:intergenic	35.0%
!	AAATGCCTTTGCTATGCATT+TGG	-	chr4_1:10850725-10850744	Msa0535040:intron	35.0%
	GAAATCCAAATGCATAGCAA+AGG	+	chr4_1:10850733-10850752	None:intergenic	35.0%
	GTTTCTAATCCACAAGCATA+CGG	-	chr4_1:10850753-10850772	Msa0535040:intron	35.0%
!	AAAAGTTTGTTCCCTACCTA+GGG	-	chr4_1:10850968-10850987	Msa0535040:CDS	35.0%
!	CTCATTCGATTCAAAGTGTT+TGG	-	chr4_1:10851182-10851201	Msa0535040:CDS	35.0%
!	TTCGATTCAAAGTGTTTGGT+TGG	-	chr4_1:10851186-10851205	Msa0535040:CDS	35.0%
	TGTGAATGTAGCTTAAGACA+TGG	-	chr4_1:10851344-10851363	Msa0535040:intron	35.0%
	TGGTAGTCGTCTACATTAAT+GGG	+	chr4_1:10851657-10851676	None:intergenic	35.0%
	ATGGTAGTCGTCTACATTAA+TGG	+	chr4_1:10851658-10851677	None:intergenic	35.0%
!!!	CTTTTCTAATGGTGTTACAG+TGG	+	chr4_1:10851843-10851862	None:intergenic	35.0%
!!	TGGCCATCTTACTTTTCTAA+TGG	+	chr4_1:10851854-10851873	None:intergenic	35.0%
	ATCCATTTGAATAGTGGTTG+TGG	+	chr4_1:10851985-10852004	None:intergenic	35.0%
	TGCAATCATGTTAAATGGTG+TGG	-	chr4_1:10852010-10852029	Msa0535040:intron	35.0%
	GCAATCATGTTAAATGGTGT+GGG	-	chr4_1:10852011-10852030	Msa0535040:intron	35.0%
	CAATCATGTTAAATGGTGTG+GGG	-	chr4_1:10852012-10852031	Msa0535040:intron	35.0%
	AATCATGTTAAATGGTGTGG+GGG	-	chr4_1:10852013-10852032	Msa0535040:intron	35.0%
	ACTATGCCAACAAAAGTTTG+TGG	+	chr4_1:10852183-10852202	None:intergenic	35.0%
	ACATCAAAACATGCATGTTG+TGG	-	chr4_1:10852308-10852327	Msa0535040:intron	35.0%
!	TTCTAACTTGTGCCCTAATA+GGG	-	chr4_1:10852370-10852389	Msa0535040:intron	35.0%
	CACTTATTGCTATGGATTCT+AGG	-	chr4_1:10852504-10852523	Msa0535040:CDS	35.0%
	TTGTTGAACACCAATGCTCA+AGG	+	chr4_1:10847618-10847637	None:intergenic	40.0%
!	TGTGTTTGGTGATTCTCTTG+TGG	-	chr4_1:10847658-10847677	Msa0535040:three_prime_UTR	40.0%
!!	CGTGCTGATTCATATCCTTA+TGG	-	chr4_1:10847716-10847735	Msa0535040:CDS	40.0%
	TCTCAAACTCATAGAGCTTC+TGG	-	chr4_1:10847746-10847765	Msa0535040:CDS	40.0%
	TAATAAGGTCAGGCATGTTG+AGG	+	chr4_1:10847787-10847806	None:intergenic	40.0%
	AGCACTCAACTAATAAGGTC+AGG	+	chr4_1:10847797-10847816	None:intergenic	40.0%
!!	TCAAGCTCTGGACTCAAATA+TGG	+	chr4_1:10847972-10847991	None:intergenic	40.0%
	TATTTGAGTCCAGAGCTTGA+TGG	-	chr4_1:10847972-10847991	Msa0535040:intron	40.0%
	GATGGTGAAAGGTTGCTTAA+TGG	-	chr4_1:10847990-10848009	Msa0535040:intron	40.0%
	ATTGAGAATTCCAATCCCAG+CGG	+	chr4_1:10848030-10848049	None:intergenic	40.0%
	ATTGCTGTGTTAACCGTGAA+AGG	+	chr4_1:10848130-10848149	None:intergenic	40.0%
	ACTTATCAAACTGTGGCTAG+TGG	-	chr4_1:10848734-10848753	Msa0535040:intron	40.0%
	CTTATCAAACTGTGGCTAGT+GGG	-	chr4_1:10848735-10848754	Msa0535040:intron	40.0%
!	CAAAGGGTTAGTGCACTAAT+TGG	-	chr4_1:10849084-10849103	Msa0535040:intron	40.0%
	TGCACTAATTGGAGAAAGTG+AGG	-	chr4_1:10849095-10849114	Msa0535040:intron	40.0%
!	AAGAGCATATTCACGAGATC+TGG	+	chr4_1:10849208-10849227	None:intergenic	40.0%
	TTTCCTTAACCAATGCTCCA+GGG	+	chr4_1:10849721-10849740	None:intergenic	40.0%
!	AAGGTCTGGAGTTAAAATCC+CGG	-	chr4_1:10849939-10849958	Msa0535040:intron	40.0%
!!!	TATTTTTTTTGGTGGTGGCC+GGG	+	chr4_1:10849960-10849979	None:intergenic	40.0%
!!	ATTTGGTGGTGGACTTTATG+TGG	+	chr4_1:10850352-10850371	None:intergenic	40.0%
!	ATTGGGAGCAAGAAGAGTTT+TGG	-	chr4_1:10850527-10850546	Msa0535040:intron	40.0%
!!	AAGAGTTTTGGTGACAGGAA+CGG	-	chr4_1:10850539-10850558	Msa0535040:intron	40.0%
	TTGGCTATGCAAGGAAGAAA+TGG	-	chr4_1:10850588-10850607	Msa0535040:intron	40.0%
	CAACTCAATGCTGAAATTGG+TGG	-	chr4_1:10850678-10850697	Msa0535040:intron	40.0%
	GGAAATATACCGTATGCTTG+TGG	+	chr4_1:10850765-10850784	None:intergenic	40.0%
	GCTTCTAACTAACATGACCA+GGG	+	chr4_1:10850931-10850950	None:intergenic	40.0%
	TGCTTCTAACTAACATGACC+AGG	+	chr4_1:10850932-10850951	None:intergenic	40.0%
!	CTAGGTAGGGAACAAACTTT+TGG	+	chr4_1:10850969-10850988	None:intergenic	40.0%
!	CAAAAGTTTGTTCCCTACCT+AGG	-	chr4_1:10850967-10850986	Msa0535040:CDS	40.0%
	TAAAGACCAAACCCTAGGTA+GGG	+	chr4_1:10850982-10851001	None:intergenic	40.0%
	ATAAAGACCAAACCCTAGGT+AGG	+	chr4_1:10850983-10851002	None:intergenic	40.0%
	AGACATAAAGACCAAACCCT+AGG	+	chr4_1:10850987-10851006	None:intergenic	40.0%
	ATCCTAAGATCTTGGGATAG+TGG	-	chr4_1:10851052-10851071	Msa0535040:CDS	40.0%
	ATCCACTATCCCAAGATCTT+AGG	+	chr4_1:10851057-10851076	None:intergenic	40.0%
	ATCGAAGATATTGCGTGGTT+AGG	+	chr4_1:10851545-10851564	None:intergenic	40.0%
	GTCAAATCGAAGATATTGCG+TGG	+	chr4_1:10851550-10851569	None:intergenic	40.0%
	TAGAAAAGTAAGATGGCCAC+CGG	-	chr4_1:10851855-10851874	Msa0535040:intron	40.0%
	GTCCACAACCACTATTCAAA+TGG	-	chr4_1:10851980-10851999	Msa0535040:intron	40.0%
!!	TGTGGGGGAAATTGACTTTT+GGG	-	chr4_1:10852028-10852047	Msa0535040:intron	40.0%
!!	AATTGACTTTTGGGGACCAA+AGG	-	chr4_1:10852037-10852056	Msa0535040:intron	40.0%
!!	ATTGACTTTTGGGGACCAAA+GGG	-	chr4_1:10852038-10852057	Msa0535040:intron	40.0%
	CATATTAGGAATGGTCCCTT+TGG	+	chr4_1:10852056-10852075	None:intergenic	40.0%
	AAACATGCATGTTGTGGTCA+AGG	-	chr4_1:10852314-10852333	Msa0535040:intron	40.0%
	CATAGTCCAACTCCATTGTA+TGG	+	chr4_1:10852341-10852360	None:intergenic	40.0%
!	CTTCTAACTTGTGCCCTAAT+AGG	-	chr4_1:10852369-10852388	Msa0535040:intron	40.0%
!	CTCTTTCTGATGGATGAAAG+GGG	+	chr4_1:10852415-10852434	None:intergenic	40.0%
!	GCTCTTTCTGATGGATGAAA+GGG	+	chr4_1:10852416-10852435	None:intergenic	40.0%
!!	AGTCTATTGGCTCTTTCTGA+TGG	+	chr4_1:10852425-10852444	None:intergenic	40.0%
!	GTGTTGATCACCTTGAGCAT+TGG	-	chr4_1:10847605-10847624	Msa0535040:three_prime_UTR	45.0%
	GGTGATTCTCTTGTGGACAA+TGG	-	chr4_1:10847665-10847684	Msa0535040:three_prime_UTR	45.0%
	AACCTTTCACCATCAAGCTC+TGG	+	chr4_1:10847984-10848003	None:intergenic	45.0%
!	GTGCTAATTTTGCTTCCGCT+GGG	-	chr4_1:10848012-10848031	Msa0535040:intron	45.0%
!	AATTTTGCTTCCGCTGGGAT+TGG	-	chr4_1:10848017-10848036	Msa0535040:intron	45.0%
	TTAGTGCACTAACCCTTTGC+TGG	+	chr4_1:10849083-10849102	None:intergenic	45.0%
	TTCCTTAACCAATGCTCCAG+GGG	+	chr4_1:10849720-10849739	None:intergenic	45.0%
	GTTTCCTTAACCAATGCTCC+AGG	+	chr4_1:10849722-10849741	None:intergenic	45.0%
	CCAACTGAGCTAAGCTCAAA+AGG	+	chr4_1:10849897-10849916	None:intergenic	45.0%
!	CCTTTTGAGCTTAGCTCAGT+TGG	-	chr4_1:10849894-10849913	Msa0535040:intron	45.0%
!!	GCAAGAAGAGTTTTGGTGAC+AGG	-	chr4_1:10850534-10850553	Msa0535040:intron	45.0%
!!	AGAGTTTTGGTGACAGGAAC+GGG	-	chr4_1:10850540-10850559	Msa0535040:intron	45.0%
	CAAGGAAGAAATGGAGAGTG+TGG	-	chr4_1:10850597-10850616	Msa0535040:intron	45.0%
	TTTGTTCCCTACCTAGGGTT+TGG	-	chr4_1:10850973-10850992	Msa0535040:CDS	45.0%
!!	ATGTTTAGCTCTTGGTGGCT+AGG	-	chr4_1:10851014-10851033	Msa0535040:CDS	45.0%
	GTGGTTAGGTTTGAGTCAAG+TGG	+	chr4_1:10851531-10851550	None:intergenic	45.0%
!	TGAATAGTGGTTGTGGACTG+TGG	+	chr4_1:10851978-10851997	None:intergenic	45.0%
!!	GTGTGGGGGAAATTGACTTT+TGG	-	chr4_1:10852027-10852046	Msa0535040:intron	45.0%
!!	GTGGGGGAAATTGACTTTTG+GGG	-	chr4_1:10852029-10852048	Msa0535040:intron	45.0%
	TTTCAATGAGCATGGTCCAG+TGG	+	chr4_1:10852110-10852129	None:intergenic	45.0%
	TGTGGTCAAGGACCATACAA+TGG	-	chr4_1:10852326-10852345	Msa0535040:intron	45.0%
	CAAGGACCATACAATGGAGT+TGG	-	chr4_1:10852332-10852351	Msa0535040:intron	45.0%
	TTAGGGCACAAGTTAGAAGC+TGG	+	chr4_1:10852368-10852387	None:intergenic	45.0%
!	GGCTCTTTCTGATGGATGAA+AGG	+	chr4_1:10852417-10852436	None:intergenic	45.0%
	TGAATCAGCACGAGCAGTAG+TGG	+	chr4_1:10847708-10847727	None:intergenic	50.0%
	GCTTCTGGTCGTTTCTCCAA+TGG	-	chr4_1:10847761-10847780	Msa0535040:CDS	50.0%
!!	GTCCAGAGCTTGATGGTGAA+AGG	-	chr4_1:10847979-10847998	Msa0535040:intron	50.0%
!	GGTGCTAATTTTGCTTCCGC+TGG	-	chr4_1:10848011-10848030	Msa0535040:intron	50.0%
	TCACGAGATCTGGCTGAGTA+GGG	+	chr4_1:10849198-10849217	None:intergenic	50.0%
	TTCACGAGATCTGGCTGAGT+AGG	+	chr4_1:10849199-10849218	None:intergenic	50.0%
	AGGTTGTGTGCCAGCAGAAT+TGG	-	chr4_1:10850569-10850588	Msa0535040:intron	50.0%
	CCTTGCATAGCCAATTCTGC+TGG	+	chr4_1:10850582-10850601	None:intergenic	50.0%
	CCAGCAGAATTGGCTATGCA+AGG	-	chr4_1:10850579-10850598	Msa0535040:intron	50.0%
	TAAATTGTTAGGTCCGGCCC+TGG	-	chr4_1:10850911-10850930	Msa0535040:intron	50.0%
	CTAACTAACATGACCAGGGC+CGG	+	chr4_1:10850927-10850946	None:intergenic	50.0%
!!	ATTAGGGGTGCTTGTGCAGA+TGG	-	chr4_1:10851134-10851153	Msa0535040:CDS	50.0%
!!	TTAGGGGTGCTTGTGCAGAT+GGG	-	chr4_1:10851135-10851154	Msa0535040:CDS	50.0%
	TGTGTGTCCGTAGAGCTCAT+GGG	-	chr4_1:10851891-10851910	Msa0535040:intron	50.0%
	GCTTCATTCCTATAGGGTCG+TGG	-	chr4_1:10852571-10852590	Msa0535040:CDS	50.0%
	GGTTACAACCACGACCCTAT+AGG	+	chr4_1:10852582-10852601	None:intergenic	50.0%
	GTCAGGCATGTTGAGGCCAT+TGG	+	chr4_1:10847780-10847799	None:intergenic	55.0%
	GTTATGTTAACCGGTGCCCC+TGG	-	chr4_1:10849701-10849720	Msa0535040:CDS	55.0%
!!	TGCCCCTGGAGCATTGGTTA+AGG	-	chr4_1:10849715-10849734	Msa0535040:intron	55.0%
	AATGTTAACCGGTGCCCCTG+AGG	+	chr4_1:10849849-10849868	None:intergenic	55.0%
	TCTGCTGGCACACAACCTAG+TGG	+	chr4_1:10850567-10850586	None:intergenic	55.0%
	TAAGATGGCCACCGGAGCAA+TGG	-	chr4_1:10851863-10851882	Msa0535040:intron	55.0%
	CACACACAAGGCCATTGCTC+CGG	+	chr4_1:10851877-10851896	None:intergenic	55.0%
	GAGCTCTACGGACACACACA+AGG	+	chr4_1:10851889-10851908	None:intergenic	55.0%
	GTGTGTGTCCGTAGAGCTCA+TGG	-	chr4_1:10851890-10851909	Msa0535040:intron	55.0%
	TGTCCGTAGAGCTCATGGGT+TGG	-	chr4_1:10851895-10851914	Msa0535040:intron	55.0%
	GTCCGTAGAGCTCATGGGTT+GGG	-	chr4_1:10851896-10851915	Msa0535040:intron	55.0%
!	TCCGTAGAGCTCATGGGTTG+GGG	-	chr4_1:10851897-10851916	Msa0535040:intron	55.0%
!!	CTCATGGGTTGGGGCCTATA+TGG	-	chr4_1:10851906-10851925	Msa0535040:intron	55.0%
	CAGCACGAGCAGTAGTGGCT+AGG	+	chr4_1:10847703-10847722	None:intergenic	60.0%
!	AACCAATGCTCCAGGGGCAC+CGG	+	chr4_1:10849714-10849733	None:intergenic	60.0%
	CTTCCGTAACCGGTGCCTCA+GGG	-	chr4_1:10849831-10849850	Msa0535040:intron	60.0%
	TTCCGTAACCGGTGCCTCAG+GGG	-	chr4_1:10849832-10849851	Msa0535040:intron	60.0%
	GTGACAGGAACGGGACCACT+AGG	-	chr4_1:10850549-10850568	Msa0535040:intron	60.0%
	ACACAAGGCCATTGCTCCGG+TGG	+	chr4_1:10851874-10851893	None:intergenic	60.0%
	GCCCCAACCCATGAGCTCTA+CGG	+	chr4_1:10851901-10851920	None:intergenic	60.0%
	AACCGGTGCCCCTGGAGCAT+TGG	-	chr4_1:10849709-10849728	Msa0535040:intron	65.0%
	GCTTCCGTAACCGGTGCCTC+AGG	-	chr4_1:10849830-10849849	Msa0535040:intron	65.0%
!!	TGCCCCTGAGGCACCGGTTA+CGG	+	chr4_1:10849837-10849856	None:intergenic	65.0%
!	AACCGGTGCCTCAGGGGCAC+CGG	-	chr4_1:10849838-10849857	Msa0535040:intron	70.0%
	AACCGGTGCCCCTGAGGCAC+CGG	+	chr4_1:10849843-10849862	None:intergenic	70.0%

Chromosome	Type	Strat	End	Strand	Name
chr4_1	gene	10847522	10852717	10847522	ID=Msa0535040;Name=Msa0535040
chr4_1	mRNA	10847522	10852717	10847522	ID=Msa0535040-mRNA-1;Parent=Msa0535040;Name=Msa0535040-mRNA-1;_AED=0.11;_eAED=0.11;_QI=35\|1\|1\|1\|1\|1\|5\|185\|370
chr4_1	exon	10847522	10847939	10847522	ID=Msa0535040-mRNA-1:exon:3509;Parent=Msa0535040-mRNA-1
chr4_1	exon	10849465	10849723	10849465	ID=Msa0535040-mRNA-1:exon:3508;Parent=Msa0535040-mRNA-1
chr4_1	exon	10850964	10851206	10850964	ID=Msa0535040-mRNA-1:exon:3507;Parent=Msa0535040-mRNA-1
chr4_1	exon	10852172	10852299	10852172	ID=Msa0535040-mRNA-1:exon:3506;Parent=Msa0535040-mRNA-1
chr4_1	exon	10852433	10852717	10852433	ID=Msa0535040-mRNA-1:exon:3505;Parent=Msa0535040-mRNA-1
chr4_1	five_prime_UTR	10852683	10852717	10852683	ID=Msa0535040-mRNA-1:five_prime_utr;Parent=Msa0535040-mRNA-1
chr4_1	CDS	10852433	10852682	10852433	ID=Msa0535040-mRNA-1:cds;Parent=Msa0535040-mRNA-1
chr4_1	CDS	10852172	10852299	10852172	ID=Msa0535040-mRNA-1:cds;Parent=Msa0535040-mRNA-1
chr4_1	CDS	10850964	10851206	10850964	ID=Msa0535040-mRNA-1:cds;Parent=Msa0535040-mRNA-1
chr4_1	CDS	10849465	10849723	10849465	ID=Msa0535040-mRNA-1:cds;Parent=Msa0535040-mRNA-1
chr4_1	CDS	10847707	10847939	10847707	ID=Msa0535040-mRNA-1:cds;Parent=Msa0535040-mRNA-1
chr4_1	three_prime_UTR	10847522	10847706	10847522	ID=Msa0535040-mRNA-1:three_prime_utr;Parent=Msa0535040-mRNA-1

Gene Sequence

>Msa0535040

ATGGAACAAAAAAACCAAATGAATATTATTCCTTCAATATTTCTTTGTGTGTTGATCACCTTGAGCATTGGTGTTCAACAAATTGAAGCAAGAGCATTTTTTGTGTTTGGTGATTCTCTTGTGGACAATGGAAATAATAACTTCCTAGCCACTACTGCTCGTGCTGATTCATATCCTTATGGAATTGATTCTCAAACTCATAGAGCTTCTGGTCGTTTCTCCAATGGCCTCAACATGCCTGACCTTATTAGTGAAAAAATTGGGTCAGAGCCTACATTACCATATTTGAGTCCAGAGCTTGATGGTGAAAGGTTGCTTAATGGTGCTAATTTTGCTTCCGCTGGGATTGGAATTCTCAATGACACTGGAGTTCAGTTTATTAACATAATCCGAATTACTGCCCAATTAGCATACTTTAAACAGTACCAGCAAAGGGTTAGTGCACTAATTGGAGAAAGTGAGGCACAAAAATTAGTGAACCAAGCATTAACCCTAATAACTTTAGGTGGGAATGATTTTGTGAACAACTATTATTTGGTTCCCTACTCAGCCAGATCTCGTGAATATGCTCTTCCTGATTATGTTGTCTTCCTCATTTCTGAGTATCGCAAAATTCTTATGAATCTATATGAATTGGGAGCAAGAAGAGTTTTGGTGACAGGAACGGGACCACTAGGTTGTGTGCCAGCAGAATTGGCTATGCAAGGAAGAAATGGAGAGTGTGGTGTTCCTCTTCAAACAGCTACTAACTTGTTCAATCCTCAACTTGTTCAATTGATTAATCAACTCAATGCTGAAATTGGTGGTCCTAATCATGTCTTCATCTATGCAAATGCCTTTGCTATGCATTTGGATTTCGTTTCTAATCCACAAGCATACGGATTTGAAACATCAAAACATGCATGTTGTGGTCAAGGACCATACAATGGAGTTGGACTATGTACTCCAGCTTCTAACTTGTGCCCTAATAGGGATCTTTATGCATTTTGGGACCCCTTTCATCCATCAGAAAGAGCCAATAGACTAATCGTTGATAAATTTATGACTGGAACTACCGATTACATGCACCCATATAATCTTAGTACACTTATTGCTATGGATTCTAGGACCTAA

Protein sequence

>Msa0535040

MEQKNQMNIIPSIFLCVLITLSIGVQQIEARAFFVFGDSLVDNGNNNFLATTARADSYPYGIDSQTHRASGRFSNGLNMPDLISEKIGSEPTLPYLSPELDGERLLNGANFASAGIGILNDTGVQFINIIRITAQLAYFKQYQQRVSALIGESEAQKLVNQALTLITLGGNDFVNNYYLVPYSARSREYALPDYVVFLISEYRKILMNLYELGARRVLVTGTGPLGCVPAELAMQGRNGECGVPLQTATNLFNPQLVQLINQLNAEIGGPNHVFIYANAFAMHLDFVSNPQAYGFETSKHACCGQGPYNGVGLCTPASNLCPNRDLYAFWDPFHPSERANRLIVDKFMTGTTDYMHPYNLSTLIAMDSRT*